-
Notifications
You must be signed in to change notification settings - Fork 74
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
- Loading branch information
Showing
3 changed files
with
206 additions
and
91 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -1,97 +1,22 @@ | ||
# Enzyme Optimization Experiment | ||
# Enzyme Optimization in Biocatalytic Reactions | ||
|
||
## Description | ||
This script performs an optimization experiment for enzyme sequences using different mutation strategies. | ||
This repository provides an exmaple on how ro run the framework for the optimization of enzymes within the context of biocatalytic reactions. | ||
|
||
## Import modules | ||
```python | ||
import logging | ||
import pandas as pd | ||
from gt4sd.frameworks.enzeptional.processing import HFandTAPEModelUtility | ||
from gt4sd.frameworks.enzeptional.core import SequenceMutator, EnzymeOptimizer | ||
from gt4sd.configuration import sync_algorithm_with_s3 | ||
from gt4sd.configuration import GT4SDConfiguration | ||
configuration = GT4SDConfiguration.get_instance() | ||
``` | ||
## Prerequisites | ||
|
||
## Load datasets and scorers | ||
```python | ||
sync_algorithm_with_s3("proteins/enzeptional/scorers", module="properties") | ||
``` | ||
Feasibility scorer path | ||
```python | ||
scorer_path = f"{configuration.gt4sd_local_cache_path}/properties/proteins/enzeptional/scorers/feasibility/model.pkl" | ||
``` | ||
## Set embedding model/tokenizer paths | ||
```python | ||
language_model_path = "facebook/esm2_t33_650M_UR50D" | ||
tokenizer_path = "facebook/esm2_t33_650M_UR50D" | ||
unmasking_model_path = "facebook/esm2_t33_650M_UR50D" | ||
chem_model_path = "seyonec/ChemBERTa-zinc-base-v1" | ||
chem_tokenizer_path = "seyonec/ChemBERTa-zinc-base-v1" | ||
``` | ||
## Load protein embedding model | ||
```python | ||
protein_model = HFandTAPEModelUtility( | ||
embedding_model_path=language_model_path, tokenizer_path=tokenizer_path | ||
) | ||
``` | ||
## Create mutation config | ||
```python | ||
mutation_config = { | ||
"type": "language-modeling", | ||
"embedding_model_path": language_model_path, | ||
"tokenizer_path": tokenizer_path, | ||
"unmasking_model_path": unmasking_model_path, | ||
} | ||
``` | ||
## Set key parameters | ||
```python | ||
intervals = [(5, 10), (20, 25)] | ||
batch_size = 5 | ||
top_k = 3 | ||
substrate_smiles = "NC1=CC=C(N)C=C1" | ||
product_smiles = "CNC1=CC=C(NC(=O)C2=CC=C(C=C2)C(C)=O)C=C1" | ||
Before initiating the enzyme optimization process, execute the following command in your terminal to activate the environment: | ||
|
||
sample_sequence = "MSKLLMIGTGPVAIDQFLTRYEASCQAYKDMHQDQQLSSQFNTNLFEGDKALVTKFLEINRTLS" | ||
```console | ||
conda activate gt4sd | ||
``` | ||
## Load mutator | ||
```python | ||
mutator = SequenceMutator(sequence=sample_sequence, mutation_config=mutation_config) | ||
``` | ||
## Set Optimizer | ||
```python | ||
optimizer = EnzymeOptimizer( | ||
sequence=sample_sequence, | ||
protein_model=protein_model, | ||
substrate_smiles=substrate_smiles, | ||
product_smiles=product_smiles, | ||
chem_model_path=chem_model_path, | ||
chem_tokenizer_path=chem_tokenizer_path, | ||
scorer_filepath=scorer_path, | ||
mutator=mutator, | ||
intervals=intervals, | ||
batch_size=batch_size, | ||
top_k=top_k, | ||
selection_ratio=0.25, | ||
perform_crossover=True, | ||
crossover_type="single_point", | ||
concat_order=["substrate", "sequence", "product"], | ||
) | ||
``` | ||
## Define optmization parameters | ||
```python | ||
num_iterations = 3 | ||
num_sequences = 5 | ||
num_mutations = 5 | ||
time_budget = 3600 | ||
``` | ||
## Optimize | ||
```python | ||
optimized_sequences, iteration_info = optimizer.optimize( | ||
num_iterations=num_iterations, | ||
num_sequences=num_sequences, | ||
num_mutations=num_mutations, | ||
time_budget=time_budget, | ||
) | ||
|
||
## Citation | ||
|
||
```bibtex | ||
@inproceedings{teukam2023enzyme, | ||
title={Enzyme optimization via a generative language modeling-based evolutionary algorithm}, | ||
author={Teukam, Yves Gaetan Nana and Grisoni, Francesca and Manica, Matteo and Zipoli, Federico and Laino, Teodoro}, | ||
booktitle={American Chemical Society (ACS) Spring Meeting}, | ||
year={2023} | ||
} | ||
``` |
Oops, something went wrong.