diff --git a/go.mod b/go.mod
index 9ea5a1341ed..b2c38c1e8bb 100644
--- a/go.mod
+++ b/go.mod
@@ -38,8 +38,8 @@ require (
 	github.com/willf/bitset v1.1.10
 	go.etcd.io/etcd v0.5.0-alpha.5.0.20181228115726-23731bf9ba55
 	go.uber.org/zap v1.14.1
-	golang.org/x/crypto v0.1.0
-	golang.org/x/tools v0.1.12
+	golang.org/x/crypto v0.17.0
+	golang.org/x/tools v0.6.0
 	google.golang.org/grpc v1.29.1
 	gopkg.in/alecthomas/kingpin.v2 v2.2.6
 	gopkg.in/cheggaaa/pb.v1 v1.0.28
@@ -99,10 +99,10 @@ require (
 	go.opencensus.io v0.22.2 // indirect
 	go.uber.org/atomic v1.6.0 // indirect
 	go.uber.org/multierr v1.5.0 // indirect
-	golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4 // indirect
-	golang.org/x/net v0.7.0 // indirect
-	golang.org/x/sys v0.5.0 // indirect
-	golang.org/x/text v0.7.0 // indirect
+	golang.org/x/mod v0.8.0 // indirect
+	golang.org/x/net v0.10.0 // indirect
+	golang.org/x/sys v0.15.0 // indirect
+	golang.org/x/text v0.14.0 // indirect
 	golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1 // indirect
 	google.golang.org/genproto v0.0.0-20190819201941-24fa4b261c55 // indirect
 	gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect
diff --git a/go.sum b/go.sum
index 5ec7ab8104f..9cf6b7d35f8 100644
--- a/go.sum
+++ b/go.sum
@@ -503,8 +503,8 @@ golang.org/x/crypto v0.0.0-20190510104115-cbcb75029529/go.mod h1:yigFU9vqHzYiE8U
 golang.org/x/crypto v0.0.0-20190701094942-4def268fd1a4/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
 golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
 golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
-golang.org/x/crypto v0.1.0 h1:MDRAIl0xIo9Io2xV565hzXHw3zVseKrJKodhohM5CjU=
-golang.org/x/crypto v0.1.0/go.mod h1:RecgLatLF4+eUMCP1PoPZQb+cVrJcOPbHkTkbkB9sbw=
+golang.org/x/crypto v0.17.0 h1:r8bRNjWL3GshPW3gkd+RpvzWrZAwPS49OmTGZ/uhM4k=
+golang.org/x/crypto v0.17.0/go.mod h1:gCAAfMLgwOJRpTjQ2zCCt2OcSfYMTeZVSRtQlPC7Nq4=
 golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
 golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
@@ -516,8 +516,8 @@ golang.org/x/mod v0.0.0-20190513183733-4bf6d317e70e/go.mod h1:mXi4GBBbnImb6dmsKG
 golang.org/x/mod v0.1.1-0.20191105210325-c90efee705ee/go.mod h1:QqPTAvyqsEbceGzBzNggFXnrqF1CaUcvgkdR5Ot7KZg=
 golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
 golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
-golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4 h1:6zppjxzCulZykYSLyVDYbneBfbaBIQPYMevg0bEwv2s=
-golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4=
+golang.org/x/mod v0.8.0 h1:LUYupSeNrTNCGzR/hVBk2NHZO4hXcVaW1k4Qx7rjPx8=
+golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
 golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
 golang.org/x/net v0.0.0-20180826012351-8a410e7b638d/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
 golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
@@ -542,8 +542,8 @@ golang.org/x/net v0.0.0-20200625001655-4c5254603344/go.mod h1:/O7V0waA8r7cgGh81R
 golang.org/x/net v0.0.0-20200813134508-3edf25e44fcc/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA=
 golang.org/x/net v0.0.0-20201021035429-f5854403a974/go.mod h1:sp8m0HH+o8qH0wwXwYZr8TS3Oi6o0r6Gce1SSxlDquU=
 golang.org/x/net v0.0.0-20201224014010-6772e930b67b/go.mod h1:m0MpNAwzfU5UDzcl9v0D8zg8gWTRqZa9RBIspLL5mdg=
-golang.org/x/net v0.7.0 h1:rJrUqqhjsgNp7KqAIc25s9pZnjU7TUcSY7HcVZjdn1g=
-golang.org/x/net v0.7.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs=
+golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M=
+golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
 golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U=
 golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw=
 golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
@@ -554,6 +554,7 @@ golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJ
 golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
 golang.org/x/sync v0.0.0-20201207232520-09787c993a3a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
+golang.org/x/sync v0.1.0 h1:wsuoTGHzEhffawBOhz5CYhcrV4IdKZbEyZjBMuTp12o=
 golang.org/x/sys v0.0.0-20180823144017-11551d06cbcc/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
 golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
@@ -597,16 +598,16 @@ golang.org/x/sys v0.0.0-20210906170528-6f6e22806c34/go.mod h1:oPkhp1MJrh7nUepCBc
 golang.org/x/sys v0.0.0-20211025201205-69cdffdb9359/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20211116061358-0a5406a5449c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
 golang.org/x/sys v0.0.0-20220204135822-1c1b9b1eba6a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.5.0 h1:MUK/U/4lj1t1oPg0HfuXDN/Z1wv31ZJ/YcPiGccS4DU=
-golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.15.0 h1:h48lPFYpsTvQJZF4EKyI4aLHaev3CxivZmv7yZig9pc=
+golang.org/x/sys v0.15.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA=
 golang.org/x/term v0.0.0-20201113234701-d7a72108b828/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw=
 golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
-golang.org/x/term v0.5.0 h1:n2a8QNdAb0sZNpU9R1ALUXBbY+w51fCQDN+7EdxNBsY=
+golang.org/x/term v0.15.0 h1:y/Oo/a/q3IXu26lQgl04j/gjuBDOBlx7X6Om1j2CPW4=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.7.0 h1:4BRB4x83lYWy72KwLD/qYDuTu7q9PjSagHvijDw7cLo=
-golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8=
+golang.org/x/text v0.14.0 h1:ScX5w1eTa3QqT8oi6+ziP7dTV1S2+ALU0bI+0zXKWiQ=
+golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU=
 golang.org/x/time v0.0.0-20180412165947-fbb02b2291d2/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
 golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
 golang.org/x/tools v0.0.0-20180221164845-07fd8470d635/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
@@ -627,8 +628,8 @@ golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtn
 golang.org/x/tools v0.0.0-20200103221440-774c71fcf114/go.mod h1:TB2adYChydJhpapKDTa4BR/hXlZSLoq2Wpct/0txZ28=
 golang.org/x/tools v0.0.0-20200619180055-7c47624df98f/go.mod h1:EkVYQZoAsY45+roYkvgYkIh4xh/qjgUK9TdY2XT94GE=
 golang.org/x/tools v0.0.0-20210106214847-113979e3529a/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA=
-golang.org/x/tools v0.1.12 h1:VveCTK38A2rkS8ZqFY25HIDFscX5X9OoEhJd3quQmXU=
-golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc=
+golang.org/x/tools v0.6.0 h1:BOw41kyTf3PuCW1pVQf8+Cyg8pMlkYB1oo9iJ6D/lKM=
+golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU=
 golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
 golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
diff --git a/vendor/golang.org/x/crypto/sha3/hashes_generic.go b/vendor/golang.org/x/crypto/sha3/hashes_generic.go
index c74fc20fcb3..fe8c84793c0 100644
--- a/vendor/golang.org/x/crypto/sha3/hashes_generic.go
+++ b/vendor/golang.org/x/crypto/sha3/hashes_generic.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !gc || purego || !s390x
-// +build !gc purego !s390x
 
 package sha3
 
diff --git a/vendor/golang.org/x/crypto/sha3/keccakf.go b/vendor/golang.org/x/crypto/sha3/keccakf.go
index 0f4ae8bacff..ce48b1dd3ed 100644
--- a/vendor/golang.org/x/crypto/sha3/keccakf.go
+++ b/vendor/golang.org/x/crypto/sha3/keccakf.go
@@ -3,10 +3,11 @@
 // license that can be found in the LICENSE file.
 
 //go:build !amd64 || purego || !gc
-// +build !amd64 purego !gc
 
 package sha3
 
+import "math/bits"
+
 // rc stores the round constants for use in the ι step.
 var rc = [24]uint64{
 	0x0000000000000001,
@@ -60,13 +61,13 @@ func keccakF1600(a *[25]uint64) {
 
 		bc0 = a[0] ^ d0
 		t = a[6] ^ d1
-		bc1 = t<<44 | t>>(64-44)
+		bc1 = bits.RotateLeft64(t, 44)
 		t = a[12] ^ d2
-		bc2 = t<<43 | t>>(64-43)
+		bc2 = bits.RotateLeft64(t, 43)
 		t = a[18] ^ d3
-		bc3 = t<<21 | t>>(64-21)
+		bc3 = bits.RotateLeft64(t, 21)
 		t = a[24] ^ d4
-		bc4 = t<<14 | t>>(64-14)
+		bc4 = bits.RotateLeft64(t, 14)
 		a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i]
 		a[6] = bc1 ^ (bc3 &^ bc2)
 		a[12] = bc2 ^ (bc4 &^ bc3)
@@ -74,15 +75,15 @@ func keccakF1600(a *[25]uint64) {
 		a[24] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[10] ^ d0
-		bc2 = t<<3 | t>>(64-3)
+		bc2 = bits.RotateLeft64(t, 3)
 		t = a[16] ^ d1
-		bc3 = t<<45 | t>>(64-45)
+		bc3 = bits.RotateLeft64(t, 45)
 		t = a[22] ^ d2
-		bc4 = t<<61 | t>>(64-61)
+		bc4 = bits.RotateLeft64(t, 61)
 		t = a[3] ^ d3
-		bc0 = t<<28 | t>>(64-28)
+		bc0 = bits.RotateLeft64(t, 28)
 		t = a[9] ^ d4
-		bc1 = t<<20 | t>>(64-20)
+		bc1 = bits.RotateLeft64(t, 20)
 		a[10] = bc0 ^ (bc2 &^ bc1)
 		a[16] = bc1 ^ (bc3 &^ bc2)
 		a[22] = bc2 ^ (bc4 &^ bc3)
@@ -90,15 +91,15 @@ func keccakF1600(a *[25]uint64) {
 		a[9] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[20] ^ d0
-		bc4 = t<<18 | t>>(64-18)
+		bc4 = bits.RotateLeft64(t, 18)
 		t = a[1] ^ d1
-		bc0 = t<<1 | t>>(64-1)
+		bc0 = bits.RotateLeft64(t, 1)
 		t = a[7] ^ d2
-		bc1 = t<<6 | t>>(64-6)
+		bc1 = bits.RotateLeft64(t, 6)
 		t = a[13] ^ d3
-		bc2 = t<<25 | t>>(64-25)
+		bc2 = bits.RotateLeft64(t, 25)
 		t = a[19] ^ d4
-		bc3 = t<<8 | t>>(64-8)
+		bc3 = bits.RotateLeft64(t, 8)
 		a[20] = bc0 ^ (bc2 &^ bc1)
 		a[1] = bc1 ^ (bc3 &^ bc2)
 		a[7] = bc2 ^ (bc4 &^ bc3)
@@ -106,15 +107,15 @@ func keccakF1600(a *[25]uint64) {
 		a[19] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[5] ^ d0
-		bc1 = t<<36 | t>>(64-36)
+		bc1 = bits.RotateLeft64(t, 36)
 		t = a[11] ^ d1
-		bc2 = t<<10 | t>>(64-10)
+		bc2 = bits.RotateLeft64(t, 10)
 		t = a[17] ^ d2
-		bc3 = t<<15 | t>>(64-15)
+		bc3 = bits.RotateLeft64(t, 15)
 		t = a[23] ^ d3
-		bc4 = t<<56 | t>>(64-56)
+		bc4 = bits.RotateLeft64(t, 56)
 		t = a[4] ^ d4
-		bc0 = t<<27 | t>>(64-27)
+		bc0 = bits.RotateLeft64(t, 27)
 		a[5] = bc0 ^ (bc2 &^ bc1)
 		a[11] = bc1 ^ (bc3 &^ bc2)
 		a[17] = bc2 ^ (bc4 &^ bc3)
@@ -122,15 +123,15 @@ func keccakF1600(a *[25]uint64) {
 		a[4] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[15] ^ d0
-		bc3 = t<<41 | t>>(64-41)
+		bc3 = bits.RotateLeft64(t, 41)
 		t = a[21] ^ d1
-		bc4 = t<<2 | t>>(64-2)
+		bc4 = bits.RotateLeft64(t, 2)
 		t = a[2] ^ d2
-		bc0 = t<<62 | t>>(64-62)
+		bc0 = bits.RotateLeft64(t, 62)
 		t = a[8] ^ d3
-		bc1 = t<<55 | t>>(64-55)
+		bc1 = bits.RotateLeft64(t, 55)
 		t = a[14] ^ d4
-		bc2 = t<<39 | t>>(64-39)
+		bc2 = bits.RotateLeft64(t, 39)
 		a[15] = bc0 ^ (bc2 &^ bc1)
 		a[21] = bc1 ^ (bc3 &^ bc2)
 		a[2] = bc2 ^ (bc4 &^ bc3)
@@ -151,13 +152,13 @@ func keccakF1600(a *[25]uint64) {
 
 		bc0 = a[0] ^ d0
 		t = a[16] ^ d1
-		bc1 = t<<44 | t>>(64-44)
+		bc1 = bits.RotateLeft64(t, 44)
 		t = a[7] ^ d2
-		bc2 = t<<43 | t>>(64-43)
+		bc2 = bits.RotateLeft64(t, 43)
 		t = a[23] ^ d3
-		bc3 = t<<21 | t>>(64-21)
+		bc3 = bits.RotateLeft64(t, 21)
 		t = a[14] ^ d4
-		bc4 = t<<14 | t>>(64-14)
+		bc4 = bits.RotateLeft64(t, 14)
 		a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+1]
 		a[16] = bc1 ^ (bc3 &^ bc2)
 		a[7] = bc2 ^ (bc4 &^ bc3)
@@ -165,15 +166,15 @@ func keccakF1600(a *[25]uint64) {
 		a[14] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[20] ^ d0
-		bc2 = t<<3 | t>>(64-3)
+		bc2 = bits.RotateLeft64(t, 3)
 		t = a[11] ^ d1
-		bc3 = t<<45 | t>>(64-45)
+		bc3 = bits.RotateLeft64(t, 45)
 		t = a[2] ^ d2
-		bc4 = t<<61 | t>>(64-61)
+		bc4 = bits.RotateLeft64(t, 61)
 		t = a[18] ^ d3
-		bc0 = t<<28 | t>>(64-28)
+		bc0 = bits.RotateLeft64(t, 28)
 		t = a[9] ^ d4
-		bc1 = t<<20 | t>>(64-20)
+		bc1 = bits.RotateLeft64(t, 20)
 		a[20] = bc0 ^ (bc2 &^ bc1)
 		a[11] = bc1 ^ (bc3 &^ bc2)
 		a[2] = bc2 ^ (bc4 &^ bc3)
@@ -181,15 +182,15 @@ func keccakF1600(a *[25]uint64) {
 		a[9] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[15] ^ d0
-		bc4 = t<<18 | t>>(64-18)
+		bc4 = bits.RotateLeft64(t, 18)
 		t = a[6] ^ d1
-		bc0 = t<<1 | t>>(64-1)
+		bc0 = bits.RotateLeft64(t, 1)
 		t = a[22] ^ d2
-		bc1 = t<<6 | t>>(64-6)
+		bc1 = bits.RotateLeft64(t, 6)
 		t = a[13] ^ d3
-		bc2 = t<<25 | t>>(64-25)
+		bc2 = bits.RotateLeft64(t, 25)
 		t = a[4] ^ d4
-		bc3 = t<<8 | t>>(64-8)
+		bc3 = bits.RotateLeft64(t, 8)
 		a[15] = bc0 ^ (bc2 &^ bc1)
 		a[6] = bc1 ^ (bc3 &^ bc2)
 		a[22] = bc2 ^ (bc4 &^ bc3)
@@ -197,15 +198,15 @@ func keccakF1600(a *[25]uint64) {
 		a[4] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[10] ^ d0
-		bc1 = t<<36 | t>>(64-36)
+		bc1 = bits.RotateLeft64(t, 36)
 		t = a[1] ^ d1
-		bc2 = t<<10 | t>>(64-10)
+		bc2 = bits.RotateLeft64(t, 10)
 		t = a[17] ^ d2
-		bc3 = t<<15 | t>>(64-15)
+		bc3 = bits.RotateLeft64(t, 15)
 		t = a[8] ^ d3
-		bc4 = t<<56 | t>>(64-56)
+		bc4 = bits.RotateLeft64(t, 56)
 		t = a[24] ^ d4
-		bc0 = t<<27 | t>>(64-27)
+		bc0 = bits.RotateLeft64(t, 27)
 		a[10] = bc0 ^ (bc2 &^ bc1)
 		a[1] = bc1 ^ (bc3 &^ bc2)
 		a[17] = bc2 ^ (bc4 &^ bc3)
@@ -213,15 +214,15 @@ func keccakF1600(a *[25]uint64) {
 		a[24] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[5] ^ d0
-		bc3 = t<<41 | t>>(64-41)
+		bc3 = bits.RotateLeft64(t, 41)
 		t = a[21] ^ d1
-		bc4 = t<<2 | t>>(64-2)
+		bc4 = bits.RotateLeft64(t, 2)
 		t = a[12] ^ d2
-		bc0 = t<<62 | t>>(64-62)
+		bc0 = bits.RotateLeft64(t, 62)
 		t = a[3] ^ d3
-		bc1 = t<<55 | t>>(64-55)
+		bc1 = bits.RotateLeft64(t, 55)
 		t = a[19] ^ d4
-		bc2 = t<<39 | t>>(64-39)
+		bc2 = bits.RotateLeft64(t, 39)
 		a[5] = bc0 ^ (bc2 &^ bc1)
 		a[21] = bc1 ^ (bc3 &^ bc2)
 		a[12] = bc2 ^ (bc4 &^ bc3)
@@ -242,13 +243,13 @@ func keccakF1600(a *[25]uint64) {
 
 		bc0 = a[0] ^ d0
 		t = a[11] ^ d1
-		bc1 = t<<44 | t>>(64-44)
+		bc1 = bits.RotateLeft64(t, 44)
 		t = a[22] ^ d2
-		bc2 = t<<43 | t>>(64-43)
+		bc2 = bits.RotateLeft64(t, 43)
 		t = a[8] ^ d3
-		bc3 = t<<21 | t>>(64-21)
+		bc3 = bits.RotateLeft64(t, 21)
 		t = a[19] ^ d4
-		bc4 = t<<14 | t>>(64-14)
+		bc4 = bits.RotateLeft64(t, 14)
 		a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+2]
 		a[11] = bc1 ^ (bc3 &^ bc2)
 		a[22] = bc2 ^ (bc4 &^ bc3)
@@ -256,15 +257,15 @@ func keccakF1600(a *[25]uint64) {
 		a[19] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[15] ^ d0
-		bc2 = t<<3 | t>>(64-3)
+		bc2 = bits.RotateLeft64(t, 3)
 		t = a[1] ^ d1
-		bc3 = t<<45 | t>>(64-45)
+		bc3 = bits.RotateLeft64(t, 45)
 		t = a[12] ^ d2
-		bc4 = t<<61 | t>>(64-61)
+		bc4 = bits.RotateLeft64(t, 61)
 		t = a[23] ^ d3
-		bc0 = t<<28 | t>>(64-28)
+		bc0 = bits.RotateLeft64(t, 28)
 		t = a[9] ^ d4
-		bc1 = t<<20 | t>>(64-20)
+		bc1 = bits.RotateLeft64(t, 20)
 		a[15] = bc0 ^ (bc2 &^ bc1)
 		a[1] = bc1 ^ (bc3 &^ bc2)
 		a[12] = bc2 ^ (bc4 &^ bc3)
@@ -272,15 +273,15 @@ func keccakF1600(a *[25]uint64) {
 		a[9] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[5] ^ d0
-		bc4 = t<<18 | t>>(64-18)
+		bc4 = bits.RotateLeft64(t, 18)
 		t = a[16] ^ d1
-		bc0 = t<<1 | t>>(64-1)
+		bc0 = bits.RotateLeft64(t, 1)
 		t = a[2] ^ d2
-		bc1 = t<<6 | t>>(64-6)
+		bc1 = bits.RotateLeft64(t, 6)
 		t = a[13] ^ d3
-		bc2 = t<<25 | t>>(64-25)
+		bc2 = bits.RotateLeft64(t, 25)
 		t = a[24] ^ d4
-		bc3 = t<<8 | t>>(64-8)
+		bc3 = bits.RotateLeft64(t, 8)
 		a[5] = bc0 ^ (bc2 &^ bc1)
 		a[16] = bc1 ^ (bc3 &^ bc2)
 		a[2] = bc2 ^ (bc4 &^ bc3)
@@ -288,15 +289,15 @@ func keccakF1600(a *[25]uint64) {
 		a[24] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[20] ^ d0
-		bc1 = t<<36 | t>>(64-36)
+		bc1 = bits.RotateLeft64(t, 36)
 		t = a[6] ^ d1
-		bc2 = t<<10 | t>>(64-10)
+		bc2 = bits.RotateLeft64(t, 10)
 		t = a[17] ^ d2
-		bc3 = t<<15 | t>>(64-15)
+		bc3 = bits.RotateLeft64(t, 15)
 		t = a[3] ^ d3
-		bc4 = t<<56 | t>>(64-56)
+		bc4 = bits.RotateLeft64(t, 56)
 		t = a[14] ^ d4
-		bc0 = t<<27 | t>>(64-27)
+		bc0 = bits.RotateLeft64(t, 27)
 		a[20] = bc0 ^ (bc2 &^ bc1)
 		a[6] = bc1 ^ (bc3 &^ bc2)
 		a[17] = bc2 ^ (bc4 &^ bc3)
@@ -304,15 +305,15 @@ func keccakF1600(a *[25]uint64) {
 		a[14] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[10] ^ d0
-		bc3 = t<<41 | t>>(64-41)
+		bc3 = bits.RotateLeft64(t, 41)
 		t = a[21] ^ d1
-		bc4 = t<<2 | t>>(64-2)
+		bc4 = bits.RotateLeft64(t, 2)
 		t = a[7] ^ d2
-		bc0 = t<<62 | t>>(64-62)
+		bc0 = bits.RotateLeft64(t, 62)
 		t = a[18] ^ d3
-		bc1 = t<<55 | t>>(64-55)
+		bc1 = bits.RotateLeft64(t, 55)
 		t = a[4] ^ d4
-		bc2 = t<<39 | t>>(64-39)
+		bc2 = bits.RotateLeft64(t, 39)
 		a[10] = bc0 ^ (bc2 &^ bc1)
 		a[21] = bc1 ^ (bc3 &^ bc2)
 		a[7] = bc2 ^ (bc4 &^ bc3)
@@ -333,13 +334,13 @@ func keccakF1600(a *[25]uint64) {
 
 		bc0 = a[0] ^ d0
 		t = a[1] ^ d1
-		bc1 = t<<44 | t>>(64-44)
+		bc1 = bits.RotateLeft64(t, 44)
 		t = a[2] ^ d2
-		bc2 = t<<43 | t>>(64-43)
+		bc2 = bits.RotateLeft64(t, 43)
 		t = a[3] ^ d3
-		bc3 = t<<21 | t>>(64-21)
+		bc3 = bits.RotateLeft64(t, 21)
 		t = a[4] ^ d4
-		bc4 = t<<14 | t>>(64-14)
+		bc4 = bits.RotateLeft64(t, 14)
 		a[0] = bc0 ^ (bc2 &^ bc1) ^ rc[i+3]
 		a[1] = bc1 ^ (bc3 &^ bc2)
 		a[2] = bc2 ^ (bc4 &^ bc3)
@@ -347,15 +348,15 @@ func keccakF1600(a *[25]uint64) {
 		a[4] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[5] ^ d0
-		bc2 = t<<3 | t>>(64-3)
+		bc2 = bits.RotateLeft64(t, 3)
 		t = a[6] ^ d1
-		bc3 = t<<45 | t>>(64-45)
+		bc3 = bits.RotateLeft64(t, 45)
 		t = a[7] ^ d2
-		bc4 = t<<61 | t>>(64-61)
+		bc4 = bits.RotateLeft64(t, 61)
 		t = a[8] ^ d3
-		bc0 = t<<28 | t>>(64-28)
+		bc0 = bits.RotateLeft64(t, 28)
 		t = a[9] ^ d4
-		bc1 = t<<20 | t>>(64-20)
+		bc1 = bits.RotateLeft64(t, 20)
 		a[5] = bc0 ^ (bc2 &^ bc1)
 		a[6] = bc1 ^ (bc3 &^ bc2)
 		a[7] = bc2 ^ (bc4 &^ bc3)
@@ -363,15 +364,15 @@ func keccakF1600(a *[25]uint64) {
 		a[9] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[10] ^ d0
-		bc4 = t<<18 | t>>(64-18)
+		bc4 = bits.RotateLeft64(t, 18)
 		t = a[11] ^ d1
-		bc0 = t<<1 | t>>(64-1)
+		bc0 = bits.RotateLeft64(t, 1)
 		t = a[12] ^ d2
-		bc1 = t<<6 | t>>(64-6)
+		bc1 = bits.RotateLeft64(t, 6)
 		t = a[13] ^ d3
-		bc2 = t<<25 | t>>(64-25)
+		bc2 = bits.RotateLeft64(t, 25)
 		t = a[14] ^ d4
-		bc3 = t<<8 | t>>(64-8)
+		bc3 = bits.RotateLeft64(t, 8)
 		a[10] = bc0 ^ (bc2 &^ bc1)
 		a[11] = bc1 ^ (bc3 &^ bc2)
 		a[12] = bc2 ^ (bc4 &^ bc3)
@@ -379,15 +380,15 @@ func keccakF1600(a *[25]uint64) {
 		a[14] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[15] ^ d0
-		bc1 = t<<36 | t>>(64-36)
+		bc1 = bits.RotateLeft64(t, 36)
 		t = a[16] ^ d1
-		bc2 = t<<10 | t>>(64-10)
+		bc2 = bits.RotateLeft64(t, 10)
 		t = a[17] ^ d2
-		bc3 = t<<15 | t>>(64-15)
+		bc3 = bits.RotateLeft64(t, 15)
 		t = a[18] ^ d3
-		bc4 = t<<56 | t>>(64-56)
+		bc4 = bits.RotateLeft64(t, 56)
 		t = a[19] ^ d4
-		bc0 = t<<27 | t>>(64-27)
+		bc0 = bits.RotateLeft64(t, 27)
 		a[15] = bc0 ^ (bc2 &^ bc1)
 		a[16] = bc1 ^ (bc3 &^ bc2)
 		a[17] = bc2 ^ (bc4 &^ bc3)
@@ -395,15 +396,15 @@ func keccakF1600(a *[25]uint64) {
 		a[19] = bc4 ^ (bc1 &^ bc0)
 
 		t = a[20] ^ d0
-		bc3 = t<<41 | t>>(64-41)
+		bc3 = bits.RotateLeft64(t, 41)
 		t = a[21] ^ d1
-		bc4 = t<<2 | t>>(64-2)
+		bc4 = bits.RotateLeft64(t, 2)
 		t = a[22] ^ d2
-		bc0 = t<<62 | t>>(64-62)
+		bc0 = bits.RotateLeft64(t, 62)
 		t = a[23] ^ d3
-		bc1 = t<<55 | t>>(64-55)
+		bc1 = bits.RotateLeft64(t, 55)
 		t = a[24] ^ d4
-		bc2 = t<<39 | t>>(64-39)
+		bc2 = bits.RotateLeft64(t, 39)
 		a[20] = bc0 ^ (bc2 &^ bc1)
 		a[21] = bc1 ^ (bc3 &^ bc2)
 		a[22] = bc2 ^ (bc4 &^ bc3)
diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go
index 248a38241ff..b908696be58 100644
--- a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go
+++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && !purego && gc
-// +build amd64,!purego,gc
 
 package sha3
 
diff --git a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s
index 4cfa54383bf..1f539388619 100644
--- a/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s
+++ b/vendor/golang.org/x/crypto/sha3/keccakf_amd64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && !purego && gc
-// +build amd64,!purego,gc
 
 // This code was translated into a form compatible with 6a from the public
 // domain sources at https://github.com/gvanas/KeccakCodePackage
@@ -320,9 +319,9 @@
 	MOVQ rDi, _si(oState); \
 	MOVQ rDo, _so(oState)  \
 
-// func keccakF1600(state *[25]uint64)
+// func keccakF1600(a *[25]uint64)
 TEXT ·keccakF1600(SB), 0, $200-8
-	MOVQ state+0(FP), rpState
+	MOVQ a+0(FP), rpState
 
 	// Convert the user state into an internal state
 	NOTQ _be(rpState)
diff --git a/vendor/golang.org/x/crypto/sha3/register.go b/vendor/golang.org/x/crypto/sha3/register.go
index 8b4453aac3c..addfd5049bb 100644
--- a/vendor/golang.org/x/crypto/sha3/register.go
+++ b/vendor/golang.org/x/crypto/sha3/register.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build go1.4
-// +build go1.4
 
 package sha3
 
diff --git a/vendor/golang.org/x/crypto/sha3/sha3.go b/vendor/golang.org/x/crypto/sha3/sha3.go
index fa182beb40b..4884d172a49 100644
--- a/vendor/golang.org/x/crypto/sha3/sha3.go
+++ b/vendor/golang.org/x/crypto/sha3/sha3.go
@@ -121,11 +121,11 @@ func (d *state) padAndPermute(dsbyte byte) {
 	copyOut(d, d.buf)
 }
 
-// Write absorbs more data into the hash's state. It produces an error
-// if more data is written to the ShakeHash after writing
+// Write absorbs more data into the hash's state. It panics if any
+// output has already been read.
 func (d *state) Write(p []byte) (written int, err error) {
 	if d.state != spongeAbsorbing {
-		panic("sha3: write to sponge after read")
+		panic("sha3: Write after Read")
 	}
 	if d.buf == nil {
 		d.buf = d.storage.asBytes()[:0]
@@ -182,12 +182,16 @@ func (d *state) Read(out []byte) (n int, err error) {
 }
 
 // Sum applies padding to the hash state and then squeezes out the desired
-// number of output bytes.
+// number of output bytes. It panics if any output has already been read.
 func (d *state) Sum(in []byte) []byte {
+	if d.state != spongeAbsorbing {
+		panic("sha3: Sum after Read")
+	}
+
 	// Make a copy of the original hash so that caller can keep writing
 	// and summing.
 	dup := d.clone()
-	hash := make([]byte, dup.outputLen)
+	hash := make([]byte, dup.outputLen, 64) // explicit cap to allow stack allocation
 	dup.Read(hash)
 	return append(in, hash...)
 }
diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.go b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go
index 63a3edb4cea..d861bca5286 100644
--- a/vendor/golang.org/x/crypto/sha3/sha3_s390x.go
+++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc && !purego
-// +build gc,!purego
 
 package sha3
 
@@ -49,7 +48,7 @@ type asmState struct {
 	buf       []byte          // care must be taken to ensure cap(buf) is a multiple of rate
 	rate      int             // equivalent to block size
 	storage   [3072]byte      // underlying storage for buf
-	outputLen int             // output length if fixed, 0 if not
+	outputLen int             // output length for full security
 	function  code            // KIMD/KLMD function code
 	state     spongeDirection // whether the sponge is absorbing or squeezing
 }
@@ -72,8 +71,10 @@ func newAsmState(function code) *asmState {
 		s.outputLen = 64
 	case shake_128:
 		s.rate = 168
+		s.outputLen = 32
 	case shake_256:
 		s.rate = 136
+		s.outputLen = 64
 	default:
 		panic("sha3: unrecognized function code")
 	}
@@ -108,7 +109,7 @@ func (s *asmState) resetBuf() {
 // It never returns an error.
 func (s *asmState) Write(b []byte) (int, error) {
 	if s.state != spongeAbsorbing {
-		panic("sha3: write to sponge after read")
+		panic("sha3: Write after Read")
 	}
 	length := len(b)
 	for len(b) > 0 {
@@ -192,8 +193,8 @@ func (s *asmState) Read(out []byte) (n int, err error) {
 // Sum appends the current hash to b and returns the resulting slice.
 // It does not change the underlying hash state.
 func (s *asmState) Sum(b []byte) []byte {
-	if s.outputLen == 0 {
-		panic("sha3: cannot call Sum on SHAKE functions")
+	if s.state != spongeAbsorbing {
+		panic("sha3: Sum after Read")
 	}
 
 	// Copy the state to preserve the original.
diff --git a/vendor/golang.org/x/crypto/sha3/sha3_s390x.s b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s
index a0e051b0451..826b862c779 100644
--- a/vendor/golang.org/x/crypto/sha3/sha3_s390x.s
+++ b/vendor/golang.org/x/crypto/sha3/sha3_s390x.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc && !purego
-// +build gc,!purego
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/crypto/sha3/shake.go b/vendor/golang.org/x/crypto/sha3/shake.go
index d7be2954ab2..bb69984027f 100644
--- a/vendor/golang.org/x/crypto/sha3/shake.go
+++ b/vendor/golang.org/x/crypto/sha3/shake.go
@@ -17,26 +17,25 @@ package sha3
 
 import (
 	"encoding/binary"
+	"hash"
 	"io"
 )
 
-// ShakeHash defines the interface to hash functions that
-// support arbitrary-length output.
+// ShakeHash defines the interface to hash functions that support
+// arbitrary-length output. When used as a plain [hash.Hash], it
+// produces minimum-length outputs that provide full-strength generic
+// security.
 type ShakeHash interface {
-	// Write absorbs more data into the hash's state. It panics if input is
-	// written to it after output has been read from it.
-	io.Writer
+	hash.Hash
 
 	// Read reads more output from the hash; reading affects the hash's
 	// state. (ShakeHash.Read is thus very different from Hash.Sum)
-	// It never returns an error.
+	// It never returns an error, but subsequent calls to Write or Sum
+	// will panic.
 	io.Reader
 
 	// Clone returns a copy of the ShakeHash in its current state.
 	Clone() ShakeHash
-
-	// Reset resets the ShakeHash to its initial state.
-	Reset()
 }
 
 // cSHAKE specific context
@@ -81,8 +80,8 @@ func leftEncode(value uint64) []byte {
 	return b[i-1:]
 }
 
-func newCShake(N, S []byte, rate int, dsbyte byte) ShakeHash {
-	c := cshakeState{state: &state{rate: rate, dsbyte: dsbyte}}
+func newCShake(N, S []byte, rate, outputLen int, dsbyte byte) ShakeHash {
+	c := cshakeState{state: &state{rate: rate, outputLen: outputLen, dsbyte: dsbyte}}
 
 	// leftEncode returns max 9 bytes
 	c.initBlock = make([]byte, 0, 9*2+len(N)+len(S))
@@ -119,7 +118,7 @@ func NewShake128() ShakeHash {
 	if h := newShake128Asm(); h != nil {
 		return h
 	}
-	return &state{rate: rate128, dsbyte: dsbyteShake}
+	return &state{rate: rate128, outputLen: 32, dsbyte: dsbyteShake}
 }
 
 // NewShake256 creates a new SHAKE256 variable-output-length ShakeHash.
@@ -129,7 +128,7 @@ func NewShake256() ShakeHash {
 	if h := newShake256Asm(); h != nil {
 		return h
 	}
-	return &state{rate: rate256, dsbyte: dsbyteShake}
+	return &state{rate: rate256, outputLen: 64, dsbyte: dsbyteShake}
 }
 
 // NewCShake128 creates a new instance of cSHAKE128 variable-output-length ShakeHash,
@@ -142,7 +141,7 @@ func NewCShake128(N, S []byte) ShakeHash {
 	if len(N) == 0 && len(S) == 0 {
 		return NewShake128()
 	}
-	return newCShake(N, S, rate128, dsbyteCShake)
+	return newCShake(N, S, rate128, 32, dsbyteCShake)
 }
 
 // NewCShake256 creates a new instance of cSHAKE256 variable-output-length ShakeHash,
@@ -155,7 +154,7 @@ func NewCShake256(N, S []byte) ShakeHash {
 	if len(N) == 0 && len(S) == 0 {
 		return NewShake256()
 	}
-	return newCShake(N, S, rate256, dsbyteCShake)
+	return newCShake(N, S, rate256, 64, dsbyteCShake)
 }
 
 // ShakeSum128 writes an arbitrary-length digest of data into hash.
diff --git a/vendor/golang.org/x/crypto/sha3/shake_generic.go b/vendor/golang.org/x/crypto/sha3/shake_generic.go
index 5c0710ef98f..8d31cf5be2d 100644
--- a/vendor/golang.org/x/crypto/sha3/shake_generic.go
+++ b/vendor/golang.org/x/crypto/sha3/shake_generic.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !gc || purego || !s390x
-// +build !gc purego !s390x
 
 package sha3
 
diff --git a/vendor/golang.org/x/crypto/sha3/xor.go b/vendor/golang.org/x/crypto/sha3/xor.go
index 59c8eb94186..7337cca88ed 100644
--- a/vendor/golang.org/x/crypto/sha3/xor.go
+++ b/vendor/golang.org/x/crypto/sha3/xor.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (!amd64 && !386 && !ppc64le) || purego
-// +build !amd64,!386,!ppc64le purego
 
 package sha3
 
diff --git a/vendor/golang.org/x/crypto/sha3/xor_unaligned.go b/vendor/golang.org/x/crypto/sha3/xor_unaligned.go
index 1ce606246d5..870e2d16e07 100644
--- a/vendor/golang.org/x/crypto/sha3/xor_unaligned.go
+++ b/vendor/golang.org/x/crypto/sha3/xor_unaligned.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (amd64 || 386 || ppc64le) && !purego
-// +build amd64 386 ppc64le
-// +build !purego
 
 package sha3
 
diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go
index 822ed42a04c..2466ae3d9a5 100644
--- a/vendor/golang.org/x/net/html/doc.go
+++ b/vendor/golang.org/x/net/html/doc.go
@@ -92,6 +92,27 @@ example, to process each anchor node in depth-first order:
 The relevant specifications include:
 https://html.spec.whatwg.org/multipage/syntax.html and
 https://html.spec.whatwg.org/multipage/syntax.html#tokenization
+
+# Security Considerations
+
+Care should be taken when parsing and interpreting HTML, whether full documents
+or fragments, within the framework of the HTML specification, especially with
+regard to untrusted inputs.
+
+This package provides both a tokenizer and a parser, which implement the
+tokenization, and tokenization and tree construction stages of the WHATWG HTML
+parsing specification respectively. While the tokenizer parses and normalizes
+individual HTML tokens, only the parser constructs the DOM tree from the
+tokenized HTML, as described in the tree construction stage of the
+specification, dynamically modifying or extending the docuemnt's DOM tree.
+
+If your use case requires semantically well-formed HTML documents, as defined by
+the WHATWG specification, the parser should be used rather than the tokenizer.
+
+In security contexts, if trust decisions are being made using the tokenized or
+parsed content, the input must be re-serialized (for instance by using Render or
+Token.String) in order for those trust decisions to hold, as the process of
+tokenization or parsing may alter the content.
 */
 package html // import "golang.org/x/net/html"
 
diff --git a/vendor/golang.org/x/net/html/escape.go b/vendor/golang.org/x/net/html/escape.go
index d8561396200..04c6bec2107 100644
--- a/vendor/golang.org/x/net/html/escape.go
+++ b/vendor/golang.org/x/net/html/escape.go
@@ -193,6 +193,87 @@ func lower(b []byte) []byte {
 	return b
 }
 
+// escapeComment is like func escape but escapes its input bytes less often.
+// Per https://github.com/golang/go/issues/58246 some HTML comments are (1)
+// meaningful and (2) contain angle brackets that we'd like to avoid escaping
+// unless we have to.
+//
+// "We have to" includes the '&' byte, since that introduces other escapes.
+//
+// It also includes those bytes (not including EOF) that would otherwise end
+// the comment. Per the summary table at the bottom of comment_test.go, this is
+// the '>' byte that, per above, we'd like to avoid escaping unless we have to.
+//
+// Studying the summary table (and T actions in its '>' column) closely, we
+// only need to escape in states 43, 44, 49, 51 and 52. State 43 is at the
+// start of the comment data. State 52 is after a '!'. The other three states
+// are after a '-'.
+//
+// Our algorithm is thus to escape every '&' and to escape '>' if and only if:
+//   - The '>' is after a '!' or '-' (in the unescaped data) or
+//   - The '>' is at the start of the comment data (after the opening "<!--").
+func escapeComment(w writer, s string) error {
+	// When modifying this function, consider manually increasing the
+	// maxSuffixLen constant in func TestComments, from 6 to e.g. 9 or more.
+	// That increase should only be temporary, not committed, as it
+	// exponentially affects the test running time.
+
+	if len(s) == 0 {
+		return nil
+	}
+
+	// Loop:
+	//   - Grow j such that s[i:j] does not need escaping.
+	//   - If s[j] does need escaping, output s[i:j] and an escaped s[j],
+	//     resetting i and j to point past that s[j] byte.
+	i := 0
+	for j := 0; j < len(s); j++ {
+		escaped := ""
+		switch s[j] {
+		case '&':
+			escaped = "&amp;"
+
+		case '>':
+			if j > 0 {
+				if prev := s[j-1]; (prev != '!') && (prev != '-') {
+					continue
+				}
+			}
+			escaped = "&gt;"
+
+		default:
+			continue
+		}
+
+		if i < j {
+			if _, err := w.WriteString(s[i:j]); err != nil {
+				return err
+			}
+		}
+		if _, err := w.WriteString(escaped); err != nil {
+			return err
+		}
+		i = j + 1
+	}
+
+	if i < len(s) {
+		if _, err := w.WriteString(s[i:]); err != nil {
+			return err
+		}
+	}
+	return nil
+}
+
+// escapeCommentString is to EscapeString as escapeComment is to escape.
+func escapeCommentString(s string) string {
+	if strings.IndexAny(s, "&>") == -1 {
+		return s
+	}
+	var buf bytes.Buffer
+	escapeComment(&buf, s)
+	return buf.String()
+}
+
 const escapedChars = "&'<>\"\r"
 
 func escape(w writer, s string) error {
diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go
index 497e132042b..8b28031905a 100644
--- a/vendor/golang.org/x/net/html/render.go
+++ b/vendor/golang.org/x/net/html/render.go
@@ -85,7 +85,7 @@ func render1(w writer, n *Node) error {
 		if _, err := w.WriteString("<!--"); err != nil {
 			return err
 		}
-		if err := escape(w, n.Data); err != nil {
+		if err := escapeComment(w, n.Data); err != nil {
 			return err
 		}
 		if _, err := w.WriteString("-->"); err != nil {
diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go
index 50f7c6aac8d..5c2a1f4efa5 100644
--- a/vendor/golang.org/x/net/html/token.go
+++ b/vendor/golang.org/x/net/html/token.go
@@ -110,7 +110,7 @@ func (t Token) String() string {
 	case SelfClosingTagToken:
 		return "<" + t.tagString() + "/>"
 	case CommentToken:
-		return "<!--" + EscapeString(t.Data) + "-->"
+		return "<!--" + escapeCommentString(t.Data) + "-->"
 	case DoctypeToken:
 		return "<!DOCTYPE " + EscapeString(t.Data) + ">"
 	}
@@ -598,10 +598,10 @@ scriptDataDoubleEscapeEnd:
 // readComment reads the next comment token starting with "<!--". The opening
 // "<!--" has already been consumed.
 func (z *Tokenizer) readComment() {
-	// When modifying this function, consider manually increasing the suffixLen
-	// constant in func TestComments, from 6 to e.g. 9 or more. That increase
-	// should only be temporary, not committed, as it exponentially affects the
-	// test running time.
+	// When modifying this function, consider manually increasing the
+	// maxSuffixLen constant in func TestComments, from 6 to e.g. 9 or more.
+	// That increase should only be temporary, not committed, as it
+	// exponentially affects the test running time.
 
 	z.data.start = z.raw.end
 	defer func() {
diff --git a/vendor/golang.org/x/net/http2/pipe.go b/vendor/golang.org/x/net/http2/pipe.go
index c15b8a7719b..684d984fd96 100644
--- a/vendor/golang.org/x/net/http2/pipe.go
+++ b/vendor/golang.org/x/net/http2/pipe.go
@@ -88,13 +88,9 @@ func (p *pipe) Write(d []byte) (n int, err error) {
 		p.c.L = &p.mu
 	}
 	defer p.c.Signal()
-	if p.err != nil {
+	if p.err != nil || p.breakErr != nil {
 		return 0, errClosedPipeWrite
 	}
-	if p.breakErr != nil {
-		p.unread += len(d)
-		return len(d), nil // discard when there is no reader
-	}
 	return p.b.Write(d)
 }
 
diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go
index 8cb14f3c97f..cd057f39824 100644
--- a/vendor/golang.org/x/net/http2/server.go
+++ b/vendor/golang.org/x/net/http2/server.go
@@ -1822,15 +1822,18 @@ func (sc *serverConn) processData(f *DataFrame) error {
 		}
 
 		if len(data) > 0 {
+			st.bodyBytes += int64(len(data))
 			wrote, err := st.body.Write(data)
 			if err != nil {
+				// The handler has closed the request body.
+				// Return the connection-level flow control for the discarded data,
+				// but not the stream-level flow control.
 				sc.sendWindowUpdate(nil, int(f.Length)-wrote)
-				return sc.countError("body_write_err", streamError(id, ErrCodeStreamClosed))
+				return nil
 			}
 			if wrote != len(data) {
 				panic("internal error: bad Writer")
 			}
-			st.bodyBytes += int64(len(data))
 		}
 
 		// Return any padded flow control now, since we won't
diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go
index 05ba23d3d98..ac90a2631c9 100644
--- a/vendor/golang.org/x/net/http2/transport.go
+++ b/vendor/golang.org/x/net/http2/transport.go
@@ -560,10 +560,11 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res
 		traceGotConn(req, cc, reused)
 		res, err := cc.RoundTrip(req)
 		if err != nil && retry <= 6 {
+			roundTripErr := err
 			if req, err = shouldRetryRequest(req, err); err == nil {
 				// After the first retry, do exponential backoff with 10% jitter.
 				if retry == 0 {
-					t.vlogf("RoundTrip retrying after failure: %v", err)
+					t.vlogf("RoundTrip retrying after failure: %v", roundTripErr)
 					continue
 				}
 				backoff := float64(uint(1) << (uint(retry) - 1))
@@ -572,7 +573,7 @@ func (t *Transport) RoundTripOpt(req *http.Request, opt RoundTripOpt) (*http.Res
 				timer := backoffNewTimer(d)
 				select {
 				case <-timer.C:
-					t.vlogf("RoundTrip retrying after failure: %v", err)
+					t.vlogf("RoundTrip retrying after failure: %v", roundTripErr)
 					continue
 				case <-req.Context().Done():
 					timer.Stop()
@@ -1265,6 +1266,27 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) {
 		return res, nil
 	}
 
+	cancelRequest := func(cs *clientStream, err error) error {
+		cs.cc.mu.Lock()
+		defer cs.cc.mu.Unlock()
+		cs.abortStreamLocked(err)
+		if cs.ID != 0 {
+			// This request may have failed because of a problem with the connection,
+			// or for some unrelated reason. (For example, the user might have canceled
+			// the request without waiting for a response.) Mark the connection as
+			// not reusable, since trying to reuse a dead connection is worse than
+			// unnecessarily creating a new one.
+			//
+			// If cs.ID is 0, then the request was never allocated a stream ID and
+			// whatever went wrong was unrelated to the connection. We might have
+			// timed out waiting for a stream slot when StrictMaxConcurrentStreams
+			// is set, for example, in which case retrying on a different connection
+			// will not help.
+			cs.cc.doNotReuse = true
+		}
+		return err
+	}
+
 	for {
 		select {
 		case <-cs.respHeaderRecv:
@@ -1279,15 +1301,12 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) {
 				return handleResponseHeaders()
 			default:
 				waitDone()
-				return nil, cs.abortErr
+				return nil, cancelRequest(cs, cs.abortErr)
 			}
 		case <-ctx.Done():
-			err := ctx.Err()
-			cs.abortStream(err)
-			return nil, err
+			return nil, cancelRequest(cs, ctx.Err())
 		case <-cs.reqCancel:
-			cs.abortStream(errRequestCanceled)
-			return nil, errRequestCanceled
+			return nil, cancelRequest(cs, errRequestCanceled)
 		}
 	}
 }
@@ -2555,6 +2574,9 @@ func (b transportResponseBody) Close() error {
 	cs := b.cs
 	cc := cs.cc
 
+	cs.bufPipe.BreakWithError(errClosedResponseBody)
+	cs.abortStream(errClosedResponseBody)
+
 	unread := cs.bufPipe.Len()
 	if unread > 0 {
 		cc.mu.Lock()
@@ -2573,9 +2595,6 @@ func (b transportResponseBody) Close() error {
 		cc.wmu.Unlock()
 	}
 
-	cs.bufPipe.BreakWithError(errClosedResponseBody)
-	cs.abortStream(errClosedResponseBody)
-
 	select {
 	case <-cs.donec:
 	case <-cs.ctx.Done():
diff --git a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s
index db9171c2e49..269e173ca46 100644
--- a/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s
+++ b/vendor/golang.org/x/sys/cpu/asm_aix_ppc64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go
index 83f112c4c80..4756ad5f795 100644
--- a/vendor/golang.org/x/sys/cpu/cpu.go
+++ b/vendor/golang.org/x/sys/cpu/cpu.go
@@ -38,7 +38,7 @@ var X86 struct {
 	HasAVX512F          bool // Advanced vector extension 512 Foundation Instructions
 	HasAVX512CD         bool // Advanced vector extension 512 Conflict Detection Instructions
 	HasAVX512ER         bool // Advanced vector extension 512 Exponential and Reciprocal Instructions
-	HasAVX512PF         bool // Advanced vector extension 512 Prefetch Instructions Instructions
+	HasAVX512PF         bool // Advanced vector extension 512 Prefetch Instructions
 	HasAVX512VL         bool // Advanced vector extension 512 Vector Length Extensions
 	HasAVX512BW         bool // Advanced vector extension 512 Byte and Word Instructions
 	HasAVX512DQ         bool // Advanced vector extension 512 Doubleword and Quadword Instructions
@@ -54,6 +54,9 @@ var X86 struct {
 	HasAVX512VBMI2      bool // Advanced vector extension 512 Vector Byte Manipulation Instructions 2
 	HasAVX512BITALG     bool // Advanced vector extension 512 Bit Algorithms
 	HasAVX512BF16       bool // Advanced vector extension 512 BFloat16 Instructions
+	HasAMXTile          bool // Advanced Matrix Extension Tile instructions
+	HasAMXInt8          bool // Advanced Matrix Extension Int8 instructions
+	HasAMXBF16          bool // Advanced Matrix Extension BFloat16 instructions
 	HasBMI1             bool // Bit manipulation instruction set 1
 	HasBMI2             bool // Bit manipulation instruction set 2
 	HasCX16             bool // Compare and exchange 16 Bytes
diff --git a/vendor/golang.org/x/sys/cpu/cpu_aix.go b/vendor/golang.org/x/sys/cpu/cpu_aix.go
index 8aaeef545a7..9bf0c32eb6a 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_aix.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_aix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix
-// +build aix
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_arm64.s b/vendor/golang.org/x/sys/cpu/cpu_arm64.s
index c61f95a05a7..fcb9a388820 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_arm64.s
+++ b/vendor/golang.org/x/sys/cpu/cpu_arm64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go
index ccf542a73da..a8acd3e3285 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gc_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go
index 0af2f248412..c8ae6ddc156 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gc_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go
index fa7cdb9bcd5..910728fb163 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gc_x86.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (386 || amd64 || amd64p32) && gc
-// +build 386 amd64 amd64p32
-// +build gc
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go
index 2aff3189116..7f1946780bd 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gccgo
-// +build gccgo
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go
index 4bfbda61993..9526d2ce3a9 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gccgo
-// +build gccgo
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c
index 6cc73109f59..3f73a05dcf3 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c
+++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (386 || amd64 || amd64p32) && gccgo
-// +build 386 amd64 amd64p32
-// +build gccgo
 
 #include <cpuid.h>
 #include <stdint.h>
diff --git a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go
index 863d415ab49..99c60fe9f9c 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (386 || amd64 || amd64p32) && gccgo
-// +build 386 amd64 amd64p32
-// +build gccgo
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux.go b/vendor/golang.org/x/sys/cpu/cpu_linux.go
index 159a686f6f7..743eb54354b 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_linux.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_linux.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !386 && !amd64 && !amd64p32 && !arm64
-// +build !386,!amd64,!amd64p32,!arm64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go
index 6000db4cdd1..4686c1d541d 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_linux_mips64x.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (mips64 || mips64le)
-// +build linux
-// +build mips64 mips64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go
index f4992b1a593..cd63e733557 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && !arm && !arm64 && !mips64 && !mips64le && !ppc64 && !ppc64le && !s390x
-// +build linux,!arm,!arm64,!mips64,!mips64le,!ppc64,!ppc64le,!s390x
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go
index 021356d6deb..197188e67f3 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_linux_ppc64x.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (ppc64 || ppc64le)
-// +build linux
-// +build ppc64 ppc64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_loong64.go b/vendor/golang.org/x/sys/cpu/cpu_loong64.go
index 0f57b05bdbe..558635850c7 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_loong64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_loong64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build loong64
-// +build loong64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go
index f4063c66423..fedb00cc4cb 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_mips64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_mips64x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build mips64 || mips64le
-// +build mips64 mips64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go
index 07c4e36d8f5..ffb4ec7eb39 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_mipsx.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_mipsx.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build mips || mipsle
-// +build mips mipsle
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go
index d7b4fb4ccc2..e9ecf2a4567 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_other_arm.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !linux && arm
-// +build !linux,arm
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go
index f3cde129b63..5341e7f88d7 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_other_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !linux && !netbsd && !openbsd && arm64
-// +build !linux,!netbsd,!openbsd,arm64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go
index 0dafe9644a5..5f8f2419ab8 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_other_mips64x.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !linux && (mips64 || mips64le)
-// +build !linux
-// +build mips64 mips64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go
index 060d46b6eac..89608fba276 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_other_ppc64x.go
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !aix && !linux && (ppc64 || ppc64le)
-// +build !aix
-// +build !linux
-// +build ppc64 ppc64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go
index dd10eb79fee..5ab87808f71 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_other_riscv64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !linux && riscv64
-// +build !linux,riscv64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go
index 4e8acd16583..c14f12b1494 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_ppc64x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build ppc64 || ppc64le
-// +build ppc64 ppc64le
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_riscv64.go b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go
index bd6c128af9b..7f0c79c004b 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_riscv64.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_riscv64.go
@@ -3,10 +3,9 @@
 // license that can be found in the LICENSE file.
 
 //go:build riscv64
-// +build riscv64
 
 package cpu
 
-const cacheLineSize = 32
+const cacheLineSize = 64
 
 func initOptions() {}
diff --git a/vendor/golang.org/x/sys/cpu/cpu_s390x.s b/vendor/golang.org/x/sys/cpu/cpu_s390x.s
index 96f81e20971..1fb4b701334 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_s390x.s
+++ b/vendor/golang.org/x/sys/cpu/cpu_s390x.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_wasm.go b/vendor/golang.org/x/sys/cpu/cpu_wasm.go
index 7747d888a69..384787ea306 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_wasm.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_wasm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build wasm
-// +build wasm
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.go b/vendor/golang.org/x/sys/cpu/cpu_x86.go
index f5aacfc825d..c29f5e4c5a6 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_x86.go
+++ b/vendor/golang.org/x/sys/cpu/cpu_x86.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 || amd64 || amd64p32
-// +build 386 amd64 amd64p32
 
 package cpu
 
@@ -37,6 +36,9 @@ func initOptions() {
 		{Name: "avx512vbmi2", Feature: &X86.HasAVX512VBMI2},
 		{Name: "avx512bitalg", Feature: &X86.HasAVX512BITALG},
 		{Name: "avx512bf16", Feature: &X86.HasAVX512BF16},
+		{Name: "amxtile", Feature: &X86.HasAMXTile},
+		{Name: "amxint8", Feature: &X86.HasAMXInt8},
+		{Name: "amxbf16", Feature: &X86.HasAMXBF16},
 		{Name: "bmi1", Feature: &X86.HasBMI1},
 		{Name: "bmi2", Feature: &X86.HasBMI2},
 		{Name: "cx16", Feature: &X86.HasCX16},
@@ -138,6 +140,10 @@ func archInit() {
 		eax71, _, _, _ := cpuid(7, 1)
 		X86.HasAVX512BF16 = isSet(5, eax71)
 	}
+
+	X86.HasAMXTile = isSet(24, edx7)
+	X86.HasAMXInt8 = isSet(25, edx7)
+	X86.HasAMXBF16 = isSet(22, edx7)
 }
 
 func isSet(bitpos uint, value uint32) bool {
diff --git a/vendor/golang.org/x/sys/cpu/cpu_x86.s b/vendor/golang.org/x/sys/cpu/cpu_x86.s
index 39acab2ff5c..7d7ba33efb8 100644
--- a/vendor/golang.org/x/sys/cpu/cpu_x86.s
+++ b/vendor/golang.org/x/sys/cpu/cpu_x86.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (386 || amd64 || amd64p32) && gc
-// +build 386 amd64 amd64p32
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/cpu/endian_big.go b/vendor/golang.org/x/sys/cpu/endian_big.go
index 93ce03a3460..7fe04b0a13b 100644
--- a/vendor/golang.org/x/sys/cpu/endian_big.go
+++ b/vendor/golang.org/x/sys/cpu/endian_big.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64
-// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go
index fe545966b61..48eccc4c799 100644
--- a/vendor/golang.org/x/sys/cpu/endian_little.go
+++ b/vendor/golang.org/x/sys/cpu/endian_little.go
@@ -2,8 +2,7 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh
-// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh
+//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/hwcap_linux.go b/vendor/golang.org/x/sys/cpu/hwcap_linux.go
index f3baa379328..34e49f955a8 100644
--- a/vendor/golang.org/x/sys/cpu/hwcap_linux.go
+++ b/vendor/golang.org/x/sys/cpu/hwcap_linux.go
@@ -5,7 +5,7 @@
 package cpu
 
 import (
-	"io/ioutil"
+	"os"
 )
 
 const (
@@ -24,7 +24,22 @@ var hwCap uint
 var hwCap2 uint
 
 func readHWCAP() error {
-	buf, err := ioutil.ReadFile(procAuxv)
+	// For Go 1.21+, get auxv from the Go runtime.
+	if a := getAuxv(); len(a) > 0 {
+		for len(a) >= 2 {
+			tag, val := a[0], uint(a[1])
+			a = a[2:]
+			switch tag {
+			case _AT_HWCAP:
+				hwCap = val
+			case _AT_HWCAP2:
+				hwCap2 = val
+			}
+		}
+		return nil
+	}
+
+	buf, err := os.ReadFile(procAuxv)
 	if err != nil {
 		// e.g. on android /proc/self/auxv is not accessible, so silently
 		// ignore the error and leave Initialized = false. On some
diff --git a/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go
index d87bd6b3eb0..4cd64c7042b 100644
--- a/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go
+++ b/vendor/golang.org/x/sys/cpu/proc_cpuinfo_linux.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && arm64
-// +build linux,arm64
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/runtime_auxv.go b/vendor/golang.org/x/sys/cpu/runtime_auxv.go
new file mode 100644
index 00000000000..5f92ac9a2e2
--- /dev/null
+++ b/vendor/golang.org/x/sys/cpu/runtime_auxv.go
@@ -0,0 +1,16 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package cpu
+
+// getAuxvFn is non-nil on Go 1.21+ (via runtime_auxv_go121.go init)
+// on platforms that use auxv.
+var getAuxvFn func() []uintptr
+
+func getAuxv() []uintptr {
+	if getAuxvFn == nil {
+		return nil
+	}
+	return getAuxvFn()
+}
diff --git a/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go
new file mode 100644
index 00000000000..4c9788ea8ee
--- /dev/null
+++ b/vendor/golang.org/x/sys/cpu/runtime_auxv_go121.go
@@ -0,0 +1,18 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build go1.21
+
+package cpu
+
+import (
+	_ "unsafe" // for linkname
+)
+
+//go:linkname runtime_getAuxv runtime.getAuxv
+func runtime_getAuxv() []uintptr
+
+func init() {
+	getAuxvFn = runtime_getAuxv
+}
diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go
index 96134157a10..1b9ccb091a5 100644
--- a/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go
+++ b/vendor/golang.org/x/sys/cpu/syscall_aix_gccgo.go
@@ -9,7 +9,6 @@
 // gccgo's libgo and thus must not used a CGo method.
 
 //go:build aix && gccgo
-// +build aix,gccgo
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go
index 904be42ffdc..e8b6cdbe9a7 100644
--- a/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go
+++ b/vendor/golang.org/x/sys/cpu/syscall_aix_ppc64_gc.go
@@ -7,7 +7,6 @@
 // (See golang.org/issue/32102)
 
 //go:build aix && ppc64 && gc
-// +build aix,ppc64,gc
 
 package cpu
 
diff --git a/vendor/golang.org/x/sys/execabs/execabs.go b/vendor/golang.org/x/sys/execabs/execabs.go
index b981cfbb4ae..3bf40fdfecd 100644
--- a/vendor/golang.org/x/sys/execabs/execabs.go
+++ b/vendor/golang.org/x/sys/execabs/execabs.go
@@ -63,7 +63,7 @@ func LookPath(file string) (string, error) {
 }
 
 func fixCmd(name string, cmd *exec.Cmd) {
-	if filepath.Base(name) == name && !filepath.IsAbs(cmd.Path) {
+	if filepath.Base(name) == name && !filepath.IsAbs(cmd.Path) && !isGo119ErrFieldSet(cmd) {
 		// exec.Command was called with a bare binary name and
 		// exec.LookPath returned a path which is not absolute.
 		// Set cmd.lookPathErr and clear cmd.Path so that it
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go118.go b/vendor/golang.org/x/sys/execabs/execabs_go118.go
index 6ab5f50894e..5627d70e398 100644
--- a/vendor/golang.org/x/sys/execabs/execabs_go118.go
+++ b/vendor/golang.org/x/sys/execabs/execabs_go118.go
@@ -3,10 +3,15 @@
 // license that can be found in the LICENSE file.
 
 //go:build !go1.19
-// +build !go1.19
 
 package execabs
 
+import "os/exec"
+
 func isGo119ErrDot(err error) bool {
 	return false
 }
+
+func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
+	return false
+}
diff --git a/vendor/golang.org/x/sys/execabs/execabs_go119.go b/vendor/golang.org/x/sys/execabs/execabs_go119.go
index 46c5b525e7b..d60ab1b4195 100644
--- a/vendor/golang.org/x/sys/execabs/execabs_go119.go
+++ b/vendor/golang.org/x/sys/execabs/execabs_go119.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build go1.19
-// +build go1.19
 
 package execabs
 
@@ -15,3 +14,7 @@ import (
 func isGo119ErrDot(err error) bool {
 	return errors.Is(err, exec.ErrDot)
 }
+
+func isGo119ErrFieldSet(cmd *exec.Cmd) bool {
+	return cmd.Err != nil
+}
diff --git a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go b/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go
deleted file mode 100644
index e07899b909b..00000000000
--- a/vendor/golang.org/x/sys/internal/unsafeheader/unsafeheader.go
+++ /dev/null
@@ -1,30 +0,0 @@
-// Copyright 2020 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package unsafeheader contains header declarations for the Go runtime's
-// slice and string implementations.
-//
-// This package allows x/sys to use types equivalent to
-// reflect.SliceHeader and reflect.StringHeader without introducing
-// a dependency on the (relatively heavy) "reflect" package.
-package unsafeheader
-
-import (
-	"unsafe"
-)
-
-// Slice is the runtime representation of a slice.
-// It cannot be used safely or portably and its representation may change in a later release.
-type Slice struct {
-	Data unsafe.Pointer
-	Len  int
-	Cap  int
-}
-
-// String is the runtime representation of a string.
-// It cannot be used safely or portably and its representation may change in a later release.
-type String struct {
-	Data unsafe.Pointer
-	Len  int
-}
diff --git a/vendor/golang.org/x/sys/unix/aliases.go b/vendor/golang.org/x/sys/unix/aliases.go
index abc89c104a8..e7d3df4bd36 100644
--- a/vendor/golang.org/x/sys/unix/aliases.go
+++ b/vendor/golang.org/x/sys/unix/aliases.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos) && go1.9
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
-// +build go1.9
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s
index db9171c2e49..269e173ca46 100644
--- a/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s
+++ b/vendor/golang.org/x/sys/unix/asm_aix_ppc64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_386.s b/vendor/golang.org/x/sys/unix/asm_bsd_386.s
index e0fcd9b3dee..a4fcef0e0d7 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_386.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_386.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (freebsd || netbsd || openbsd) && gc
-// +build freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s
index 2b99c349a2d..1e63615c570 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_amd64.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin || dragonfly || freebsd || netbsd || openbsd) && gc
-// +build darwin dragonfly freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s
index d702d4adc77..6496c310087 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_arm.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (freebsd || netbsd || openbsd) && gc
-// +build freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s
index fe36a7391a6..4fd1f54daaa 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_arm64.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin || freebsd || netbsd || openbsd) && gc
-// +build darwin freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s
index e5b9a84899a..42f7eb9e474 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_ppc64.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin || freebsd || netbsd || openbsd) && gc
-// +build darwin freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s
index d560019ea29..f8902667e97 100644
--- a/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s
+++ b/vendor/golang.org/x/sys/unix/asm_bsd_riscv64.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin || freebsd || netbsd || openbsd) && gc
-// +build darwin freebsd netbsd openbsd
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_386.s b/vendor/golang.org/x/sys/unix/asm_linux_386.s
index 8fd101d0716..3b4734870d9 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_386.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_386.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s
index 7ed38e43c67..67e29f3178b 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_amd64.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_amd64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm.s b/vendor/golang.org/x/sys/unix/asm_linux_arm.s
index 8ef1d51402a..d6ae269ce16 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_arm.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_arm.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s
index 98ae02760da..01e5e253c68 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_arm64.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_arm64.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && arm64 && gc
-// +build linux
-// +build arm64
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s
index 565357288a8..2abf12f6e87 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_loong64.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_loong64.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && loong64 && gc
-// +build linux
-// +build loong64
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s
index 21231d2ce13..f84bae7120e 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_mips64x.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (mips64 || mips64le) && gc
-// +build linux
-// +build mips64 mips64le
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s
index 6783b26c606..f08f6280772 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_mipsx.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (mips || mipsle) && gc
-// +build linux
-// +build mips mipsle
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s
index 19d4989344d..bdfc024d2d3 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_ppc64x.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (ppc64 || ppc64le) && gc
-// +build linux
-// +build ppc64 ppc64le
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s
index e42eb81d583..2e8c9961203 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_riscv64.s
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build riscv64 && gc
-// +build riscv64
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s
index c46aab33959..2c394b11ebd 100644
--- a/vendor/golang.org/x/sys/unix/asm_linux_s390x.s
+++ b/vendor/golang.org/x/sys/unix/asm_linux_s390x.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && s390x && gc
-// +build linux
-// +build s390x
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s
index 5e7a1169c05..fab586a2c41 100644
--- a/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s
+++ b/vendor/golang.org/x/sys/unix/asm_openbsd_mips64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s
index f8c5394c1a7..f949ec5476d 100644
--- a/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s
+++ b/vendor/golang.org/x/sys/unix/asm_solaris_amd64.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gc
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s
index 3b54e185813..2f67ba86d57 100644
--- a/vendor/golang.org/x/sys/unix/asm_zos_s390x.s
+++ b/vendor/golang.org/x/sys/unix/asm_zos_s390x.s
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x && gc
-// +build zos
-// +build s390x
-// +build gc
 
 #include "textflag.h"
 
diff --git a/vendor/golang.org/x/sys/unix/cap_freebsd.go b/vendor/golang.org/x/sys/unix/cap_freebsd.go
index 0b7c6adb866..a08657890f3 100644
--- a/vendor/golang.org/x/sys/unix/cap_freebsd.go
+++ b/vendor/golang.org/x/sys/unix/cap_freebsd.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build freebsd
-// +build freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/constants.go b/vendor/golang.org/x/sys/unix/constants.go
index 394a3965b68..6fb7cb77d0a 100644
--- a/vendor/golang.org/x/sys/unix/constants.go
+++ b/vendor/golang.org/x/sys/unix/constants.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go
index 65a998508db..d7851346177 100644
--- a/vendor/golang.org/x/sys/unix/dev_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix && ppc
-// +build aix,ppc
 
 // Functions to access/create device major and minor numbers matching the
 // encoding used by AIX.
diff --git a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go
index 8fc08ad0aae..623a5e6973a 100644
--- a/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/dev_aix_ppc64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix && ppc64
-// +build aix,ppc64
 
 // Functions to access/create device major and minor numbers matching the
 // encoding used AIX.
diff --git a/vendor/golang.org/x/sys/unix/dev_zos.go b/vendor/golang.org/x/sys/unix/dev_zos.go
index a388e59a0e0..bb6a64fe92d 100644
--- a/vendor/golang.org/x/sys/unix/dev_zos.go
+++ b/vendor/golang.org/x/sys/unix/dev_zos.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 // Functions to access/create device major and minor numbers matching the
 // encoding used by z/OS.
diff --git a/vendor/golang.org/x/sys/unix/dirent.go b/vendor/golang.org/x/sys/unix/dirent.go
index 2499f977b07..1ebf1178269 100644
--- a/vendor/golang.org/x/sys/unix/dirent.go
+++ b/vendor/golang.org/x/sys/unix/dirent.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/endian_big.go b/vendor/golang.org/x/sys/unix/endian_big.go
index a5202655768..1095fd31d68 100644
--- a/vendor/golang.org/x/sys/unix/endian_big.go
+++ b/vendor/golang.org/x/sys/unix/endian_big.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 //
 //go:build armbe || arm64be || m68k || mips || mips64 || mips64p32 || ppc || ppc64 || s390 || s390x || shbe || sparc || sparc64
-// +build armbe arm64be m68k mips mips64 mips64p32 ppc ppc64 s390 s390x shbe sparc sparc64
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/endian_little.go b/vendor/golang.org/x/sys/unix/endian_little.go
index b0f2bc4ae3b..b9f0e277b14 100644
--- a/vendor/golang.org/x/sys/unix/endian_little.go
+++ b/vendor/golang.org/x/sys/unix/endian_little.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 //
 //go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh
-// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/env_unix.go b/vendor/golang.org/x/sys/unix/env_unix.go
index 29ccc4d1334..a96da71f473 100644
--- a/vendor/golang.org/x/sys/unix/env_unix.go
+++ b/vendor/golang.org/x/sys/unix/env_unix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 // Unix environment variables.
 
diff --git a/vendor/golang.org/x/sys/unix/epoll_zos.go b/vendor/golang.org/x/sys/unix/epoll_zos.go
index cedaf7e024b..7753fddea81 100644
--- a/vendor/golang.org/x/sys/unix/epoll_zos.go
+++ b/vendor/golang.org/x/sys/unix/epoll_zos.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/fcntl.go b/vendor/golang.org/x/sys/unix/fcntl.go
index e9b991258c1..6200876fb28 100644
--- a/vendor/golang.org/x/sys/unix/fcntl.go
+++ b/vendor/golang.org/x/sys/unix/fcntl.go
@@ -2,8 +2,7 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build dragonfly || freebsd || linux || netbsd || openbsd
-// +build dragonfly freebsd linux netbsd openbsd
+//go:build dragonfly || freebsd || linux || netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go
index 29d44808b1d..13b4acd5c69 100644
--- a/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go
+++ b/vendor/golang.org/x/sys/unix/fcntl_linux_32bit.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (linux && 386) || (linux && arm) || (linux && mips) || (linux && mipsle) || (linux && ppc)
-// +build linux,386 linux,arm linux,mips linux,mipsle linux,ppc
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/fdset.go b/vendor/golang.org/x/sys/unix/fdset.go
index a8068f94f29..9e83d18cd04 100644
--- a/vendor/golang.org/x/sys/unix/fdset.go
+++ b/vendor/golang.org/x/sys/unix/fdset.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/fstatfs_zos.go b/vendor/golang.org/x/sys/unix/fstatfs_zos.go
index e377cc9f49c..c8bde601e77 100644
--- a/vendor/golang.org/x/sys/unix/fstatfs_zos.go
+++ b/vendor/golang.org/x/sys/unix/fstatfs_zos.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/gccgo.go b/vendor/golang.org/x/sys/unix/gccgo.go
index b06f52d748f..aca5721ddcc 100644
--- a/vendor/golang.org/x/sys/unix/gccgo.go
+++ b/vendor/golang.org/x/sys/unix/gccgo.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gccgo && !aix && !hurd
-// +build gccgo,!aix,!hurd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/gccgo_c.c b/vendor/golang.org/x/sys/unix/gccgo_c.c
index f98a1c542f0..d468b7b47f1 100644
--- a/vendor/golang.org/x/sys/unix/gccgo_c.c
+++ b/vendor/golang.org/x/sys/unix/gccgo_c.c
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gccgo && !aix && !hurd
-// +build gccgo,!aix,!hurd
 
 #include <errno.h>
 #include <stdint.h>
diff --git a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go
index e60e49a3d9c..972d61bd754 100644
--- a/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/gccgo_linux_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build gccgo && linux && amd64
-// +build gccgo,linux,amd64
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ifreq_linux.go b/vendor/golang.org/x/sys/unix/ifreq_linux.go
index 15721a5104e..848840ae4c7 100644
--- a/vendor/golang.org/x/sys/unix/ifreq_linux.go
+++ b/vendor/golang.org/x/sys/unix/ifreq_linux.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux
-// +build linux
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ioctl_linux.go b/vendor/golang.org/x/sys/unix/ioctl_linux.go
index 0d12c0851ad..dbe680eab88 100644
--- a/vendor/golang.org/x/sys/unix/ioctl_linux.go
+++ b/vendor/golang.org/x/sys/unix/ioctl_linux.go
@@ -231,3 +231,8 @@ func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) {
 func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error {
 	return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value))
 }
+
+// IoctlLoopConfigure configures all loop device parameters in a single step
+func IoctlLoopConfigure(fd int, value *LoopConfig) error {
+	return ioctlPtr(fd, LOOP_CONFIGURE, unsafe.Pointer(value))
+}
diff --git a/vendor/golang.org/x/sys/unix/ioctl_signed.go b/vendor/golang.org/x/sys/unix/ioctl_signed.go
new file mode 100644
index 00000000000..5b0759bd865
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/ioctl_signed.go
@@ -0,0 +1,69 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build aix || solaris
+
+package unix
+
+import (
+	"unsafe"
+)
+
+// ioctl itself should not be exposed directly, but additional get/set
+// functions for specific types are permissible.
+
+// IoctlSetInt performs an ioctl operation which sets an integer value
+// on fd, using the specified request number.
+func IoctlSetInt(fd int, req int, value int) error {
+	return ioctl(fd, req, uintptr(value))
+}
+
+// IoctlSetPointerInt performs an ioctl operation which sets an
+// integer value on fd, using the specified request number. The ioctl
+// argument is called with a pointer to the integer value, rather than
+// passing the integer value directly.
+func IoctlSetPointerInt(fd int, req int, value int) error {
+	v := int32(value)
+	return ioctlPtr(fd, req, unsafe.Pointer(&v))
+}
+
+// IoctlSetWinsize performs an ioctl on fd with a *Winsize argument.
+//
+// To change fd's window size, the req argument should be TIOCSWINSZ.
+func IoctlSetWinsize(fd int, req int, value *Winsize) error {
+	// TODO: if we get the chance, remove the req parameter and
+	// hardcode TIOCSWINSZ.
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
+}
+
+// IoctlSetTermios performs an ioctl on fd with a *Termios.
+//
+// The req value will usually be TCSETA or TIOCSETA.
+func IoctlSetTermios(fd int, req int, value *Termios) error {
+	// TODO: if we get the chance, remove the req parameter.
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
+}
+
+// IoctlGetInt performs an ioctl operation which gets an integer value
+// from fd, using the specified request number.
+//
+// A few ioctl requests use the return value as an output parameter;
+// for those, IoctlRetInt should be used instead of this function.
+func IoctlGetInt(fd int, req int) (int, error) {
+	var value int
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
+	return value, err
+}
+
+func IoctlGetWinsize(fd int, req int) (*Winsize, error) {
+	var value Winsize
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
+	return &value, err
+}
+
+func IoctlGetTermios(fd int, req int) (*Termios, error) {
+	var value Termios
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
+	return &value, err
+}
diff --git a/vendor/golang.org/x/sys/unix/ioctl.go b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go
similarity index 76%
rename from vendor/golang.org/x/sys/unix/ioctl.go
rename to vendor/golang.org/x/sys/unix/ioctl_unsigned.go
index 1c51b0ec2bc..20f470b9d09 100644
--- a/vendor/golang.org/x/sys/unix/ioctl.go
+++ b/vendor/golang.org/x/sys/unix/ioctl_unsigned.go
@@ -2,13 +2,11 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build aix || darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd || solaris
-// +build aix darwin dragonfly freebsd hurd linux netbsd openbsd solaris
+//go:build darwin || dragonfly || freebsd || hurd || linux || netbsd || openbsd
 
 package unix
 
 import (
-	"runtime"
 	"unsafe"
 )
 
@@ -27,7 +25,7 @@ func IoctlSetInt(fd int, req uint, value int) error {
 // passing the integer value directly.
 func IoctlSetPointerInt(fd int, req uint, value int) error {
 	v := int32(value)
-	return ioctl(fd, req, uintptr(unsafe.Pointer(&v)))
+	return ioctlPtr(fd, req, unsafe.Pointer(&v))
 }
 
 // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument.
@@ -36,9 +34,7 @@ func IoctlSetPointerInt(fd int, req uint, value int) error {
 func IoctlSetWinsize(fd int, req uint, value *Winsize) error {
 	// TODO: if we get the chance, remove the req parameter and
 	// hardcode TIOCSWINSZ.
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(value)))
-	runtime.KeepAlive(value)
-	return err
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
 }
 
 // IoctlSetTermios performs an ioctl on fd with a *Termios.
@@ -46,9 +42,7 @@ func IoctlSetWinsize(fd int, req uint, value *Winsize) error {
 // The req value will usually be TCSETA or TIOCSETA.
 func IoctlSetTermios(fd int, req uint, value *Termios) error {
 	// TODO: if we get the chance, remove the req parameter.
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(value)))
-	runtime.KeepAlive(value)
-	return err
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
 }
 
 // IoctlGetInt performs an ioctl operation which gets an integer value
@@ -58,18 +52,18 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error {
 // for those, IoctlRetInt should be used instead of this function.
 func IoctlGetInt(fd int, req uint) (int, error) {
 	var value int
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return value, err
 }
 
 func IoctlGetWinsize(fd int, req uint) (*Winsize, error) {
 	var value Winsize
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return &value, err
 }
 
 func IoctlGetTermios(fd int, req uint) (*Termios, error) {
 	var value Termios
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return &value, err
 }
diff --git a/vendor/golang.org/x/sys/unix/ioctl_zos.go b/vendor/golang.org/x/sys/unix/ioctl_zos.go
index 5384e7d91d7..c8b2a750f8c 100644
--- a/vendor/golang.org/x/sys/unix/ioctl_zos.go
+++ b/vendor/golang.org/x/sys/unix/ioctl_zos.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
@@ -17,25 +16,23 @@ import (
 
 // IoctlSetInt performs an ioctl operation which sets an integer value
 // on fd, using the specified request number.
-func IoctlSetInt(fd int, req uint, value int) error {
+func IoctlSetInt(fd int, req int, value int) error {
 	return ioctl(fd, req, uintptr(value))
 }
 
 // IoctlSetWinsize performs an ioctl on fd with a *Winsize argument.
 //
 // To change fd's window size, the req argument should be TIOCSWINSZ.
-func IoctlSetWinsize(fd int, req uint, value *Winsize) error {
+func IoctlSetWinsize(fd int, req int, value *Winsize) error {
 	// TODO: if we get the chance, remove the req parameter and
 	// hardcode TIOCSWINSZ.
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(value)))
-	runtime.KeepAlive(value)
-	return err
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
 }
 
 // IoctlSetTermios performs an ioctl on fd with a *Termios.
 //
 // The req value is expected to be TCSETS, TCSETSW, or TCSETSF
-func IoctlSetTermios(fd int, req uint, value *Termios) error {
+func IoctlSetTermios(fd int, req int, value *Termios) error {
 	if (req != TCSETS) && (req != TCSETSW) && (req != TCSETSF) {
 		return ENOSYS
 	}
@@ -49,22 +46,22 @@ func IoctlSetTermios(fd int, req uint, value *Termios) error {
 //
 // A few ioctl requests use the return value as an output parameter;
 // for those, IoctlRetInt should be used instead of this function.
-func IoctlGetInt(fd int, req uint) (int, error) {
+func IoctlGetInt(fd int, req int) (int, error) {
 	var value int
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return value, err
 }
 
-func IoctlGetWinsize(fd int, req uint) (*Winsize, error) {
+func IoctlGetWinsize(fd int, req int) (*Winsize, error) {
 	var value Winsize
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return &value, err
 }
 
 // IoctlGetTermios performs an ioctl on fd with a *Termios.
 //
 // The req value is expected to be TCGETS
-func IoctlGetTermios(fd int, req uint) (*Termios, error) {
+func IoctlGetTermios(fd int, req int) (*Termios, error) {
 	var value Termios
 	if req != TCGETS {
 		return &value, ENOSYS
diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh
index 8e3947c3686..e6f31d374df 100644
--- a/vendor/golang.org/x/sys/unix/mkall.sh
+++ b/vendor/golang.org/x/sys/unix/mkall.sh
@@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then
 	# Use the Docker-based build system
 	# Files generated through docker (use $cmd so you can Ctl-C the build or run)
 	$cmd docker build --tag generate:$GOOS $GOOS
-	$cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS
+	$cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS
 	exit
 fi
 
diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh
index 7456d9ddde1..6202638bae8 100644
--- a/vendor/golang.org/x/sys/unix/mkerrors.sh
+++ b/vendor/golang.org/x/sys/unix/mkerrors.sh
@@ -66,6 +66,7 @@ includes_Darwin='
 #include <sys/ptrace.h>
 #include <sys/select.h>
 #include <sys/socket.h>
+#include <sys/stat.h>
 #include <sys/un.h>
 #include <sys/sockio.h>
 #include <sys/sys_domain.h>
@@ -203,6 +204,7 @@ struct ltchars {
 #include <sys/timerfd.h>
 #include <sys/uio.h>
 #include <sys/xattr.h>
+#include <netinet/udp.h>
 #include <linux/audit.h>
 #include <linux/bpf.h>
 #include <linux/can.h>
@@ -517,10 +519,12 @@ ccflags="$@"
 		$2 ~ /^LOCK_(SH|EX|NB|UN)$/ ||
 		$2 ~ /^LO_(KEY|NAME)_SIZE$/ ||
 		$2 ~ /^LOOP_(CLR|CTL|GET|SET)_/ ||
-		$2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT)_/ ||
+		$2 == "LOOP_CONFIGURE" ||
+		$2 ~ /^(AF|SOCK|SO|SOL|IPPROTO|IP|IPV6|TCP|MCAST|EVFILT|NOTE|SHUT|PROT|MAP|MREMAP|MFD|T?PACKET|MSG|SCM|MCL|DT|MADV|PR|LOCAL|TCPOPT|UDP)_/ ||
 		$2 ~ /^NFC_(GENL|PROTO|COMM|RF|SE|DIRECTION|LLCP|SOCKPROTO)_/ ||
 		$2 ~ /^NFC_.*_(MAX)?SIZE$/ ||
 		$2 ~ /^RAW_PAYLOAD_/ ||
+		$2 ~ /^[US]F_/ ||
 		$2 ~ /^TP_STATUS_/ ||
 		$2 ~ /^FALLOC_/ ||
 		$2 ~ /^ICMPV?6?_(FILTER|SEC)/ ||
@@ -557,7 +561,7 @@ ccflags="$@"
 		$2 ~ /^RLIMIT_(AS|CORE|CPU|DATA|FSIZE|LOCKS|MEMLOCK|MSGQUEUE|NICE|NOFILE|NPROC|RSS|RTPRIO|RTTIME|SIGPENDING|STACK)|RLIM_INFINITY/ ||
 		$2 ~ /^PRIO_(PROCESS|PGRP|USER)/ ||
 		$2 ~ /^CLONE_[A-Z_]+/ ||
-		$2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ &&
+		$2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+|BPF_F_LINK)$/ &&
 		$2 ~ /^(BPF|DLT)_/ ||
 		$2 ~ /^AUDIT_/ ||
 		$2 ~ /^(CLOCK|TIMER)_/ ||
@@ -580,6 +584,7 @@ ccflags="$@"
 		$2 ~ /^PERF_/ ||
 		$2 ~ /^SECCOMP_MODE_/ ||
 		$2 ~ /^SEEK_/ ||
+		$2 ~ /^SCHED_/ ||
 		$2 ~ /^SPLICE_/ ||
 		$2 ~ /^SYNC_FILE_RANGE_/ ||
 		$2 !~ /IOC_MAGIC/ &&
@@ -621,7 +626,7 @@ ccflags="$@"
 		$2 ~ /^MEM/ ||
 		$2 ~ /^WG/ ||
 		$2 ~ /^FIB_RULE_/ ||
-		$2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE)/ {printf("\t%s = C.%s\n", $2, $2)}
+		$2 ~ /^BLK[A-Z]*(GET$|SET$|BUF$|PART$|SIZE|IOMIN$|IOOPT$|ALIGNOFF$|DISCARD|ROTATIONAL$|ZEROOUT$|GETDISKSEQ$)/ {printf("\t%s = C.%s\n", $2, $2)}
 		$2 ~ /^__WCOREFLAG$/ {next}
 		$2 ~ /^__W[A-Z0-9]+$/ {printf("\t%s = C.%s\n", substr($2,3), $2)}
 
@@ -659,7 +664,6 @@ echo '// mkerrors.sh' "$@"
 echo '// Code generated by the command above; see README.md. DO NOT EDIT.'
 echo
 echo "//go:build ${GOARCH} && ${GOOS}"
-echo "// +build ${GOARCH},${GOOS}"
 echo
 go tool cgo -godefs -- "$@" _const.go >_error.out
 cat _error.out | grep -vf _error.grep | grep -vf _signal.grep
@@ -738,7 +742,8 @@ main(void)
 		e = errors[i].num;
 		if(i > 0 && errors[i-1].num == e)
 			continue;
-		strcpy(buf, strerror(e));
+		strncpy(buf, strerror(e), sizeof(buf) - 1);
+		buf[sizeof(buf) - 1] = '\0';
 		// lowercase first letter: Bad -> bad, but STREAM -> STREAM.
 		if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z)
 			buf[0] += a - A;
@@ -757,7 +762,8 @@ main(void)
 		e = signals[i].num;
 		if(i > 0 && signals[i-1].num == e)
 			continue;
-		strcpy(buf, strsignal(e));
+		strncpy(buf, strsignal(e), sizeof(buf) - 1);
+		buf[sizeof(buf) - 1] = '\0';
 		// lowercase first letter: Bad -> bad, but STREAM -> STREAM.
 		if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z)
 			buf[0] += a - A;
diff --git a/vendor/golang.org/x/sys/unix/mmap_nomremap.go b/vendor/golang.org/x/sys/unix/mmap_nomremap.go
new file mode 100644
index 00000000000..4b68e59780a
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/mmap_nomremap.go
@@ -0,0 +1,13 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build aix || darwin || dragonfly || freebsd || openbsd || solaris
+
+package unix
+
+var mapper = &mmapper{
+	active: make(map[*byte][]byte),
+	mmap:   mmap,
+	munmap: munmap,
+}
diff --git a/vendor/golang.org/x/sys/unix/mremap.go b/vendor/golang.org/x/sys/unix/mremap.go
new file mode 100644
index 00000000000..fd45fe529da
--- /dev/null
+++ b/vendor/golang.org/x/sys/unix/mremap.go
@@ -0,0 +1,52 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:build linux || netbsd
+
+package unix
+
+import "unsafe"
+
+type mremapMmapper struct {
+	mmapper
+	mremap func(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error)
+}
+
+var mapper = &mremapMmapper{
+	mmapper: mmapper{
+		active: make(map[*byte][]byte),
+		mmap:   mmap,
+		munmap: munmap,
+	},
+	mremap: mremap,
+}
+
+func (m *mremapMmapper) Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) {
+	if newLength <= 0 || len(oldData) == 0 || len(oldData) != cap(oldData) || flags&mremapFixed != 0 {
+		return nil, EINVAL
+	}
+
+	pOld := &oldData[cap(oldData)-1]
+	m.Lock()
+	defer m.Unlock()
+	bOld := m.active[pOld]
+	if bOld == nil || &bOld[0] != &oldData[0] {
+		return nil, EINVAL
+	}
+	newAddr, errno := m.mremap(uintptr(unsafe.Pointer(&bOld[0])), uintptr(len(bOld)), uintptr(newLength), flags, 0)
+	if errno != nil {
+		return nil, errno
+	}
+	bNew := unsafe.Slice((*byte)(unsafe.Pointer(newAddr)), newLength)
+	pNew := &bNew[cap(bNew)-1]
+	if flags&mremapDontunmap == 0 {
+		delete(m.active, pOld)
+	}
+	m.active[pNew] = bNew
+	return bNew, nil
+}
+
+func Mremap(oldData []byte, newLength int, flags int) (data []byte, err error) {
+	return mapper.Mremap(oldData, newLength, flags)
+}
diff --git a/vendor/golang.org/x/sys/unix/pagesize_unix.go b/vendor/golang.org/x/sys/unix/pagesize_unix.go
index 53f1b4c5b81..4d0a3430edc 100644
--- a/vendor/golang.org/x/sys/unix/pagesize_unix.go
+++ b/vendor/golang.org/x/sys/unix/pagesize_unix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
 
 // For Unix, get the pagesize from the runtime.
 
diff --git a/vendor/golang.org/x/sys/unix/pledge_openbsd.go b/vendor/golang.org/x/sys/unix/pledge_openbsd.go
index eb48294b274..6a09af53e6b 100644
--- a/vendor/golang.org/x/sys/unix/pledge_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/pledge_openbsd.go
@@ -8,54 +8,31 @@ import (
 	"errors"
 	"fmt"
 	"strconv"
-	"syscall"
-	"unsafe"
 )
 
 // Pledge implements the pledge syscall.
 //
-// The pledge syscall does not accept execpromises on OpenBSD releases
-// before 6.3.
-//
-// execpromises must be empty when Pledge is called on OpenBSD
-// releases predating 6.3, otherwise an error will be returned.
+// This changes both the promises and execpromises; use PledgePromises or
+// PledgeExecpromises to only change the promises or execpromises
+// respectively.
 //
 // For more information see pledge(2).
 func Pledge(promises, execpromises string) error {
-	maj, min, err := majmin()
-	if err != nil {
+	if err := pledgeAvailable(); err != nil {
 		return err
 	}
 
-	err = pledgeAvailable(maj, min, execpromises)
+	pptr, err := BytePtrFromString(promises)
 	if err != nil {
 		return err
 	}
 
-	pptr, err := syscall.BytePtrFromString(promises)
+	exptr, err := BytePtrFromString(execpromises)
 	if err != nil {
 		return err
 	}
 
-	// This variable will hold either a nil unsafe.Pointer or
-	// an unsafe.Pointer to a string (execpromises).
-	var expr unsafe.Pointer
-
-	// If we're running on OpenBSD > 6.2, pass execpromises to the syscall.
-	if maj > 6 || (maj == 6 && min > 2) {
-		exptr, err := syscall.BytePtrFromString(execpromises)
-		if err != nil {
-			return err
-		}
-		expr = unsafe.Pointer(exptr)
-	}
-
-	_, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0)
-	if e != 0 {
-		return e
-	}
-
-	return nil
+	return pledge(pptr, exptr)
 }
 
 // PledgePromises implements the pledge syscall.
@@ -64,30 +41,16 @@ func Pledge(promises, execpromises string) error {
 //
 // For more information see pledge(2).
 func PledgePromises(promises string) error {
-	maj, min, err := majmin()
-	if err != nil {
-		return err
-	}
-
-	err = pledgeAvailable(maj, min, "")
-	if err != nil {
+	if err := pledgeAvailable(); err != nil {
 		return err
 	}
 
-	// This variable holds the execpromises and is always nil.
-	var expr unsafe.Pointer
-
-	pptr, err := syscall.BytePtrFromString(promises)
+	pptr, err := BytePtrFromString(promises)
 	if err != nil {
 		return err
 	}
 
-	_, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(unsafe.Pointer(pptr)), uintptr(expr), 0)
-	if e != 0 {
-		return e
-	}
-
-	return nil
+	return pledge(pptr, nil)
 }
 
 // PledgeExecpromises implements the pledge syscall.
@@ -96,30 +59,16 @@ func PledgePromises(promises string) error {
 //
 // For more information see pledge(2).
 func PledgeExecpromises(execpromises string) error {
-	maj, min, err := majmin()
-	if err != nil {
+	if err := pledgeAvailable(); err != nil {
 		return err
 	}
 
-	err = pledgeAvailable(maj, min, execpromises)
+	exptr, err := BytePtrFromString(execpromises)
 	if err != nil {
 		return err
 	}
 
-	// This variable holds the promises and is always nil.
-	var pptr unsafe.Pointer
-
-	exptr, err := syscall.BytePtrFromString(execpromises)
-	if err != nil {
-		return err
-	}
-
-	_, _, e := syscall.Syscall(SYS_PLEDGE, uintptr(pptr), uintptr(unsafe.Pointer(exptr)), 0)
-	if e != 0 {
-		return e
-	}
-
-	return nil
+	return pledge(nil, exptr)
 }
 
 // majmin returns major and minor version number for an OpenBSD system.
@@ -147,16 +96,15 @@ func majmin() (major int, minor int, err error) {
 
 // pledgeAvailable checks for availability of the pledge(2) syscall
 // based on the running OpenBSD version.
-func pledgeAvailable(maj, min int, execpromises string) error {
-	// If OpenBSD <= 5.9, pledge is not available.
-	if (maj == 5 && min != 9) || maj < 5 {
-		return fmt.Errorf("pledge syscall is not available on OpenBSD %d.%d", maj, min)
+func pledgeAvailable() error {
+	maj, min, err := majmin()
+	if err != nil {
+		return err
 	}
 
-	// If OpenBSD <= 6.2 and execpromises is not empty,
-	// return an error - execpromises is not available before 6.3
-	if (maj < 6 || (maj == 6 && min <= 2)) && execpromises != "" {
-		return fmt.Errorf("cannot use execpromises on OpenBSD %d.%d", maj, min)
+	// Require OpenBSD 6.4 as a minimum.
+	if maj < 6 || (maj == 6 && min <= 3) {
+		return fmt.Errorf("cannot call Pledge on OpenBSD %d.%d", maj, min)
 	}
 
 	return nil
diff --git a/vendor/golang.org/x/sys/unix/ptrace_darwin.go b/vendor/golang.org/x/sys/unix/ptrace_darwin.go
index 463c3eff7fd..3f0975f3de7 100644
--- a/vendor/golang.org/x/sys/unix/ptrace_darwin.go
+++ b/vendor/golang.org/x/sys/unix/ptrace_darwin.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build darwin && !ios
-// +build darwin,!ios
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ptrace_ios.go b/vendor/golang.org/x/sys/unix/ptrace_ios.go
index ed0509a0117..a4d35db5dc2 100644
--- a/vendor/golang.org/x/sys/unix/ptrace_ios.go
+++ b/vendor/golang.org/x/sys/unix/ptrace_ios.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build ios
-// +build ios
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/race.go b/vendor/golang.org/x/sys/unix/race.go
index 6f6c5fec5ae..714d2aae7c0 100644
--- a/vendor/golang.org/x/sys/unix/race.go
+++ b/vendor/golang.org/x/sys/unix/race.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin && race) || (linux && race) || (freebsd && race)
-// +build darwin,race linux,race freebsd,race
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/race0.go b/vendor/golang.org/x/sys/unix/race0.go
index 706e1322ae4..4a9f6634c98 100644
--- a/vendor/golang.org/x/sys/unix/race0.go
+++ b/vendor/golang.org/x/sys/unix/race0.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || (darwin && !race) || (linux && !race) || (freebsd && !race) || netbsd || openbsd || solaris || dragonfly || zos
-// +build aix darwin,!race linux,!race freebsd,!race netbsd openbsd solaris dragonfly zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdents.go b/vendor/golang.org/x/sys/unix/readdirent_getdents.go
index 4d6257569ea..dbd2b6ccb1b 100644
--- a/vendor/golang.org/x/sys/unix/readdirent_getdents.go
+++ b/vendor/golang.org/x/sys/unix/readdirent_getdents.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || dragonfly || freebsd || linux || netbsd || openbsd
-// +build aix dragonfly freebsd linux netbsd openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go
index 2a4ba47c45b..130398b6b76 100644
--- a/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go
+++ b/vendor/golang.org/x/sys/unix/readdirent_getdirentries.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build darwin
-// +build darwin
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
index 3865943f6e2..c3a62dbb1b6 100644
--- a/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
+++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 // Socket control messages
 
diff --git a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go
index 0840fe4a574..4a1eab37ec0 100644
--- a/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go
+++ b/vendor/golang.org/x/sys/unix/sockcmsg_unix_other.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin freebsd linux netbsd openbsd solaris zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall.go b/vendor/golang.org/x/sys/unix/syscall.go
index 63e8c838317..5ea74da9820 100644
--- a/vendor/golang.org/x/sys/unix/syscall.go
+++ b/vendor/golang.org/x/sys/unix/syscall.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 // Package unix contains an interface to the low-level operating system
 // primitives. OS details vary depending on the underlying system, and
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix.go b/vendor/golang.org/x/sys/unix/syscall_aix.go
index 2db1b51e99f..67ce6cef2d5 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix
-// +build aix
 
 // Aix system calls.
 // This file is compiled as ordinary Go code,
@@ -107,7 +106,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) {
 	if n > 0 {
 		sl += _Socklen(n) + 1
 	}
-	if sa.raw.Path[0] == '@' {
+	if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) {
+		// Check sl > 3 so we don't change unnamed socket behavior.
 		sa.raw.Path[0] = 0
 		// Don't count trailing NUL for abstract address.
 		sl--
@@ -292,9 +292,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
 				break
 			}
 		}
-
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -410,7 +408,8 @@ func (w WaitStatus) CoreDump() bool { return w&0x80 == 0x80 }
 
 func (w WaitStatus) TrapCause() int { return -1 }
 
-//sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctl(fd int, req int, arg uintptr) (err error)
+//sys	ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = ioctl
 
 // fcntl must never be called with cmd=F_DUP2FD because it doesn't work on AIX
 // There is no way to create a custom fcntl and to keep //sys fcntl easily,
@@ -488,8 +487,6 @@ func Fsync(fd int) error {
 //sys	Unlinkat(dirfd int, path string, flags int) (err error)
 //sys	Ustat(dev int, ubuf *Ustat_t) (err error)
 //sys	write(fd int, p []byte) (n int, err error)
-//sys	readlen(fd int, p *byte, np int) (n int, err error) = read
-//sys	writelen(fd int, p *byte, np int) (n int, err error) = write
 
 //sys	Dup2(oldfd int, newfd int) (err error)
 //sys	Fadvise(fd int, offset int64, length int64, advice int) (err error) = posix_fadvise64
@@ -536,21 +533,6 @@ func Fsync(fd int) error {
 //sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = nsendmsg
 
 //sys	munmap(addr uintptr, length uintptr) (err error)
-
-var mapper = &mmapper{
-	active: make(map[*byte][]byte),
-	mmap:   mmap,
-	munmap: munmap,
-}
-
-func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
-	return mapper.Mmap(fd, offset, length, prot, flags)
-}
-
-func Munmap(b []byte) (err error) {
-	return mapper.Munmap(b)
-}
-
 //sys	Madvise(b []byte, advice int) (err error)
 //sys	Mprotect(b []byte, prot int) (err error)
 //sys	Mlock(b []byte) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
index e92a0be1630..1fdaa476005 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc.go
@@ -3,12 +3,10 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix && ppc
-// +build aix,ppc
 
 package unix
 
 //sysnb	Getrlimit(resource int, rlim *Rlimit) (err error) = getrlimit64
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error) = setrlimit64
 //sys	Seek(fd int, offset int64, whence int) (off int64, err error) = lseek64
 
 //sys	mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
index 16eed17098e..c87f9a9f456 100644
--- a/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_aix_ppc64.go
@@ -3,12 +3,10 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix && ppc64
-// +build aix,ppc64
 
 package unix
 
 //sysnb	Getrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Seek(fd int, offset int64, whence int) (off int64, err error) = lseek
 
 //sys	mmap(addr uintptr, length uintptr, prot int, flags int, fd int, offset int64) (xaddr uintptr, err error) = mmap64
diff --git a/vendor/golang.org/x/sys/unix/syscall_bsd.go b/vendor/golang.org/x/sys/unix/syscall_bsd.go
index eda42671f19..a00c3e5450b 100644
--- a/vendor/golang.org/x/sys/unix/syscall_bsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_bsd.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build darwin || dragonfly || freebsd || netbsd || openbsd
-// +build darwin dragonfly freebsd netbsd openbsd
 
 // BSD system call wrappers shared by *BSD based systems
 // including OS X (Darwin) and FreeBSD.  Like the other
@@ -245,8 +244,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
 				break
 			}
 		}
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -318,7 +316,7 @@ func GetsockoptString(fd, level, opt int) (string, error) {
 	if err != nil {
 		return "", err
 	}
-	return string(buf[:vallen-1]), nil
+	return ByteSliceToString(buf[:vallen]), nil
 }
 
 //sys	recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error)
@@ -602,20 +600,6 @@ func Poll(fds []PollFd, timeout int) (n int, err error) {
 //	Gethostuuid(uuid *byte, timeout *Timespec) (err error)
 //	Ptrace(req int, pid int, addr uintptr, data int) (ret uintptr, err error)
 
-var mapper = &mmapper{
-	active: make(map[*byte][]byte),
-	mmap:   mmap,
-	munmap: munmap,
-}
-
-func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
-	return mapper.Mmap(fd, offset, length, prot, flags)
-}
-
-func Munmap(b []byte) (err error) {
-	return mapper.Munmap(b)
-}
-
 //sys	Madvise(b []byte, behav int) (err error)
 //sys	Mlock(b []byte) (err error)
 //sys	Mlockall(flags int) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go
index 192b071b3d0..59542a897d2 100644
--- a/vendor/golang.org/x/sys/unix/syscall_darwin.go
+++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go
@@ -14,7 +14,6 @@ package unix
 
 import (
 	"fmt"
-	"runtime"
 	"syscall"
 	"unsafe"
 )
@@ -376,11 +375,10 @@ func Flistxattr(fd int, dest []byte) (sz int, err error) {
 func Kill(pid int, signum syscall.Signal) (err error) { return kill(pid, int(signum), 1) }
 
 //sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 func IoctlCtlInfo(fd int, ctlInfo *CtlInfo) error {
-	err := ioctl(fd, CTLIOCGINFO, uintptr(unsafe.Pointer(ctlInfo)))
-	runtime.KeepAlive(ctlInfo)
-	return err
+	return ioctlPtr(fd, CTLIOCGINFO, unsafe.Pointer(ctlInfo))
 }
 
 // IfreqMTU is struct ifreq used to get or set a network device's MTU.
@@ -394,16 +392,14 @@ type IfreqMTU struct {
 func IoctlGetIfreqMTU(fd int, ifname string) (*IfreqMTU, error) {
 	var ifreq IfreqMTU
 	copy(ifreq.Name[:], ifname)
-	err := ioctl(fd, SIOCGIFMTU, uintptr(unsafe.Pointer(&ifreq)))
+	err := ioctlPtr(fd, SIOCGIFMTU, unsafe.Pointer(&ifreq))
 	return &ifreq, err
 }
 
 // IoctlSetIfreqMTU performs the SIOCSIFMTU ioctl operation on fd to set the MTU
 // of the network device specified by ifreq.Name.
 func IoctlSetIfreqMTU(fd int, ifreq *IfreqMTU) error {
-	err := ioctl(fd, SIOCSIFMTU, uintptr(unsafe.Pointer(ifreq)))
-	runtime.KeepAlive(ifreq)
-	return err
+	return ioctlPtr(fd, SIOCSIFMTU, unsafe.Pointer(ifreq))
 }
 
 //sys	sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS_SYSCTL
@@ -514,30 +510,36 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 		return nil, err
 	}
 
-	// Find size.
-	n := uintptr(0)
-	if err := sysctl(mib, nil, &n, nil, 0); err != nil {
-		return nil, err
-	}
-	if n == 0 {
-		return nil, nil
-	}
-	if n%SizeofKinfoProc != 0 {
-		return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc)
-	}
+	for {
+		// Find size.
+		n := uintptr(0)
+		if err := sysctl(mib, nil, &n, nil, 0); err != nil {
+			return nil, err
+		}
+		if n == 0 {
+			return nil, nil
+		}
+		if n%SizeofKinfoProc != 0 {
+			return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc)
+		}
 
-	// Read into buffer of that size.
-	buf := make([]KinfoProc, n/SizeofKinfoProc)
-	if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil {
-		return nil, err
-	}
-	if n%SizeofKinfoProc != 0 {
-		return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc)
-	}
+		// Read into buffer of that size.
+		buf := make([]KinfoProc, n/SizeofKinfoProc)
+		if err := sysctl(mib, (*byte)(unsafe.Pointer(&buf[0])), &n, nil, 0); err != nil {
+			if err == ENOMEM {
+				// Process table grew. Try again.
+				continue
+			}
+			return nil, err
+		}
+		if n%SizeofKinfoProc != 0 {
+			return nil, fmt.Errorf("sysctl() returned a size of %d, which is not a multiple of %d", n, SizeofKinfoProc)
+		}
 
-	// The actual call may return less than the original reported required
-	// size so ensure we deal with that.
-	return buf[:n/SizeofKinfoProc], nil
+		// The actual call may return less than the original reported required
+		// size so ensure we deal with that.
+		return buf[:n/SizeofKinfoProc], nil
+	}
 }
 
 //sys	sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error)
@@ -617,6 +619,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 //sys	Rmdir(path string) (err error)
 //sys	Seek(fd int, offset int64, whence int) (newoffset int64, err error) = SYS_LSEEK
 //sys	Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error)
+//sys	Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error)
 //sys	Setegid(egid int) (err error)
 //sysnb	Seteuid(euid int) (err error)
 //sysnb	Setgid(gid int) (err error)
@@ -626,7 +629,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 //sys	Setprivexec(flag int) (err error)
 //sysnb	Setregid(rgid int, egid int) (err error)
 //sysnb	Setreuid(ruid int, euid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
 //sysnb	Setuid(uid int) (err error)
@@ -642,190 +644,3 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error)
 //sys	munmap(addr uintptr, length uintptr) (err error)
-//sys	readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE
-
-/*
- * Unimplemented
- */
-// Profil
-// Sigaction
-// Sigprocmask
-// Getlogin
-// Sigpending
-// Sigaltstack
-// Ioctl
-// Reboot
-// Execve
-// Vfork
-// Sbrk
-// Sstk
-// Ovadvise
-// Mincore
-// Setitimer
-// Swapon
-// Select
-// Sigsuspend
-// Readv
-// Writev
-// Nfssvc
-// Getfh
-// Quotactl
-// Csops
-// Waitid
-// Add_profil
-// Kdebug_trace
-// Sigreturn
-// Atsocket
-// Kqueue_from_portset_np
-// Kqueue_portset
-// Getattrlist
-// Setattrlist
-// Getdirentriesattr
-// Searchfs
-// Delete
-// Copyfile
-// Watchevent
-// Waitevent
-// Modwatch
-// Fsctl
-// Initgroups
-// Posix_spawn
-// Nfsclnt
-// Fhopen
-// Minherit
-// Semsys
-// Msgsys
-// Shmsys
-// Semctl
-// Semget
-// Semop
-// Msgctl
-// Msgget
-// Msgsnd
-// Msgrcv
-// Shm_open
-// Shm_unlink
-// Sem_open
-// Sem_close
-// Sem_unlink
-// Sem_wait
-// Sem_trywait
-// Sem_post
-// Sem_getvalue
-// Sem_init
-// Sem_destroy
-// Open_extended
-// Umask_extended
-// Stat_extended
-// Lstat_extended
-// Fstat_extended
-// Chmod_extended
-// Fchmod_extended
-// Access_extended
-// Settid
-// Gettid
-// Setsgroups
-// Getsgroups
-// Setwgroups
-// Getwgroups
-// Mkfifo_extended
-// Mkdir_extended
-// Identitysvc
-// Shared_region_check_np
-// Shared_region_map_np
-// __pthread_mutex_destroy
-// __pthread_mutex_init
-// __pthread_mutex_lock
-// __pthread_mutex_trylock
-// __pthread_mutex_unlock
-// __pthread_cond_init
-// __pthread_cond_destroy
-// __pthread_cond_broadcast
-// __pthread_cond_signal
-// Setsid_with_pid
-// __pthread_cond_timedwait
-// Aio_fsync
-// Aio_return
-// Aio_suspend
-// Aio_cancel
-// Aio_error
-// Aio_read
-// Aio_write
-// Lio_listio
-// __pthread_cond_wait
-// Iopolicysys
-// __pthread_kill
-// __pthread_sigmask
-// __sigwait
-// __disable_threadsignal
-// __pthread_markcancel
-// __pthread_canceled
-// __semwait_signal
-// Proc_info
-// sendfile
-// Stat64_extended
-// Lstat64_extended
-// Fstat64_extended
-// __pthread_chdir
-// __pthread_fchdir
-// Audit
-// Auditon
-// Getauid
-// Setauid
-// Getaudit
-// Setaudit
-// Getaudit_addr
-// Setaudit_addr
-// Auditctl
-// Bsdthread_create
-// Bsdthread_terminate
-// Stack_snapshot
-// Bsdthread_register
-// Workq_open
-// Workq_ops
-// __mac_execve
-// __mac_syscall
-// __mac_get_file
-// __mac_set_file
-// __mac_get_link
-// __mac_set_link
-// __mac_get_proc
-// __mac_set_proc
-// __mac_get_fd
-// __mac_set_fd
-// __mac_get_pid
-// __mac_get_lcid
-// __mac_get_lctx
-// __mac_set_lctx
-// Setlcid
-// Read_nocancel
-// Write_nocancel
-// Open_nocancel
-// Close_nocancel
-// Wait4_nocancel
-// Recvmsg_nocancel
-// Sendmsg_nocancel
-// Recvfrom_nocancel
-// Accept_nocancel
-// Fcntl_nocancel
-// Select_nocancel
-// Fsync_nocancel
-// Connect_nocancel
-// Sigsuspend_nocancel
-// Readv_nocancel
-// Writev_nocancel
-// Sendto_nocancel
-// Pread_nocancel
-// Pwrite_nocancel
-// Waitid_nocancel
-// Poll_nocancel
-// Msgsnd_nocancel
-// Msgrcv_nocancel
-// Sem_wait_nocancel
-// Aio_suspend_nocancel
-// __sigwait_nocancel
-// __semwait_signal_nocancel
-// __mac_mount
-// __mac_get_mount
-// __mac_getfsstat
diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go
index b37310ce9b4..0eaecf5fc32 100644
--- a/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_darwin_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && darwin
-// +build amd64,darwin
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go
index d51ec996304..f36c6707cfb 100644
--- a/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_darwin_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm64 && darwin
-// +build arm64,darwin
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go
index 53c96641f81..16dc6993799 100644
--- a/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go
+++ b/vendor/golang.org/x/sys/unix/syscall_darwin_libSystem.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build darwin && go1.12
-// +build darwin,go1.12
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
index a41111a794e..97cb916f2c9 100644
--- a/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
+++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly.go
@@ -172,6 +172,7 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) {
 }
 
 //sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 //sys	sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL
 
@@ -325,7 +326,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sysnb	Setreuid(ruid int, euid int) (err error)
 //sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
 //sysnb	Setresuid(ruid int, euid int, suid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
 //sysnb	Setuid(uid int) (err error)
@@ -343,203 +343,5 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error)
 //sys	munmap(addr uintptr, length uintptr) (err error)
-//sys	readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE
 //sys	accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error)
 //sys	utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error)
-
-/*
- * Unimplemented
- * TODO(jsing): Update this list for DragonFly.
- */
-// Profil
-// Sigaction
-// Sigprocmask
-// Getlogin
-// Sigpending
-// Sigaltstack
-// Reboot
-// Execve
-// Vfork
-// Sbrk
-// Sstk
-// Ovadvise
-// Mincore
-// Setitimer
-// Swapon
-// Select
-// Sigsuspend
-// Readv
-// Writev
-// Nfssvc
-// Getfh
-// Quotactl
-// Mount
-// Csops
-// Waitid
-// Add_profil
-// Kdebug_trace
-// Sigreturn
-// Atsocket
-// Kqueue_from_portset_np
-// Kqueue_portset
-// Getattrlist
-// Setattrlist
-// Getdirentriesattr
-// Searchfs
-// Delete
-// Copyfile
-// Watchevent
-// Waitevent
-// Modwatch
-// Getxattr
-// Fgetxattr
-// Setxattr
-// Fsetxattr
-// Removexattr
-// Fremovexattr
-// Listxattr
-// Flistxattr
-// Fsctl
-// Initgroups
-// Posix_spawn
-// Nfsclnt
-// Fhopen
-// Minherit
-// Semsys
-// Msgsys
-// Shmsys
-// Semctl
-// Semget
-// Semop
-// Msgctl
-// Msgget
-// Msgsnd
-// Msgrcv
-// Shmat
-// Shmctl
-// Shmdt
-// Shmget
-// Shm_open
-// Shm_unlink
-// Sem_open
-// Sem_close
-// Sem_unlink
-// Sem_wait
-// Sem_trywait
-// Sem_post
-// Sem_getvalue
-// Sem_init
-// Sem_destroy
-// Open_extended
-// Umask_extended
-// Stat_extended
-// Lstat_extended
-// Fstat_extended
-// Chmod_extended
-// Fchmod_extended
-// Access_extended
-// Settid
-// Gettid
-// Setsgroups
-// Getsgroups
-// Setwgroups
-// Getwgroups
-// Mkfifo_extended
-// Mkdir_extended
-// Identitysvc
-// Shared_region_check_np
-// Shared_region_map_np
-// __pthread_mutex_destroy
-// __pthread_mutex_init
-// __pthread_mutex_lock
-// __pthread_mutex_trylock
-// __pthread_mutex_unlock
-// __pthread_cond_init
-// __pthread_cond_destroy
-// __pthread_cond_broadcast
-// __pthread_cond_signal
-// Setsid_with_pid
-// __pthread_cond_timedwait
-// Aio_fsync
-// Aio_return
-// Aio_suspend
-// Aio_cancel
-// Aio_error
-// Aio_read
-// Aio_write
-// Lio_listio
-// __pthread_cond_wait
-// Iopolicysys
-// __pthread_kill
-// __pthread_sigmask
-// __sigwait
-// __disable_threadsignal
-// __pthread_markcancel
-// __pthread_canceled
-// __semwait_signal
-// Proc_info
-// Stat64_extended
-// Lstat64_extended
-// Fstat64_extended
-// __pthread_chdir
-// __pthread_fchdir
-// Audit
-// Auditon
-// Getauid
-// Setauid
-// Getaudit
-// Setaudit
-// Getaudit_addr
-// Setaudit_addr
-// Auditctl
-// Bsdthread_create
-// Bsdthread_terminate
-// Stack_snapshot
-// Bsdthread_register
-// Workq_open
-// Workq_ops
-// __mac_execve
-// __mac_syscall
-// __mac_get_file
-// __mac_set_file
-// __mac_get_link
-// __mac_set_link
-// __mac_get_proc
-// __mac_set_proc
-// __mac_get_fd
-// __mac_set_fd
-// __mac_get_pid
-// __mac_get_lcid
-// __mac_get_lctx
-// __mac_set_lctx
-// Setlcid
-// Read_nocancel
-// Write_nocancel
-// Open_nocancel
-// Close_nocancel
-// Wait4_nocancel
-// Recvmsg_nocancel
-// Sendmsg_nocancel
-// Recvfrom_nocancel
-// Accept_nocancel
-// Fcntl_nocancel
-// Select_nocancel
-// Fsync_nocancel
-// Connect_nocancel
-// Sigsuspend_nocancel
-// Readv_nocancel
-// Writev_nocancel
-// Sendto_nocancel
-// Pread_nocancel
-// Pwrite_nocancel
-// Waitid_nocancel
-// Msgsnd_nocancel
-// Msgrcv_nocancel
-// Sem_wait_nocancel
-// Aio_suspend_nocancel
-// __sigwait_nocancel
-// __semwait_signal_nocancel
-// __mac_mount
-// __mac_get_mount
-// __mac_getfsstat
diff --git a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go
index 4e2d32120a8..14bab6b2de5 100644
--- a/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_dragonfly_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && dragonfly
-// +build amd64,dragonfly
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd.go b/vendor/golang.org/x/sys/unix/syscall_freebsd.go
index d50b9dc250b..64d1bb4dba5 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd.go
@@ -161,7 +161,8 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) {
 	return
 }
 
-//sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL
+//sys	ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 //sys	sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL
 
@@ -253,6 +254,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 //sys	ptrace(request int, pid int, addr uintptr, data int) (err error)
+//sys	ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) = SYS_PTRACE
 
 func PtraceAttach(pid int) (err error) {
 	return ptrace(PT_ATTACH, pid, 0, 0)
@@ -267,19 +269,36 @@ func PtraceDetach(pid int) (err error) {
 }
 
 func PtraceGetFpRegs(pid int, fpregsout *FpReg) (err error) {
-	return ptrace(PT_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0)
+	return ptracePtr(PT_GETFPREGS, pid, unsafe.Pointer(fpregsout), 0)
 }
 
 func PtraceGetRegs(pid int, regsout *Reg) (err error) {
-	return ptrace(PT_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0)
+	return ptracePtr(PT_GETREGS, pid, unsafe.Pointer(regsout), 0)
+}
+
+func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
+	ioDesc := PtraceIoDesc{
+		Op:   int32(req),
+		Offs: offs,
+	}
+	if countin > 0 {
+		_ = out[:countin] // check bounds
+		ioDesc.Addr = &out[0]
+	} else if out != nil {
+		ioDesc.Addr = (*byte)(unsafe.Pointer(&_zero))
+	}
+	ioDesc.SetLen(countin)
+
+	err = ptracePtr(PT_IO, pid, unsafe.Pointer(&ioDesc), 0)
+	return int(ioDesc.Len), err
 }
 
 func PtraceLwpEvents(pid int, enable int) (err error) {
 	return ptrace(PT_LWP_EVENTS, pid, 0, enable)
 }
 
-func PtraceLwpInfo(pid int, info uintptr) (err error) {
-	return ptrace(PT_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{})))
+func PtraceLwpInfo(pid int, info *PtraceLwpInfoStruct) (err error) {
+	return ptracePtr(PT_LWPINFO, pid, unsafe.Pointer(info), int(unsafe.Sizeof(*info)))
 }
 
 func PtracePeekData(pid int, addr uintptr, out []byte) (count int, err error) {
@@ -299,13 +318,25 @@ func PtracePokeText(pid int, addr uintptr, data []byte) (count int, err error) {
 }
 
 func PtraceSetRegs(pid int, regs *Reg) (err error) {
-	return ptrace(PT_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0)
+	return ptracePtr(PT_SETREGS, pid, unsafe.Pointer(regs), 0)
 }
 
 func PtraceSingleStep(pid int) (err error) {
 	return ptrace(PT_STEP, pid, 1, 0)
 }
 
+func Dup3(oldfd, newfd, flags int) error {
+	if oldfd == newfd || flags&^O_CLOEXEC != 0 {
+		return EINVAL
+	}
+	how := F_DUP2FD
+	if flags&O_CLOEXEC != 0 {
+		how = F_DUP2FD_CLOEXEC
+	}
+	_, err := fcntl(oldfd, how, newfd)
+	return err
+}
+
 /*
  * Exposed directly
  */
@@ -402,7 +433,6 @@ func PtraceSingleStep(pid int) (err error) {
 //sysnb	Setreuid(ruid int, euid int) (err error)
 //sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
 //sysnb	Setresuid(ruid int, euid int, suid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
 //sysnb	Setuid(uid int) (err error)
@@ -419,197 +449,5 @@ func PtraceSingleStep(pid int) (err error) {
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error)
 //sys	munmap(addr uintptr, length uintptr) (err error)
-//sys	readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE
 //sys	accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error)
 //sys	utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error)
-
-/*
- * Unimplemented
- */
-// Profil
-// Sigaction
-// Sigprocmask
-// Getlogin
-// Sigpending
-// Sigaltstack
-// Ioctl
-// Reboot
-// Execve
-// Vfork
-// Sbrk
-// Sstk
-// Ovadvise
-// Mincore
-// Setitimer
-// Swapon
-// Select
-// Sigsuspend
-// Readv
-// Writev
-// Nfssvc
-// Getfh
-// Quotactl
-// Mount
-// Csops
-// Waitid
-// Add_profil
-// Kdebug_trace
-// Sigreturn
-// Atsocket
-// Kqueue_from_portset_np
-// Kqueue_portset
-// Getattrlist
-// Setattrlist
-// Getdents
-// Getdirentriesattr
-// Searchfs
-// Delete
-// Copyfile
-// Watchevent
-// Waitevent
-// Modwatch
-// Fsctl
-// Initgroups
-// Posix_spawn
-// Nfsclnt
-// Fhopen
-// Minherit
-// Semsys
-// Msgsys
-// Shmsys
-// Semctl
-// Semget
-// Semop
-// Msgctl
-// Msgget
-// Msgsnd
-// Msgrcv
-// Shmat
-// Shmctl
-// Shmdt
-// Shmget
-// Shm_open
-// Shm_unlink
-// Sem_open
-// Sem_close
-// Sem_unlink
-// Sem_wait
-// Sem_trywait
-// Sem_post
-// Sem_getvalue
-// Sem_init
-// Sem_destroy
-// Open_extended
-// Umask_extended
-// Stat_extended
-// Lstat_extended
-// Fstat_extended
-// Chmod_extended
-// Fchmod_extended
-// Access_extended
-// Settid
-// Gettid
-// Setsgroups
-// Getsgroups
-// Setwgroups
-// Getwgroups
-// Mkfifo_extended
-// Mkdir_extended
-// Identitysvc
-// Shared_region_check_np
-// Shared_region_map_np
-// __pthread_mutex_destroy
-// __pthread_mutex_init
-// __pthread_mutex_lock
-// __pthread_mutex_trylock
-// __pthread_mutex_unlock
-// __pthread_cond_init
-// __pthread_cond_destroy
-// __pthread_cond_broadcast
-// __pthread_cond_signal
-// Setsid_with_pid
-// __pthread_cond_timedwait
-// Aio_fsync
-// Aio_return
-// Aio_suspend
-// Aio_cancel
-// Aio_error
-// Aio_read
-// Aio_write
-// Lio_listio
-// __pthread_cond_wait
-// Iopolicysys
-// __pthread_kill
-// __pthread_sigmask
-// __sigwait
-// __disable_threadsignal
-// __pthread_markcancel
-// __pthread_canceled
-// __semwait_signal
-// Proc_info
-// Stat64_extended
-// Lstat64_extended
-// Fstat64_extended
-// __pthread_chdir
-// __pthread_fchdir
-// Audit
-// Auditon
-// Getauid
-// Setauid
-// Getaudit
-// Setaudit
-// Getaudit_addr
-// Setaudit_addr
-// Auditctl
-// Bsdthread_create
-// Bsdthread_terminate
-// Stack_snapshot
-// Bsdthread_register
-// Workq_open
-// Workq_ops
-// __mac_execve
-// __mac_syscall
-// __mac_get_file
-// __mac_set_file
-// __mac_get_link
-// __mac_set_link
-// __mac_get_proc
-// __mac_set_proc
-// __mac_get_fd
-// __mac_set_fd
-// __mac_get_pid
-// __mac_get_lcid
-// __mac_get_lctx
-// __mac_set_lctx
-// Setlcid
-// Read_nocancel
-// Write_nocancel
-// Open_nocancel
-// Close_nocancel
-// Wait4_nocancel
-// Recvmsg_nocancel
-// Sendmsg_nocancel
-// Recvfrom_nocancel
-// Accept_nocancel
-// Fcntl_nocancel
-// Select_nocancel
-// Fsync_nocancel
-// Connect_nocancel
-// Sigsuspend_nocancel
-// Readv_nocancel
-// Writev_nocancel
-// Sendto_nocancel
-// Pread_nocancel
-// Pwrite_nocancel
-// Waitid_nocancel
-// Poll_nocancel
-// Msgsnd_nocancel
-// Msgrcv_nocancel
-// Sem_wait_nocancel
-// Aio_suspend_nocancel
-// __sigwait_nocancel
-// __semwait_signal_nocancel
-// __mac_mount
-// __mac_get_mount
-// __mac_getfsstat
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go
index 6a91d471d09..3967bca772d 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 && freebsd
-// +build 386,freebsd
 
 package unix
 
@@ -42,6 +41,10 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
 
+func (d *PtraceIoDesc) SetLen(length int) {
+	d.Len = uint32(length)
+}
+
 func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
 	var writtenOut uint64 = 0
 	_, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr((*offset)>>32), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0)
@@ -57,16 +60,5 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceGetFsBase(pid int, fsbase *int64) (err error) {
-	return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
-}
-
-func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{
-		Op:   int32(req),
-		Offs: offs,
-		Addr: uintptr(unsafe.Pointer(&out[0])), // TODO(#58351): this is not safe.
-		Len:  uint32(countin),
-	}
-	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
-	return int(ioDesc.Len), err
+	return ptracePtr(PT_GETFSBASE, pid, unsafe.Pointer(fsbase), 0)
 }
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go
index 48110a0abb9..eff19ada235 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && freebsd
-// +build amd64,freebsd
 
 package unix
 
@@ -42,6 +41,10 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
 
+func (d *PtraceIoDesc) SetLen(length int) {
+	d.Len = uint64(length)
+}
+
 func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
 	var writtenOut uint64 = 0
 	_, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0)
@@ -57,16 +60,5 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceGetFsBase(pid int, fsbase *int64) (err error) {
-	return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
-}
-
-func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{
-		Op:   int32(req),
-		Offs: offs,
-		Addr: uintptr(unsafe.Pointer(&out[0])), // TODO(#58351): this is not safe.
-		Len:  uint64(countin),
-	}
-	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
-	return int(ioDesc.Len), err
+	return ptracePtr(PT_GETFSBASE, pid, unsafe.Pointer(fsbase), 0)
 }
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go
index 52f1d4b75a3..4f24b517a67 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm && freebsd
-// +build arm,freebsd
 
 package unix
 
@@ -42,6 +41,10 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
 
+func (d *PtraceIoDesc) SetLen(length int) {
+	d.Len = uint32(length)
+}
+
 func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
 	var writtenOut uint64 = 0
 	_, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr((*offset)>>32), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0)
@@ -55,14 +58,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
-
-func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{
-		Op:   int32(req),
-		Offs: offs,
-		Addr: uintptr(unsafe.Pointer(&out[0])), // TODO(#58351): this is not safe.
-		Len:  uint32(countin),
-	}
-	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
-	return int(ioDesc.Len), err
-}
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go
index 5537ee4f2ed..ac30759ece1 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm64 && freebsd
-// +build arm64,freebsd
 
 package unix
 
@@ -42,6 +41,10 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
 
+func (d *PtraceIoDesc) SetLen(length int) {
+	d.Len = uint64(length)
+}
+
 func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
 	var writtenOut uint64 = 0
 	_, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0)
@@ -55,14 +58,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
-
-func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{
-		Op:   int32(req),
-		Offs: offs,
-		Addr: uintptr(unsafe.Pointer(&out[0])), // TODO(#58351): this is not safe.
-		Len:  uint64(countin),
-	}
-	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
-	return int(ioDesc.Len), err
-}
diff --git a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go
index 164abd5d215..aab725ca77f 100644
--- a/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_freebsd_riscv64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build riscv64 && freebsd
-// +build riscv64,freebsd
 
 package unix
 
@@ -42,6 +41,10 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }
 
+func (d *PtraceIoDesc) SetLen(length int) {
+	d.Len = uint64(length)
+}
+
 func sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
 	var writtenOut uint64 = 0
 	_, _, e1 := Syscall9(SYS_SENDFILE, uintptr(infd), uintptr(outfd), uintptr(*offset), uintptr(count), 0, uintptr(unsafe.Pointer(&writtenOut)), 0, 0, 0)
@@ -55,14 +58,3 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
-
-func PtraceIO(req int, pid int, offs uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{
-		Op:   int32(req),
-		Offs: offs,
-		Addr: uintptr(unsafe.Pointer(&out[0])), // TODO(#58351): this is not safe.
-		Len:  uint64(countin),
-	}
-	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
-	return int(ioDesc.Len), err
-}
diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd.go b/vendor/golang.org/x/sys/unix/syscall_hurd.go
index 4ffb64808d7..ba46651f8e3 100644
--- a/vendor/golang.org/x/sys/unix/syscall_hurd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_hurd.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build hurd
-// +build hurd
 
 package unix
 
@@ -20,3 +19,11 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 	}
 	return
 }
+
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	r0, er := C.ioctl(C.int(fd), C.ulong(req), C.uintptr_t(uintptr(arg)))
+	if r0 == -1 && er != nil {
+		err = er
+	}
+	return
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go
index 7cf54a3e4f1..df89f9e6b47 100644
--- a/vendor/golang.org/x/sys/unix/syscall_hurd_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_hurd_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 && hurd
-// +build 386,hurd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_illumos.go b/vendor/golang.org/x/sys/unix/syscall_illumos.go
index 87db5a6a8cc..a863f7052c7 100644
--- a/vendor/golang.org/x/sys/unix/syscall_illumos.go
+++ b/vendor/golang.org/x/sys/unix/syscall_illumos.go
@@ -5,7 +5,6 @@
 // illumos system calls not present on Solaris.
 
 //go:build amd64 && illumos
-// +build amd64,illumos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go
index 5443dddd48d..0f85e29e621 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux.go
@@ -61,15 +61,23 @@ func FanotifyMark(fd int, flags uint, mask uint64, dirFd int, pathname string) (
 }
 
 //sys	fchmodat(dirfd int, path string, mode uint32) (err error)
-
-func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) {
-	// Linux fchmodat doesn't support the flags parameter. Mimick glibc's behavior
-	// and check the flags. Otherwise the mode would be applied to the symlink
-	// destination which is not what the user expects.
-	if flags&^AT_SYMLINK_NOFOLLOW != 0 {
-		return EINVAL
-	} else if flags&AT_SYMLINK_NOFOLLOW != 0 {
-		return EOPNOTSUPP
+//sys	fchmodat2(dirfd int, path string, mode uint32, flags int) (err error)
+
+func Fchmodat(dirfd int, path string, mode uint32, flags int) error {
+	// Linux fchmodat doesn't support the flags parameter, but fchmodat2 does.
+	// Try fchmodat2 if flags are specified.
+	if flags != 0 {
+		err := fchmodat2(dirfd, path, mode, flags)
+		if err == ENOSYS {
+			// fchmodat2 isn't available. If the flags are known to be valid,
+			// return EOPNOTSUPP to indicate that fchmodat doesn't support them.
+			if flags&^(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 {
+				return EINVAL
+			} else if flags&(AT_SYMLINK_NOFOLLOW|AT_EMPTY_PATH) != 0 {
+				return EOPNOTSUPP
+			}
+		}
+		return err
 	}
 	return fchmodat(dirfd, path, mode)
 }
@@ -417,7 +425,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) {
 	if n > 0 {
 		sl += _Socklen(n) + 1
 	}
-	if sa.raw.Path[0] == '@' {
+	if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) {
+		// Check sl > 3 so we don't change unnamed socket behavior.
 		sa.raw.Path[0] = 0
 		// Don't count trailing NUL for abstract address.
 		sl--
@@ -693,10 +702,10 @@ type SockaddrALG struct {
 
 func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) {
 	// Leave room for NUL byte terminator.
-	if len(sa.Type) > 13 {
+	if len(sa.Type) > len(sa.raw.Type)-1 {
 		return nil, 0, EINVAL
 	}
-	if len(sa.Name) > 63 {
+	if len(sa.Name) > len(sa.raw.Name)-1 {
 		return nil, 0, EINVAL
 	}
 
@@ -704,17 +713,8 @@ func (sa *SockaddrALG) sockaddr() (unsafe.Pointer, _Socklen, error) {
 	sa.raw.Feat = sa.Feature
 	sa.raw.Mask = sa.Mask
 
-	typ, err := ByteSliceFromString(sa.Type)
-	if err != nil {
-		return nil, 0, err
-	}
-	name, err := ByteSliceFromString(sa.Name)
-	if err != nil {
-		return nil, 0, err
-	}
-
-	copy(sa.raw.Type[:], typ)
-	copy(sa.raw.Name[:], name)
+	copy(sa.raw.Type[:], sa.Type)
+	copy(sa.raw.Name[:], sa.Name)
 
 	return unsafe.Pointer(&sa.raw), SizeofSockaddrALG, nil
 }
@@ -1015,8 +1015,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
 		for n < len(pp.Path) && pp.Path[n] != 0 {
 			n++
 		}
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -1311,7 +1310,7 @@ func GetsockoptString(fd, level, opt int) (string, error) {
 			return "", err
 		}
 	}
-	return string(buf[:vallen-1]), nil
+	return ByteSliceToString(buf[:vallen]), nil
 }
 
 func GetsockoptTpacketStats(fd, level, opt int) (*TpacketStats, error) {
@@ -1365,6 +1364,10 @@ func SetsockoptTCPRepairOpt(fd, level, opt int, o []TCPRepairOpt) (err error) {
 	return setsockopt(fd, level, opt, unsafe.Pointer(&o[0]), uintptr(SizeofTCPRepairOpt*len(o)))
 }
 
+func SetsockoptTCPMD5Sig(fd, level, opt int, s *TCPMD5Sig) error {
+	return setsockopt(fd, level, opt, unsafe.Pointer(s), unsafe.Sizeof(*s))
+}
+
 // Keyctl Commands (http://man7.org/linux/man-pages/man2/keyctl.2.html)
 
 // KeyctlInt calls keyctl commands in which each argument is an int.
@@ -1579,6 +1582,7 @@ func BindToDevice(fd int, device string) (err error) {
 }
 
 //sys	ptrace(request int, pid int, addr uintptr, data uintptr) (err error)
+//sys	ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) = SYS_PTRACE
 
 func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err error) {
 	// The peek requests are machine-size oriented, so we wrap it
@@ -1596,7 +1600,7 @@ func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err erro
 	// boundary.
 	n := 0
 	if addr%SizeofPtr != 0 {
-		err = ptrace(req, pid, addr-addr%SizeofPtr, uintptr(unsafe.Pointer(&buf[0])))
+		err = ptracePtr(req, pid, addr-addr%SizeofPtr, unsafe.Pointer(&buf[0]))
 		if err != nil {
 			return 0, err
 		}
@@ -1608,7 +1612,7 @@ func ptracePeek(req int, pid int, addr uintptr, out []byte) (count int, err erro
 	for len(out) > 0 {
 		// We use an internal buffer to guarantee alignment.
 		// It's not documented if this is necessary, but we're paranoid.
-		err = ptrace(req, pid, addr+uintptr(n), uintptr(unsafe.Pointer(&buf[0])))
+		err = ptracePtr(req, pid, addr+uintptr(n), unsafe.Pointer(&buf[0]))
 		if err != nil {
 			return n, err
 		}
@@ -1640,7 +1644,7 @@ func ptracePoke(pokeReq int, peekReq int, pid int, addr uintptr, data []byte) (c
 	n := 0
 	if addr%SizeofPtr != 0 {
 		var buf [SizeofPtr]byte
-		err = ptrace(peekReq, pid, addr-addr%SizeofPtr, uintptr(unsafe.Pointer(&buf[0])))
+		err = ptracePtr(peekReq, pid, addr-addr%SizeofPtr, unsafe.Pointer(&buf[0]))
 		if err != nil {
 			return 0, err
 		}
@@ -1667,7 +1671,7 @@ func ptracePoke(pokeReq int, peekReq int, pid int, addr uintptr, data []byte) (c
 	// Trailing edge.
 	if len(data) > 0 {
 		var buf [SizeofPtr]byte
-		err = ptrace(peekReq, pid, addr+uintptr(n), uintptr(unsafe.Pointer(&buf[0])))
+		err = ptracePtr(peekReq, pid, addr+uintptr(n), unsafe.Pointer(&buf[0]))
 		if err != nil {
 			return n, err
 		}
@@ -1695,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) {
 	return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data)
 }
 
+// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so
+// x/sys/unix doesn't need to depend on debug/elf and thus
+// compress/zlib, debug/dwarf, and other packages.
+const elfNT_PRSTATUS = 1
+
 func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	var iov Iovec
+	iov.Base = (*byte)(unsafe.Pointer(regsout))
+	iov.SetLen(int(unsafe.Sizeof(*regsout)))
+	return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov))
 }
 
 func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	var iov Iovec
+	iov.Base = (*byte)(unsafe.Pointer(regs))
+	iov.SetLen(int(unsafe.Sizeof(*regs)))
+	return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov))
 }
 
 func PtraceSetOptions(pid int, options int) (err error) {
@@ -1709,7 +1724,7 @@ func PtraceSetOptions(pid int, options int) (err error) {
 
 func PtraceGetEventMsg(pid int) (msg uint, err error) {
 	var data _C_long
-	err = ptrace(PTRACE_GETEVENTMSG, pid, 0, uintptr(unsafe.Pointer(&data)))
+	err = ptracePtr(PTRACE_GETEVENTMSG, pid, 0, unsafe.Pointer(&data))
 	msg = uint(data)
 	return
 }
@@ -1869,9 +1884,8 @@ func Getpgrp() (pid int) {
 //sys	OpenTree(dfd int, fileName string, flags uint) (r int, err error)
 //sys	PerfEventOpen(attr *PerfEventAttr, pid int, cpu int, groupFd int, flags int) (fd int, err error)
 //sys	PivotRoot(newroot string, putold string) (err error) = SYS_PIVOT_ROOT
-//sysnb	Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) = SYS_PRLIMIT64
 //sys	Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error)
-//sys	Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) = SYS_PSELECT6
+//sys	pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error)
 //sys	read(fd int, p []byte) (n int, err error)
 //sys	Removexattr(path string, attr string) (err error)
 //sys	Renameat2(olddirfd int, oldpath string, newdirfd int, newpath string, flags uint) (err error)
@@ -1883,6 +1897,15 @@ func Getpgrp() (pid int) {
 //sysnb	Settimeofday(tv *Timeval) (err error)
 //sys	Setns(fd int, nstype int) (err error)
 
+//go:linkname syscall_prlimit syscall.prlimit
+func syscall_prlimit(pid, resource int, newlimit, old *syscall.Rlimit) error
+
+func Prlimit(pid, resource int, newlimit, old *Rlimit) error {
+	// Just call the syscall version, because as of Go 1.21
+	// it will affect starting a new process.
+	return syscall_prlimit(pid, resource, (*syscall.Rlimit)(newlimit), (*syscall.Rlimit)(old))
+}
+
 // PrctlRetInt performs a prctl operation specified by option and further
 // optional arguments arg2 through arg5 depending on option. It returns a
 // non-negative integer that is returned by the prctl syscall.
@@ -1965,8 +1988,6 @@ func Signalfd(fd int, sigmask *Sigset_t, flags int) (newfd int, err error) {
 //sys	Unshare(flags int) (err error)
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	exitThread(code int) (err error) = SYS_EXIT
-//sys	readlen(fd int, p *byte, np int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, p *byte, np int) (n int, err error) = SYS_WRITE
 //sys	readv(fd int, iovs []Iovec) (n int, err error) = SYS_READV
 //sys	writev(fd int, iovs []Iovec) (n int, err error) = SYS_WRITEV
 //sys	preadv(fd int, iovs []Iovec, offs_l uintptr, offs_h uintptr) (n int, err error) = SYS_PREADV
@@ -2101,21 +2122,7 @@ func writevRacedetect(iovecs []Iovec, n int) {
 
 // mmap varies by architecture; see syscall_linux_*.go.
 //sys	munmap(addr uintptr, length uintptr) (err error)
-
-var mapper = &mmapper{
-	active: make(map[*byte][]byte),
-	mmap:   mmap,
-	munmap: munmap,
-}
-
-func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
-	return mapper.Mmap(fd, offset, length, prot, flags)
-}
-
-func Munmap(b []byte) (err error) {
-	return mapper.Munmap(b)
-}
-
+//sys	mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error)
 //sys	Madvise(b []byte, advice int) (err error)
 //sys	Mprotect(b []byte, prot int) (err error)
 //sys	Mlock(b []byte) (err error)
@@ -2124,6 +2131,12 @@ func Munmap(b []byte) (err error) {
 //sys	Munlock(b []byte) (err error)
 //sys	Munlockall() (err error)
 
+const (
+	mremapFixed     = MREMAP_FIXED
+	mremapDontunmap = MREMAP_DONTUNMAP
+	mremapMaymove   = MREMAP_MAYMOVE
+)
+
 // Vmsplice splices user pages from a slice of Iovecs into a pipe specified by fd,
 // using the specified flags.
 func Vmsplice(fd int, iovs []Iovec, flags int) (int, error) {
@@ -2154,6 +2167,14 @@ func isGroupMember(gid int) bool {
 	return false
 }
 
+func isCapDacOverrideSet() bool {
+	hdr := CapUserHeader{Version: LINUX_CAPABILITY_VERSION_3}
+	data := [2]CapUserData{}
+	err := Capget(&hdr, &data[0])
+
+	return err == nil && data[0].Effective&(1<<CAP_DAC_OVERRIDE) != 0
+}
+
 //sys	faccessat(dirfd int, path string, mode uint32) (err error)
 //sys	Faccessat2(dirfd int, path string, mode uint32, flags int) (err error)
 
@@ -2189,6 +2210,12 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 	var uid int
 	if flags&AT_EACCESS != 0 {
 		uid = Geteuid()
+		if uid != 0 && isCapDacOverrideSet() {
+			// If CAP_DAC_OVERRIDE is set, file access check is
+			// done by the kernel in the same way as for root
+			// (see generic_permission() in the Linux sources).
+			uid = 0
+		}
 	} else {
 		uid = Getuid()
 	}
@@ -2394,99 +2421,75 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error {
 	return rtSigprocmask(how, set, oldset, _C__NSIG/8)
 }
 
-/*
- * Unimplemented
- */
-// AfsSyscall
-// ArchPrctl
-// Brk
-// ClockNanosleep
-// ClockSettime
-// Clone
-// EpollCtlOld
-// EpollPwait
-// EpollWaitOld
-// Execve
-// Fork
-// Futex
-// GetKernelSyms
-// GetMempolicy
-// GetRobustList
-// GetThreadArea
-// Getpmsg
-// IoCancel
-// IoDestroy
-// IoGetevents
-// IoSetup
-// IoSubmit
-// IoprioGet
-// IoprioSet
-// KexecLoad
-// LookupDcookie
-// Mbind
-// MigratePages
-// Mincore
-// ModifyLdt
-// Mount
-// MovePages
-// MqGetsetattr
-// MqNotify
-// MqOpen
-// MqTimedreceive
-// MqTimedsend
-// MqUnlink
-// Mremap
-// Msgctl
-// Msgget
-// Msgrcv
-// Msgsnd
-// Nfsservctl
-// Personality
-// Pselect6
-// Ptrace
-// Putpmsg
-// Quotactl
-// Readahead
-// Readv
-// RemapFilePages
-// RestartSyscall
-// RtSigaction
-// RtSigpending
-// RtSigqueueinfo
-// RtSigreturn
-// RtSigsuspend
-// RtSigtimedwait
-// SchedGetPriorityMax
-// SchedGetPriorityMin
-// SchedGetparam
-// SchedGetscheduler
-// SchedRrGetInterval
-// SchedSetparam
-// SchedYield
-// Security
-// Semctl
-// Semget
-// Semop
-// Semtimedop
-// SetMempolicy
-// SetRobustList
-// SetThreadArea
-// SetTidAddress
-// Sigaltstack
-// Swapoff
-// Swapon
-// Sysfs
-// TimerCreate
-// TimerDelete
-// TimerGetoverrun
-// TimerGettime
-// TimerSettime
-// Tkill (obsolete)
-// Tuxcall
-// Umount2
-// Uselib
-// Utimensat
-// Vfork
-// Vhangup
-// Vserver
-// _Sysctl
+//sysnb	getresuid(ruid *_C_int, euid *_C_int, suid *_C_int)
+//sysnb	getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int)
+
+func Getresuid() (ruid, euid, suid int) {
+	var r, e, s _C_int
+	getresuid(&r, &e, &s)
+	return int(r), int(e), int(s)
+}
+
+func Getresgid() (rgid, egid, sgid int) {
+	var r, e, s _C_int
+	getresgid(&r, &e, &s)
+	return int(r), int(e), int(s)
+}
+
+// Pselect is a wrapper around the Linux pselect6 system call.
+// This version does not modify the timeout argument.
+func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
+	// Per https://man7.org/linux/man-pages/man2/select.2.html#NOTES,
+	// The Linux pselect6() system call modifies its timeout argument.
+	// [Not modifying the argument] is the behavior required by POSIX.1-2001.
+	var mutableTimeout *Timespec
+	if timeout != nil {
+		mutableTimeout = new(Timespec)
+		*mutableTimeout = *timeout
+	}
+
+	// The final argument of the pselect6() system call is not a
+	// sigset_t * pointer, but is instead a structure
+	var kernelMask *sigset_argpack
+	if sigmask != nil {
+		wordBits := 32 << (^uintptr(0) >> 63) // see math.intSize
+
+		// A sigset stores one bit per signal,
+		// offset by 1 (because signal 0 does not exist).
+		// So the number of words needed is ⌈__C_NSIG - 1 / wordBits⌉.
+		sigsetWords := (_C__NSIG - 1 + wordBits - 1) / (wordBits)
+
+		sigsetBytes := uintptr(sigsetWords * (wordBits / 8))
+		kernelMask = &sigset_argpack{
+			ss:    sigmask,
+			ssLen: sigsetBytes,
+		}
+	}
+
+	return pselect6(nfd, r, w, e, mutableTimeout, kernelMask)
+}
+
+//sys	schedSetattr(pid int, attr *SchedAttr, flags uint) (err error)
+//sys	schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error)
+
+// SchedSetAttr is a wrapper for sched_setattr(2) syscall.
+// https://man7.org/linux/man-pages/man2/sched_setattr.2.html
+func SchedSetAttr(pid int, attr *SchedAttr, flags uint) error {
+	if attr == nil {
+		return EINVAL
+	}
+	attr.Size = SizeofSchedAttr
+	return schedSetattr(pid, attr, flags)
+}
+
+// SchedGetAttr is a wrapper for sched_getattr(2) syscall.
+// https://man7.org/linux/man-pages/man2/sched_getattr.2.html
+func SchedGetAttr(pid int, flags uint) (*SchedAttr, error) {
+	attr := &SchedAttr{}
+	if err := schedGetattr(pid, attr, SizeofSchedAttr, flags); err != nil {
+		return nil, err
+	}
+	return attr, nil
+}
+
+//sys	Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_386.go
index ff5b5899d6d..506dafa7b4c 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 && linux
-// +build 386,linux
 
 package unix
 
@@ -97,33 +96,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	return
 }
 
-//sysnb	setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT
-
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	err = Prlimit(0, resource, rlim, nil)
-	if err != ENOSYS {
-		return err
-	}
-
-	rl := rlimit32{}
-	if rlim.Cur == rlimInf64 {
-		rl.Cur = rlimInf32
-	} else if rlim.Cur < uint64(rlimInf32) {
-		rl.Cur = uint32(rlim.Cur)
-	} else {
-		return EINVAL
-	}
-	if rlim.Max == rlimInf64 {
-		rl.Max = rlimInf32
-	} else if rlim.Max < uint64(rlimInf32) {
-		rl.Max = uint32(rlim.Max)
-	} else {
-		return EINVAL
-	}
-
-	return setrlimit(resource, &rl)
-}
-
 func Seek(fd int, offset int64, whence int) (newoffset int64, err error) {
 	newoffset, errno := seek(fd, offset, whence)
 	if errno != 0 {
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go
index 08086ac6a4c..38d55641b52 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_alarm.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (386 || amd64 || mips || mipsle || mips64 || mipsle || ppc64 || ppc64le || ppc || s390x || sparc64)
-// +build linux
-// +build 386 amd64 mips mipsle mips64 mipsle ppc64 ppc64le ppc s390x sparc64
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go
index 9b270353298..d557cf8de3f 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && linux
-// +build amd64,linux
 
 package unix
 
@@ -40,13 +39,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	if timeout != nil {
 		ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000}
 	}
-	return Pselect(nfd, r, w, e, ts, nil)
+	return pselect6(nfd, r, w, e, ts, nil)
 }
 
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go
index 8b0f0f3aa56..facdb83b23b 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_amd64_gc.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && linux && gc
-// +build amd64,linux,gc
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
index 856ad1d635c..cd2dd797fd6 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm && linux
-// +build arm,linux
 
 package unix
 
@@ -171,33 +170,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	return
 }
 
-//sysnb	setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT
-
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	err = Prlimit(0, resource, rlim, nil)
-	if err != ENOSYS {
-		return err
-	}
-
-	rl := rlimit32{}
-	if rlim.Cur == rlimInf64 {
-		rl.Cur = rlimInf32
-	} else if rlim.Cur < uint64(rlimInf32) {
-		rl.Cur = uint32(rlim.Cur)
-	} else {
-		return EINVAL
-	}
-	if rlim.Max == rlimInf64 {
-		rl.Max = rlimInf32
-	} else if rlim.Max < uint64(rlimInf32) {
-		rl.Max = uint32(rlim.Max)
-	} else {
-		return EINVAL
-	}
-
-	return setrlimit(resource, &rl)
-}
-
 func (r *PtraceRegs) PC() uint64 { return uint64(r.Uregs[15]) }
 
 func (r *PtraceRegs) SetPC(pc uint64) { r.Uregs[15] = uint32(pc) }
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go
index 6422704bc52..cf2ee6c75ef 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm64 && linux
-// +build arm64,linux
 
 package unix
 
@@ -33,13 +32,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	if timeout != nil {
 		ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000}
 	}
-	return Pselect(nfd, r, w, e, ts, nil)
+	return pselect6(nfd, r, w, e, ts, nil)
 }
 
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 
@@ -143,15 +141,6 @@ func Getrlimit(resource int, rlim *Rlimit) error {
 	return getrlimit(resource, rlim)
 }
 
-// Setrlimit prefers the prlimit64 system call. See issue 38604.
-func Setrlimit(resource int, rlim *Rlimit) error {
-	err := Prlimit(0, resource, rlim, nil)
-	if err != ENOSYS {
-		return err
-	}
-	return setrlimit(resource, rlim)
-}
-
 func (r *PtraceRegs) PC() uint64 { return r.Pc }
 
 func (r *PtraceRegs) SetPC(pc uint64) { r.Pc = pc }
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go
index 2b1168d7d19..ffc4c2b635d 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_gc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && gc
-// +build linux,gc
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go
index 9843fb48960..9ebfdcf4478 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && gc && 386
-// +build linux,gc,386
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go
index a6008fccd59..5f2b57c4c27 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_gc_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm && gc && linux
-// +build arm,gc,linux
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go
index 7740af2428b..d1a3ad82633 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && gccgo && 386
-// +build linux,gccgo,386
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go
index e16a12299ae..f2f67423e98 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_gccgo_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && gccgo && arm
-// +build linux,gccgo,arm
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go
index 59dab510e97..3d0e98451f8 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_loong64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build loong64 && linux
-// +build loong64,linux
 
 package unix
 
@@ -28,7 +27,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	if timeout != nil {
 		ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000}
 	}
-	return Pselect(nfd, r, w, e, ts, nil)
+	return pselect6(nfd, r, w, e, ts, nil)
 }
 
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
@@ -126,11 +125,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	return
 }
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	err = Prlimit(0, resource, rlim, nil)
-	return
-}
-
 func futimesat(dirfd int, path string, tv *[2]Timeval) (err error) {
 	if tv == nil {
 		return utimensat(dirfd, path, nil, 0)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go
index bfef09a39eb..70963a95abf 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (mips64 || mips64le)
-// +build linux
-// +build mips64 mips64le
 
 package unix
 
@@ -31,13 +29,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	if timeout != nil {
 		ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000}
 	}
-	return Pselect(nfd, r, w, e, ts, nil)
+	return pselect6(nfd, r, w, e, ts, nil)
 }
 
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Statfs(path string, buf *Statfs_t) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go
index ab302509663..c218ebd2801 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (mips || mipsle)
-// +build linux
-// +build mips mipsle
 
 package unix
 
@@ -151,33 +149,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	return
 }
 
-//sysnb	setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT
-
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	err = Prlimit(0, resource, rlim, nil)
-	if err != ENOSYS {
-		return err
-	}
-
-	rl := rlimit32{}
-	if rlim.Cur == rlimInf64 {
-		rl.Cur = rlimInf32
-	} else if rlim.Cur < uint64(rlimInf32) {
-		rl.Cur = uint32(rlim.Cur)
-	} else {
-		return EINVAL
-	}
-	if rlim.Max == rlimInf64 {
-		rl.Max = rlimInf32
-	} else if rlim.Max < uint64(rlimInf32) {
-		rl.Max = uint32(rlim.Max)
-	} else {
-		return EINVAL
-	}
-
-	return setrlimit(resource, &rl)
-}
-
 func (r *PtraceRegs) PC() uint64 { return r.Epc }
 
 func (r *PtraceRegs) SetPC(pc uint64) { r.Epc = pc }
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go
index eac1cf1acc8..e6c48500ca9 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && ppc
-// +build linux,ppc
 
 package unix
 
@@ -159,33 +158,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 	return
 }
 
-//sysnb	setrlimit(resource int, rlim *rlimit32) (err error) = SYS_SETRLIMIT
-
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	err = Prlimit(0, resource, rlim, nil)
-	if err != ENOSYS {
-		return err
-	}
-
-	rl := rlimit32{}
-	if rlim.Cur == rlimInf64 {
-		rl.Cur = rlimInf32
-	} else if rlim.Cur < uint64(rlimInf32) {
-		rl.Cur = uint32(rlim.Cur)
-	} else {
-		return EINVAL
-	}
-	if rlim.Max == rlimInf64 {
-		rl.Max = rlimInf32
-	} else if rlim.Max < uint64(rlimInf32) {
-		rl.Max = uint32(rlim.Max)
-	} else {
-		return EINVAL
-	}
-
-	return setrlimit(resource, &rl)
-}
-
 func (r *PtraceRegs) PC() uint32 { return r.Nip }
 
 func (r *PtraceRegs) SetPC(pc uint32) { r.Nip = pc }
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go
index 4df56616b8f..7286a9aa882 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (ppc64 || ppc64le)
-// +build linux
-// +build ppc64 ppc64le
 
 package unix
 
@@ -34,7 +32,6 @@ package unix
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go
index 5f4243dea2c..6f5a288944d 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build riscv64 && linux
-// +build riscv64,linux
 
 package unix
 
@@ -32,13 +31,12 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	if timeout != nil {
 		ts = &Timespec{Sec: timeout.Sec, Nsec: timeout.Usec * 1000}
 	}
-	return Pselect(nfd, r, w, e, ts, nil)
+	return pselect6(nfd, r, w, e, ts, nil)
 }
 
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 
@@ -178,3 +176,14 @@ func KexecFileLoad(kernelFd int, initrdFd int, cmdline string, flags int) error
 	}
 	return kexecFileLoad(kernelFd, initrdFd, cmdlineLen, cmdline, flags)
 }
+
+//sys	riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error)
+
+func RISCVHWProbe(pairs []RISCVHWProbePairs, set *CPUSet, flags uint) (err error) {
+	var setSize uintptr
+
+	if set != nil {
+		setSize = uintptr(unsafe.Sizeof(*set))
+	}
+	return riscvHWProbe(pairs, setSize, set, flags)
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go
index d0a7d406685..66f31210d08 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build s390x && linux
-// +build s390x,linux
 
 package unix
 
@@ -34,7 +33,6 @@ import (
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)
 //sys	Statfs(path string, buf *Statfs_t) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go
index f5c793be26d..11d1f169866 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build sparc64 && linux
-// +build sparc64,linux
 
 package unix
 
@@ -31,7 +30,6 @@ package unix
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd.go b/vendor/golang.org/x/sys/unix/syscall_netbsd.go
index 35a3ad758f5..88162099af5 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd.go
@@ -13,7 +13,6 @@
 package unix
 
 import (
-	"runtime"
 	"syscall"
 	"unsafe"
 )
@@ -178,13 +177,13 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 //sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 //sys	sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL
 
 func IoctlGetPtmget(fd int, req uint) (*Ptmget, error) {
 	var value Ptmget
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
-	runtime.KeepAlive(value)
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return &value, err
 }
 
@@ -341,7 +340,6 @@ func Statvfs(path string, buf *Statvfs_t) (err error) {
 //sys	Setpriority(which int, who int, prio int) (err error)
 //sysnb	Setregid(rgid int, egid int) (err error)
 //sysnb	Setreuid(ruid int, euid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
 //sysnb	Setuid(uid int) (err error)
@@ -358,267 +356,16 @@ func Statvfs(path string, buf *Statvfs_t) (err error) {
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error)
 //sys	munmap(addr uintptr, length uintptr) (err error)
-//sys	readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE
 //sys	utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error)
 
-/*
- * Unimplemented
- */
-// ____semctl13
-// __clone
-// __fhopen40
-// __fhstat40
-// __fhstatvfs140
-// __fstat30
-// __getcwd
-// __getfh30
-// __getlogin
-// __lstat30
-// __mount50
-// __msgctl13
-// __msync13
-// __ntp_gettime30
-// __posix_chown
-// __posix_fchown
-// __posix_lchown
-// __posix_rename
-// __setlogin
-// __shmctl13
-// __sigaction_sigtramp
-// __sigaltstack14
-// __sigpending14
-// __sigprocmask14
-// __sigsuspend14
-// __sigtimedwait
-// __stat30
-// __syscall
-// __vfork14
-// _ksem_close
-// _ksem_destroy
-// _ksem_getvalue
-// _ksem_init
-// _ksem_open
-// _ksem_post
-// _ksem_trywait
-// _ksem_unlink
-// _ksem_wait
-// _lwp_continue
-// _lwp_create
-// _lwp_ctl
-// _lwp_detach
-// _lwp_exit
-// _lwp_getname
-// _lwp_getprivate
-// _lwp_kill
-// _lwp_park
-// _lwp_self
-// _lwp_setname
-// _lwp_setprivate
-// _lwp_suspend
-// _lwp_unpark
-// _lwp_unpark_all
-// _lwp_wait
-// _lwp_wakeup
-// _pset_bind
-// _sched_getaffinity
-// _sched_getparam
-// _sched_setaffinity
-// _sched_setparam
-// acct
-// aio_cancel
-// aio_error
-// aio_fsync
-// aio_read
-// aio_return
-// aio_suspend
-// aio_write
-// break
-// clock_getres
-// clock_gettime
-// clock_settime
-// compat_09_ogetdomainname
-// compat_09_osetdomainname
-// compat_09_ouname
-// compat_10_omsgsys
-// compat_10_osemsys
-// compat_10_oshmsys
-// compat_12_fstat12
-// compat_12_getdirentries
-// compat_12_lstat12
-// compat_12_msync
-// compat_12_oreboot
-// compat_12_oswapon
-// compat_12_stat12
-// compat_13_sigaction13
-// compat_13_sigaltstack13
-// compat_13_sigpending13
-// compat_13_sigprocmask13
-// compat_13_sigreturn13
-// compat_13_sigsuspend13
-// compat_14___semctl
-// compat_14_msgctl
-// compat_14_shmctl
-// compat_16___sigaction14
-// compat_16___sigreturn14
-// compat_20_fhstatfs
-// compat_20_fstatfs
-// compat_20_getfsstat
-// compat_20_statfs
-// compat_30___fhstat30
-// compat_30___fstat13
-// compat_30___lstat13
-// compat_30___stat13
-// compat_30_fhopen
-// compat_30_fhstat
-// compat_30_fhstatvfs1
-// compat_30_getdents
-// compat_30_getfh
-// compat_30_ntp_gettime
-// compat_30_socket
-// compat_40_mount
-// compat_43_fstat43
-// compat_43_lstat43
-// compat_43_oaccept
-// compat_43_ocreat
-// compat_43_oftruncate
-// compat_43_ogetdirentries
-// compat_43_ogetdtablesize
-// compat_43_ogethostid
-// compat_43_ogethostname
-// compat_43_ogetkerninfo
-// compat_43_ogetpagesize
-// compat_43_ogetpeername
-// compat_43_ogetrlimit
-// compat_43_ogetsockname
-// compat_43_okillpg
-// compat_43_olseek
-// compat_43_ommap
-// compat_43_oquota
-// compat_43_orecv
-// compat_43_orecvfrom
-// compat_43_orecvmsg
-// compat_43_osend
-// compat_43_osendmsg
-// compat_43_osethostid
-// compat_43_osethostname
-// compat_43_osetrlimit
-// compat_43_osigblock
-// compat_43_osigsetmask
-// compat_43_osigstack
-// compat_43_osigvec
-// compat_43_otruncate
-// compat_43_owait
-// compat_43_stat43
-// execve
-// extattr_delete_fd
-// extattr_delete_file
-// extattr_delete_link
-// extattr_get_fd
-// extattr_get_file
-// extattr_get_link
-// extattr_list_fd
-// extattr_list_file
-// extattr_list_link
-// extattr_set_fd
-// extattr_set_file
-// extattr_set_link
-// extattrctl
-// fchroot
-// fdatasync
-// fgetxattr
-// fktrace
-// flistxattr
-// fork
-// fremovexattr
-// fsetxattr
-// fstatvfs1
-// fsync_range
-// getcontext
-// getitimer
-// getvfsstat
-// getxattr
-// ktrace
-// lchflags
-// lchmod
-// lfs_bmapv
-// lfs_markv
-// lfs_segclean
-// lfs_segwait
-// lgetxattr
-// lio_listio
-// listxattr
-// llistxattr
-// lremovexattr
-// lseek
-// lsetxattr
-// lutimes
-// madvise
-// mincore
-// minherit
-// modctl
-// mq_close
-// mq_getattr
-// mq_notify
-// mq_open
-// mq_receive
-// mq_send
-// mq_setattr
-// mq_timedreceive
-// mq_timedsend
-// mq_unlink
-// mremap
-// msgget
-// msgrcv
-// msgsnd
-// nfssvc
-// ntp_adjtime
-// pmc_control
-// pmc_get_info
-// pollts
-// preadv
-// profil
-// pselect
-// pset_assign
-// pset_create
-// pset_destroy
-// ptrace
-// pwritev
-// quotactl
-// rasctl
-// readv
-// reboot
-// removexattr
-// sa_enable
-// sa_preempt
-// sa_register
-// sa_setconcurrency
-// sa_stacks
-// sa_yield
-// sbrk
-// sched_yield
-// semconfig
-// semget
-// semop
-// setcontext
-// setitimer
-// setxattr
-// shmat
-// shmdt
-// shmget
-// sstk
-// statvfs1
-// swapctl
-// sysarch
-// syscall
-// timer_create
-// timer_delete
-// timer_getoverrun
-// timer_gettime
-// timer_settime
-// undelete
-// utrace
-// uuidgen
-// vadvise
-// vfork
-// writev
+const (
+	mremapFixed     = MAP_FIXED
+	mremapDontunmap = 0
+	mremapMaymove   = 0
+)
+
+//sys	mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) = SYS_MREMAP
+
+func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (uintptr, error) {
+	return mremapNetBSD(oldaddr, oldlength, newaddr, newlength, flags)
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go
index 5199d282fd0..7a5eb57432f 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 && netbsd
-// +build 386,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go
index 70a9c52e980..62d8957ae6e 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && netbsd
-// +build amd64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go
index 3eb5942f93f..ce6a0688512 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm && netbsd
-// +build arm,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go
index fc6ccfd810d..d46d689d1b6 100644
--- a/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_netbsd_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm64 && netbsd
-// +build arm64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
index 9b67b908e5f..b25343c71a4 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
@@ -137,24 +137,49 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 }
 
 func Getfsstat(buf []Statfs_t, flags int) (n int, err error) {
-	var _p0 unsafe.Pointer
+	var bufptr *Statfs_t
 	var bufsize uintptr
 	if len(buf) > 0 {
-		_p0 = unsafe.Pointer(&buf[0])
+		bufptr = &buf[0]
 		bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf))
 	}
-	r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags))
-	n = int(r0)
-	if e1 != 0 {
-		err = e1
-	}
-	return
+	return getfsstat(bufptr, bufsize, flags)
+}
+
+//sysnb	getresuid(ruid *_C_int, euid *_C_int, suid *_C_int)
+//sysnb	getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int)
+
+func Getresuid() (ruid, euid, suid int) {
+	var r, e, s _C_int
+	getresuid(&r, &e, &s)
+	return int(r), int(e), int(s)
+}
+
+func Getresgid() (rgid, egid, sgid int) {
+	var r, e, s _C_int
+	getresgid(&r, &e, &s)
+	return int(r), int(e), int(s)
 }
 
 //sys	ioctl(fd int, req uint, arg uintptr) (err error)
+//sys	ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 //sys	sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) = SYS___SYSCTL
 
+//sys	fcntl(fd int, cmd int, arg int) (n int, err error)
+//sys	fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) = SYS_FCNTL
+
+// FcntlInt performs a fcntl syscall on fd with the provided command and argument.
+func FcntlInt(fd uintptr, cmd, arg int) (int, error) {
+	return fcntl(int(fd), cmd, arg)
+}
+
+// FcntlFlock performs a fcntl syscall for the F_GETLK, F_SETLK or F_SETLKW command.
+func FcntlFlock(fd uintptr, cmd int, lk *Flock_t) error {
+	_, err := fcntlPtr(int(fd), cmd, unsafe.Pointer(lk))
+	return err
+}
+
 //sys	ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error)
 
 func Ppoll(fds []PollFd, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
@@ -293,7 +318,6 @@ func Uname(uname *Utsname) error {
 //sysnb	Setreuid(ruid int, euid int) (err error)
 //sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
 //sysnb	Setresuid(ruid int, euid int, suid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setrtable(rtable int) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
@@ -311,80 +335,7 @@ func Uname(uname *Utsname) error {
 //sys	write(fd int, p []byte) (n int, err error)
 //sys	mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error)
 //sys	munmap(addr uintptr, length uintptr) (err error)
-//sys	readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
-//sys	writelen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_WRITE
+//sys	getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error)
 //sys	utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error)
-
-/*
- * Unimplemented
- */
-// __getcwd
-// __semctl
-// __syscall
-// __sysctl
-// adjfreq
-// break
-// clock_getres
-// clock_gettime
-// clock_settime
-// closefrom
-// execve
-// fhopen
-// fhstat
-// fhstatfs
-// fork
-// futimens
-// getfh
-// getgid
-// getitimer
-// getlogin
-// getresgid
-// getresuid
-// getthrid
-// ktrace
-// lfs_bmapv
-// lfs_markv
-// lfs_segclean
-// lfs_segwait
-// mincore
-// minherit
-// mount
-// mquery
-// msgctl
-// msgget
-// msgrcv
-// msgsnd
-// nfssvc
-// nnpfspioctl
-// preadv
-// profil
-// pwritev
-// quotactl
-// readv
-// reboot
-// renameat
-// rfork
-// sched_yield
-// semget
-// semop
-// setgroups
-// setitimer
-// setsockopt
-// shmat
-// shmctl
-// shmdt
-// shmget
-// sigaction
-// sigaltstack
-// sigpending
-// sigprocmask
-// sigreturn
-// sigsuspend
-// sysarch
-// syscall
-// threxit
-// thrsigdivert
-// thrsleep
-// thrwakeup
-// vfork
-// writev
+//sys	pledge(promises *byte, execpromises *byte) (err error)
+//sys	unveil(path *byte, flags *byte) (err error)
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go
index 6baabcdcb06..9ddc89f4fcd 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_386.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build 386 && openbsd
-// +build 386,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go
index bab25360eae..70a3c96eea1 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && openbsd
-// +build amd64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go
index 8eed3c4d4e7..265caa87f76 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm && openbsd
-// +build arm,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go
index 483dde99d4c..ac4fda1715a 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_arm64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build arm64 && openbsd
-// +build arm64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go
index 04aa43f41b2..0a451e6dd40 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_libc.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build openbsd
-// +build openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go
index c2796139c01..30a308cbb4b 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_ppc64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build ppc64 && openbsd
-// +build ppc64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go
index 23199a7ff62..ea954330fac 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd_riscv64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build riscv64 && openbsd
-// +build riscv64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris.go b/vendor/golang.org/x/sys/unix/syscall_solaris.go
index 07ac56109a0..21974af064d 100644
--- a/vendor/golang.org/x/sys/unix/syscall_solaris.go
+++ b/vendor/golang.org/x/sys/unix/syscall_solaris.go
@@ -128,7 +128,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) {
 	if n > 0 {
 		sl += _Socklen(n) + 1
 	}
-	if sa.raw.Path[0] == '@' {
+	if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) {
+		// Check sl > 3 so we don't change unnamed socket behavior.
 		sa.raw.Path[0] = 0
 		// Don't count trailing NUL for abstract address.
 		sl--
@@ -157,7 +158,7 @@ func GetsockoptString(fd, level, opt int) (string, error) {
 	if err != nil {
 		return "", err
 	}
-	return string(buf[:vallen-1]), nil
+	return ByteSliceToString(buf[:vallen]), nil
 }
 
 const ImplementsGetwd = true
@@ -408,8 +409,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
 		for n < len(pp.Path) && pp.Path[n] != 0 {
 			n++
 		}
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -546,22 +546,26 @@ func Minor(dev uint64) uint32 {
  * Expose the ioctl function
  */
 
-//sys	ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) = libc.ioctl
+//sys	ioctlRet(fd int, req int, arg uintptr) (ret int, err error) = libc.ioctl
+//sys	ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) = libc.ioctl
 
-func ioctl(fd int, req uint, arg uintptr) (err error) {
+func ioctl(fd int, req int, arg uintptr) (err error) {
 	_, err = ioctlRet(fd, req, arg)
 	return err
 }
 
-func IoctlSetTermio(fd int, req uint, value *Termio) error {
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(value)))
-	runtime.KeepAlive(value)
+func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) {
+	_, err = ioctlPtrRet(fd, req, arg)
 	return err
 }
 
-func IoctlGetTermio(fd int, req uint) (*Termio, error) {
+func IoctlSetTermio(fd int, req int, value *Termio) error {
+	return ioctlPtr(fd, req, unsafe.Pointer(value))
+}
+
+func IoctlGetTermio(fd int, req int) (*Termio, error) {
 	var value Termio
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&value)))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&value))
 	return &value, err
 }
 
@@ -662,7 +666,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	Setpriority(which int, who int, prio int) (err error)
 //sysnb	Setregid(rgid int, egid int) (err error)
 //sysnb	Setreuid(ruid int, euid int) (err error)
-//sysnb	Setrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Setuid(uid int) (err error)
 //sys	Shutdown(s int, how int) (err error) = libsocket.shutdown
@@ -696,38 +699,6 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) = libsocket.setsockopt
 //sys	recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Socklen) (n int, err error) = libsocket.recvfrom
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0)
-	n = int(r0)
-	if e1 != 0 {
-		err = e1
-	}
-	return
-}
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf), 0, 0, 0)
-	n = int(r0)
-	if e1 != 0 {
-		err = e1
-	}
-	return
-}
-
-var mapper = &mmapper{
-	active: make(map[*byte][]byte),
-	mmap:   mmap,
-	munmap: munmap,
-}
-
-func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
-	return mapper.Mmap(fd, offset, length, prot, flags)
-}
-
-func Munmap(b []byte) (err error) {
-	return mapper.Munmap(b)
-}
-
 // Event Ports
 
 type fileObjCookie struct {
@@ -1077,14 +1048,14 @@ func Getmsg(fd int, cl []byte, data []byte) (retCl []byte, retData []byte, flags
 	return retCl, retData, flags, nil
 }
 
-func IoctlSetIntRetInt(fd int, req uint, arg int) (int, error) {
+func IoctlSetIntRetInt(fd int, req int, arg int) (int, error) {
 	return ioctlRet(fd, req, uintptr(arg))
 }
 
-func IoctlSetString(fd int, req uint, val string) error {
+func IoctlSetString(fd int, req int, val string) error {
 	bs := make([]byte, len(val)+1)
 	copy(bs[:len(bs)-1], val)
-	err := ioctl(fd, req, uintptr(unsafe.Pointer(&bs[0])))
+	err := ioctlPtr(fd, req, unsafe.Pointer(&bs[0]))
 	runtime.KeepAlive(&bs[0])
 	return err
 }
@@ -1117,8 +1088,8 @@ func (l *Lifreq) GetLifruUint() uint {
 	return *(*uint)(unsafe.Pointer(&l.Lifru[0]))
 }
 
-func IoctlLifreq(fd int, req uint, l *Lifreq) error {
-	return ioctl(fd, req, uintptr(unsafe.Pointer(l)))
+func IoctlLifreq(fd int, req int, l *Lifreq) error {
+	return ioctlPtr(fd, req, unsafe.Pointer(l))
 }
 
 // Strioctl Helpers
@@ -1128,6 +1099,6 @@ func (s *Strioctl) SetInt(i int) {
 	s.Dp = (*int8)(unsafe.Pointer(&i))
 }
 
-func IoctlSetStrioctlRetInt(fd int, req uint, s *Strioctl) (int, error) {
-	return ioctlRet(fd, req, uintptr(unsafe.Pointer(s)))
+func IoctlSetStrioctlRetInt(fd int, req int, s *Strioctl) (int, error) {
+	return ioctlPtrRet(fd, req, unsafe.Pointer(s))
 }
diff --git a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go
index 0bd25ef81f2..e02d8ceae37 100644
--- a/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go
+++ b/vendor/golang.org/x/sys/unix/syscall_solaris_amd64.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build amd64 && solaris
-// +build amd64,solaris
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_unix.go b/vendor/golang.org/x/sys/unix/syscall_unix.go
index 00f0aa37588..77081de8c7d 100644
--- a/vendor/golang.org/x/sys/unix/syscall_unix.go
+++ b/vendor/golang.org/x/sys/unix/syscall_unix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
 
 package unix
 
@@ -147,6 +146,14 @@ func (m *mmapper) Munmap(data []byte) (err error) {
 	return nil
 }
 
+func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
+	return mapper.Mmap(fd, offset, length, prot, flags)
+}
+
+func Munmap(b []byte) (err error) {
+	return mapper.Munmap(b)
+}
+
 func Read(fd int, p []byte) (n int, err error) {
 	n, err = read(fd, p)
 	if raceenabled {
@@ -541,6 +548,9 @@ func SetNonblock(fd int, nonblocking bool) (err error) {
 	if err != nil {
 		return err
 	}
+	if (flag&O_NONBLOCK != 0) == nonblocking {
+		return nil
+	}
 	if nonblocking {
 		flag |= O_NONBLOCK
 	} else {
@@ -587,3 +597,10 @@ func emptyIovecs(iov []Iovec) bool {
 	}
 	return true
 }
+
+// Setrlimit sets a resource limit.
+func Setrlimit(resource int, rlim *Rlimit) error {
+	// Just call the syscall version, because as of Go 1.21
+	// it will affect starting a new process.
+	return syscall.Setrlimit(resource, (*syscall.Rlimit)(rlim))
+}
diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go
index b6919ca580e..05c95bccfab 100644
--- a/vendor/golang.org/x/sys/unix/syscall_unix_gc.go
+++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc.go
@@ -3,8 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin || dragonfly || freebsd || (linux && !ppc64 && !ppc64le) || netbsd || openbsd || solaris) && gc
-// +build darwin dragonfly freebsd linux,!ppc64,!ppc64le netbsd openbsd solaris
-// +build gc
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go
index f6f707acf2c..23f39b7af7e 100644
--- a/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go
+++ b/vendor/golang.org/x/sys/unix/syscall_unix_gc_ppc64x.go
@@ -3,9 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux && (ppc64le || ppc64) && gc
-// +build linux
-// +build ppc64le ppc64
-// +build gc
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go
index 68b2f3e1cd0..b473038c615 100644
--- a/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go
+++ b/vendor/golang.org/x/sys/unix/syscall_zos_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
@@ -139,8 +138,7 @@ func anyToSockaddr(_ int, rsa *RawSockaddrAny) (Sockaddr, error) {
 		for n < int(pp.Len) && pp.Path[n] != 0 {
 			n++
 		}
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -193,7 +191,6 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 
 //sys   fcntl(fd int, cmd int, arg int) (val int, err error)
 //sys	read(fd int, p []byte) (n int, err error)
-//sys   readlen(fd int, buf *byte, nbuf int) (n int, err error) = SYS_READ
 //sys	write(fd int, p []byte) (n int, err error)
 
 //sys	accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) = SYS___ACCEPT_A
@@ -213,7 +210,8 @@ func (cmsg *Cmsghdr) SetLen(length int) {
 //sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = SYS___SENDMSG_A
 //sys   mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) = SYS_MMAP
 //sys   munmap(addr uintptr, length uintptr) (err error) = SYS_MUNMAP
-//sys   ioctl(fd int, req uint, arg uintptr) (err error) = SYS_IOCTL
+//sys   ioctl(fd int, req int, arg uintptr) (err error) = SYS_IOCTL
+//sys   ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) = SYS_IOCTL
 
 //sys   Access(path string, mode uint32) (err error) = SYS___ACCESS_A
 //sys   Chdir(path string) (err error) = SYS___CHDIR_A
@@ -285,25 +283,11 @@ func Close(fd int) (err error) {
 	return
 }
 
-var mapper = &mmapper{
-	active: make(map[*byte][]byte),
-	mmap:   mmap,
-	munmap: munmap,
-}
-
 // Dummy function: there are no semantics for Madvise on z/OS
 func Madvise(b []byte, advice int) (err error) {
 	return
 }
 
-func Mmap(fd int, offset int64, length int, prot int, flags int) (data []byte, err error) {
-	return mapper.Mmap(fd, offset, length, prot, flags)
-}
-
-func Munmap(b []byte) (err error) {
-	return mapper.Munmap(b)
-}
-
 //sys   Gethostname(buf []byte) (err error) = SYS___GETHOSTNAME_A
 //sysnb	Getegid() (egid int)
 //sysnb	Geteuid() (uid int)
@@ -1120,7 +1104,7 @@ func GetsockoptString(fd, level, opt int) (string, error) {
 		return "", err
 	}
 
-	return string(buf[:vallen-1]), nil
+	return ByteSliceToString(buf[:vallen]), nil
 }
 
 func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) {
diff --git a/vendor/golang.org/x/sys/unix/sysvshm_linux.go b/vendor/golang.org/x/sys/unix/sysvshm_linux.go
index 2c3a4437f0f..4fcd38de276 100644
--- a/vendor/golang.org/x/sys/unix/sysvshm_linux.go
+++ b/vendor/golang.org/x/sys/unix/sysvshm_linux.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build linux
-// +build linux
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix.go b/vendor/golang.org/x/sys/unix/sysvshm_unix.go
index 5bb41d17bc4..79a84f18b46 100644
--- a/vendor/golang.org/x/sys/unix/sysvshm_unix.go
+++ b/vendor/golang.org/x/sys/unix/sysvshm_unix.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build (darwin && !ios) || linux
-// +build darwin,!ios linux
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go
index 71bddefdb87..9eb0db664cb 100644
--- a/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go
+++ b/vendor/golang.org/x/sys/unix/sysvshm_unix_other.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build darwin && !ios
-// +build darwin,!ios
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/timestruct.go b/vendor/golang.org/x/sys/unix/timestruct.go
index 616b1b28485..7997b190226 100644
--- a/vendor/golang.org/x/sys/unix/timestruct.go
+++ b/vendor/golang.org/x/sys/unix/timestruct.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris || zos
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris zos
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/unveil_openbsd.go b/vendor/golang.org/x/sys/unix/unveil_openbsd.go
index 168d5ae7791..cb7e598cef9 100644
--- a/vendor/golang.org/x/sys/unix/unveil_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/unveil_openbsd.go
@@ -4,39 +4,48 @@
 
 package unix
 
-import (
-	"syscall"
-	"unsafe"
-)
+import "fmt"
 
 // Unveil implements the unveil syscall.
 // For more information see unveil(2).
 // Note that the special case of blocking further
 // unveil calls is handled by UnveilBlock.
 func Unveil(path string, flags string) error {
-	pathPtr, err := syscall.BytePtrFromString(path)
-	if err != nil {
+	if err := supportsUnveil(); err != nil {
 		return err
 	}
-	flagsPtr, err := syscall.BytePtrFromString(flags)
+	pathPtr, err := BytePtrFromString(path)
 	if err != nil {
 		return err
 	}
-	_, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(unsafe.Pointer(pathPtr)), uintptr(unsafe.Pointer(flagsPtr)), 0)
-	if e != 0 {
-		return e
+	flagsPtr, err := BytePtrFromString(flags)
+	if err != nil {
+		return err
 	}
-	return nil
+	return unveil(pathPtr, flagsPtr)
 }
 
 // UnveilBlock blocks future unveil calls.
 // For more information see unveil(2).
 func UnveilBlock() error {
-	// Both pointers must be nil.
-	var pathUnsafe, flagsUnsafe unsafe.Pointer
-	_, _, e := syscall.Syscall(SYS_UNVEIL, uintptr(pathUnsafe), uintptr(flagsUnsafe), 0)
-	if e != 0 {
-		return e
+	if err := supportsUnveil(); err != nil {
+		return err
 	}
+	return unveil(nil, nil)
+}
+
+// supportsUnveil checks for availability of the unveil(2) system call based
+// on the running OpenBSD version.
+func supportsUnveil() error {
+	maj, min, err := majmin()
+	if err != nil {
+		return err
+	}
+
+	// unveil is not available before 6.4
+	if maj < 6 || (maj == 6 && min <= 3) {
+		return fmt.Errorf("cannot call Unveil on OpenBSD %d.%d", maj, min)
+	}
+
 	return nil
 }
diff --git a/vendor/golang.org/x/sys/unix/xattr_bsd.go b/vendor/golang.org/x/sys/unix/xattr_bsd.go
index f5f8e9f3665..e1687939618 100644
--- a/vendor/golang.org/x/sys/unix/xattr_bsd.go
+++ b/vendor/golang.org/x/sys/unix/xattr_bsd.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build freebsd || netbsd
-// +build freebsd netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
index ca9799b79ef..2fb219d7876 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && aix
-// +build ppc,aix
 
 // Created by cgo -godefs - DO NOT EDIT
 // cgo -godefs -- -maix32 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
index 200c8c26fe6..b0e6f5c85c7 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_aix_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && aix
-// +build ppc64,aix
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -maix64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go
index 476a1c7e77c..e40fa85245f 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && darwin
-// +build amd64,darwin
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
@@ -1270,6 +1269,16 @@ const (
 	SEEK_END                                = 0x2
 	SEEK_HOLE                               = 0x3
 	SEEK_SET                                = 0x0
+	SF_APPEND                               = 0x40000
+	SF_ARCHIVED                             = 0x10000
+	SF_DATALESS                             = 0x40000000
+	SF_FIRMLINK                             = 0x800000
+	SF_IMMUTABLE                            = 0x20000
+	SF_NOUNLINK                             = 0x100000
+	SF_RESTRICTED                           = 0x80000
+	SF_SETTABLE                             = 0x3fff0000
+	SF_SUPPORTED                            = 0x9f0000
+	SF_SYNTHETIC                            = 0xc0000000
 	SHUT_RD                                 = 0x0
 	SHUT_RDWR                               = 0x2
 	SHUT_WR                                 = 0x1
@@ -1543,6 +1552,15 @@ const (
 	TIOCTIMESTAMP                           = 0x40107459
 	TIOCUCNTL                               = 0x80047466
 	TOSTOP                                  = 0x400000
+	UF_APPEND                               = 0x4
+	UF_COMPRESSED                           = 0x20
+	UF_DATAVAULT                            = 0x80
+	UF_HIDDEN                               = 0x8000
+	UF_IMMUTABLE                            = 0x2
+	UF_NODUMP                               = 0x1
+	UF_OPAQUE                               = 0x8
+	UF_SETTABLE                             = 0xffff
+	UF_TRACKED                              = 0x40
 	VDISCARD                                = 0xf
 	VDSUSP                                  = 0xb
 	VEOF                                    = 0x0
diff --git a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go
index e36f5178d60..bb02aa6c056 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_darwin_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && darwin
-// +build arm64,darwin
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
@@ -1270,6 +1269,16 @@ const (
 	SEEK_END                                = 0x2
 	SEEK_HOLE                               = 0x3
 	SEEK_SET                                = 0x0
+	SF_APPEND                               = 0x40000
+	SF_ARCHIVED                             = 0x10000
+	SF_DATALESS                             = 0x40000000
+	SF_FIRMLINK                             = 0x800000
+	SF_IMMUTABLE                            = 0x20000
+	SF_NOUNLINK                             = 0x100000
+	SF_RESTRICTED                           = 0x80000
+	SF_SETTABLE                             = 0x3fff0000
+	SF_SUPPORTED                            = 0x9f0000
+	SF_SYNTHETIC                            = 0xc0000000
 	SHUT_RD                                 = 0x0
 	SHUT_RDWR                               = 0x2
 	SHUT_WR                                 = 0x1
@@ -1543,6 +1552,15 @@ const (
 	TIOCTIMESTAMP                           = 0x40107459
 	TIOCUCNTL                               = 0x80047466
 	TOSTOP                                  = 0x400000
+	UF_APPEND                               = 0x4
+	UF_COMPRESSED                           = 0x20
+	UF_DATAVAULT                            = 0x80
+	UF_HIDDEN                               = 0x8000
+	UF_IMMUTABLE                            = 0x2
+	UF_NODUMP                               = 0x1
+	UF_OPAQUE                               = 0x8
+	UF_SETTABLE                             = 0xffff
+	UF_TRACKED                              = 0x40
 	VDISCARD                                = 0xf
 	VDSUSP                                  = 0xb
 	VEOF                                    = 0x0
diff --git a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go
index 17bba0e44f9..c0e0f8694c1 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_dragonfly_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && dragonfly
-// +build amd64,dragonfly
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go
index f8c2c513874..6c6923906f4 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && freebsd
-// +build 386,freebsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m32 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go
index 96310c3be1b..dd9163f8e88 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && freebsd
-// +build amd64,freebsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go
index 777b69defa0..493a2a793c0 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && freebsd
-// +build arm,freebsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go
index c557ac2db31..8b437b307d5 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && freebsd
-// +build arm64,freebsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go
index 341b4d96265..67c02dd5795 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_freebsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && freebsd
-// +build riscv64,freebsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux.go b/vendor/golang.org/x/sys/unix/zerrors_linux.go
index e174685adbd..c73cfe2f10b 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux.go
@@ -1,7 +1,6 @@
 // Code generated by mkmerge; DO NOT EDIT.
 
 //go:build linux
-// +build linux
 
 package unix
 
@@ -70,6 +69,7 @@ const (
 	ALG_SET_DRBG_ENTROPY                        = 0x6
 	ALG_SET_IV                                  = 0x2
 	ALG_SET_KEY                                 = 0x1
+	ALG_SET_KEY_BY_KEY_SERIAL                   = 0x7
 	ALG_SET_OP                                  = 0x3
 	ANON_INODE_FS_MAGIC                         = 0x9041934
 	ARPHRD_6LOWPAN                              = 0x339
@@ -480,10 +480,13 @@ const (
 	BPF_FROM_BE                                 = 0x8
 	BPF_FROM_LE                                 = 0x0
 	BPF_FS_MAGIC                                = 0xcafe4a11
+	BPF_F_AFTER                                 = 0x10
 	BPF_F_ALLOW_MULTI                           = 0x2
 	BPF_F_ALLOW_OVERRIDE                        = 0x1
 	BPF_F_ANY_ALIGNMENT                         = 0x2
-	BPF_F_KPROBE_MULTI_RETURN                   = 0x1
+	BPF_F_BEFORE                                = 0x8
+	BPF_F_ID                                    = 0x20
+	BPF_F_NETFILTER_IP_DEFRAG                   = 0x1
 	BPF_F_QUERY_EFFECTIVE                       = 0x1
 	BPF_F_REPLACE                               = 0x4
 	BPF_F_SLEEPABLE                             = 0x10
@@ -492,6 +495,7 @@ const (
 	BPF_F_TEST_RUN_ON_CPU                       = 0x1
 	BPF_F_TEST_STATE_FREQ                       = 0x8
 	BPF_F_TEST_XDP_LIVE_FRAMES                  = 0x2
+	BPF_F_XDP_DEV_BOUND_ONLY                    = 0x40
 	BPF_F_XDP_HAS_FRAGS                         = 0x20
 	BPF_H                                       = 0x8
 	BPF_IMM                                     = 0x0
@@ -519,6 +523,7 @@ const (
 	BPF_MAJOR_VERSION                           = 0x1
 	BPF_MAXINSNS                                = 0x1000
 	BPF_MEM                                     = 0x60
+	BPF_MEMSX                                   = 0x80
 	BPF_MEMWORDS                                = 0x10
 	BPF_MINOR_VERSION                           = 0x1
 	BPF_MISC                                    = 0x7
@@ -774,6 +779,10 @@ const (
 	DEVLINK_GENL_MCGRP_CONFIG_NAME              = "config"
 	DEVLINK_GENL_NAME                           = "devlink"
 	DEVLINK_GENL_VERSION                        = 0x1
+	DEVLINK_PORT_FN_CAP_IPSEC_CRYPTO            = 0x4
+	DEVLINK_PORT_FN_CAP_IPSEC_PACKET            = 0x8
+	DEVLINK_PORT_FN_CAP_MIGRATABLE              = 0x2
+	DEVLINK_PORT_FN_CAP_ROCE                    = 0x1
 	DEVLINK_SB_THRESHOLD_TO_ALPHA_MAX           = 0x14
 	DEVLINK_SUPPORTED_FLASH_OVERWRITE_SECTIONS  = 0x3
 	DEVMEM_MAGIC                                = 0x454d444d
@@ -823,9 +832,9 @@ const (
 	DM_UUID_FLAG                                = 0x4000
 	DM_UUID_LEN                                 = 0x81
 	DM_VERSION                                  = 0xc138fd00
-	DM_VERSION_EXTRA                            = "-ioctl (2022-07-28)"
+	DM_VERSION_EXTRA                            = "-ioctl (2023-03-01)"
 	DM_VERSION_MAJOR                            = 0x4
-	DM_VERSION_MINOR                            = 0x2f
+	DM_VERSION_MINOR                            = 0x30
 	DM_VERSION_PATCHLEVEL                       = 0x0
 	DT_BLK                                      = 0x6
 	DT_CHR                                      = 0x2
@@ -1194,6 +1203,7 @@ const (
 	FAN_EVENT_METADATA_LEN                      = 0x18
 	FAN_EVENT_ON_CHILD                          = 0x8000000
 	FAN_FS_ERROR                                = 0x8000
+	FAN_INFO                                    = 0x20
 	FAN_MARK_ADD                                = 0x1
 	FAN_MARK_DONT_FOLLOW                        = 0x4
 	FAN_MARK_EVICTABLE                          = 0x200
@@ -1230,6 +1240,8 @@ const (
 	FAN_REPORT_PIDFD                            = 0x80
 	FAN_REPORT_TARGET_FID                       = 0x1000
 	FAN_REPORT_TID                              = 0x100
+	FAN_RESPONSE_INFO_AUDIT_RULE                = 0x1
+	FAN_RESPONSE_INFO_NONE                      = 0x0
 	FAN_UNLIMITED_MARKS                         = 0x20
 	FAN_UNLIMITED_QUEUE                         = 0x10
 	FD_CLOEXEC                                  = 0x1
@@ -1262,6 +1274,8 @@ const (
 	FSCRYPT_MODE_AES_256_CTS                    = 0x4
 	FSCRYPT_MODE_AES_256_HCTR2                  = 0xa
 	FSCRYPT_MODE_AES_256_XTS                    = 0x1
+	FSCRYPT_MODE_SM4_CTS                        = 0x8
+	FSCRYPT_MODE_SM4_XTS                        = 0x7
 	FSCRYPT_POLICY_FLAGS_PAD_16                 = 0x2
 	FSCRYPT_POLICY_FLAGS_PAD_32                 = 0x3
 	FSCRYPT_POLICY_FLAGS_PAD_4                  = 0x0
@@ -1280,8 +1294,6 @@ const (
 	FS_ENCRYPTION_MODE_AES_256_GCM              = 0x2
 	FS_ENCRYPTION_MODE_AES_256_XTS              = 0x1
 	FS_ENCRYPTION_MODE_INVALID                  = 0x0
-	FS_ENCRYPTION_MODE_SPECK128_256_CTS         = 0x8
-	FS_ENCRYPTION_MODE_SPECK128_256_XTS         = 0x7
 	FS_IOC_ADD_ENCRYPTION_KEY                   = 0xc0506617
 	FS_IOC_GET_ENCRYPTION_KEY_STATUS            = 0xc080661a
 	FS_IOC_GET_ENCRYPTION_POLICY_EX             = 0xc0096616
@@ -1691,6 +1703,7 @@ const (
 	KEXEC_ON_CRASH                              = 0x1
 	KEXEC_PRESERVE_CONTEXT                      = 0x2
 	KEXEC_SEGMENT_MAX                           = 0x10
+	KEXEC_UPDATE_ELFCOREHDR                     = 0x4
 	KEYCTL_ASSUME_AUTHORITY                     = 0x10
 	KEYCTL_CAPABILITIES                         = 0x1f
 	KEYCTL_CAPS0_BIG_KEY                        = 0x10
@@ -1770,6 +1783,7 @@ const (
 	LANDLOCK_ACCESS_FS_REFER                    = 0x2000
 	LANDLOCK_ACCESS_FS_REMOVE_DIR               = 0x10
 	LANDLOCK_ACCESS_FS_REMOVE_FILE              = 0x20
+	LANDLOCK_ACCESS_FS_TRUNCATE                 = 0x4000
 	LANDLOCK_ACCESS_FS_WRITE_FILE               = 0x2
 	LANDLOCK_CREATE_RULESET_VERSION             = 0x1
 	LINUX_REBOOT_CMD_CAD_OFF                    = 0x0
@@ -1787,6 +1801,7 @@ const (
 	LOCK_SH                                     = 0x1
 	LOCK_UN                                     = 0x8
 	LOOP_CLR_FD                                 = 0x4c01
+	LOOP_CONFIGURE                              = 0x4c0a
 	LOOP_CTL_ADD                                = 0x4c80
 	LOOP_CTL_GET_FREE                           = 0x4c82
 	LOOP_CTL_REMOVE                             = 0x4c81
@@ -1809,6 +1824,7 @@ const (
 	LWTUNNEL_IP_OPT_GENEVE_MAX                  = 0x3
 	LWTUNNEL_IP_OPT_VXLAN_MAX                   = 0x1
 	MADV_COLD                                   = 0x14
+	MADV_COLLAPSE                               = 0x19
 	MADV_DODUMP                                 = 0x11
 	MADV_DOFORK                                 = 0xb
 	MADV_DONTDUMP                               = 0x10
@@ -1855,6 +1871,7 @@ const (
 	MEMWRITEOOB64                               = 0xc0184d15
 	MFD_ALLOW_SEALING                           = 0x2
 	MFD_CLOEXEC                                 = 0x1
+	MFD_EXEC                                    = 0x10
 	MFD_HUGETLB                                 = 0x4
 	MFD_HUGE_16GB                               = 0x88000000
 	MFD_HUGE_16MB                               = 0x60000000
@@ -1870,6 +1887,7 @@ const (
 	MFD_HUGE_8MB                                = 0x5c000000
 	MFD_HUGE_MASK                               = 0x3f
 	MFD_HUGE_SHIFT                              = 0x1a
+	MFD_NOEXEC_SEAL                             = 0x8
 	MINIX2_SUPER_MAGIC                          = 0x2468
 	MINIX2_SUPER_MAGIC2                         = 0x2478
 	MINIX3_SUPER_MAGIC                          = 0x4d5a
@@ -1893,6 +1911,9 @@ const (
 	MOUNT_ATTR_SIZE_VER0                        = 0x20
 	MOUNT_ATTR_STRICTATIME                      = 0x20
 	MOUNT_ATTR__ATIME                           = 0x70
+	MREMAP_DONTUNMAP                            = 0x4
+	MREMAP_FIXED                                = 0x2
+	MREMAP_MAYMOVE                              = 0x1
 	MSDOS_SUPER_MAGIC                           = 0x4d44
 	MSG_BATCH                                   = 0x40000
 	MSG_CMSG_CLOEXEC                            = 0x40000000
@@ -2163,6 +2184,7 @@ const (
 	PACKET_FANOUT_DATA                          = 0x16
 	PACKET_FANOUT_EBPF                          = 0x7
 	PACKET_FANOUT_FLAG_DEFRAG                   = 0x8000
+	PACKET_FANOUT_FLAG_IGNORE_OUTGOING          = 0x4000
 	PACKET_FANOUT_FLAG_ROLLOVER                 = 0x1000
 	PACKET_FANOUT_FLAG_UNIQUEID                 = 0x2000
 	PACKET_FANOUT_HASH                          = 0x0
@@ -2198,6 +2220,7 @@ const (
 	PACKET_USER                                 = 0x6
 	PACKET_VERSION                              = 0xa
 	PACKET_VNET_HDR                             = 0xf
+	PACKET_VNET_HDR_SZ                          = 0x18
 	PARITY_CRC16_PR0                            = 0x2
 	PARITY_CRC16_PR0_CCITT                      = 0x4
 	PARITY_CRC16_PR1                            = 0x3
@@ -2215,6 +2238,7 @@ const (
 	PERF_ATTR_SIZE_VER5                         = 0x70
 	PERF_ATTR_SIZE_VER6                         = 0x78
 	PERF_ATTR_SIZE_VER7                         = 0x80
+	PERF_ATTR_SIZE_VER8                         = 0x88
 	PERF_AUX_FLAG_COLLISION                     = 0x8
 	PERF_AUX_FLAG_CORESIGHT_FORMAT_CORESIGHT    = 0x0
 	PERF_AUX_FLAG_CORESIGHT_FORMAT_RAW          = 0x100
@@ -2258,6 +2282,7 @@ const (
 	PERF_MEM_LVLNUM_PMEM                        = 0xe
 	PERF_MEM_LVLNUM_RAM                         = 0xd
 	PERF_MEM_LVLNUM_SHIFT                       = 0x21
+	PERF_MEM_LVLNUM_UNC                         = 0x8
 	PERF_MEM_LVL_HIT                            = 0x2
 	PERF_MEM_LVL_IO                             = 0x1000
 	PERF_MEM_LVL_L1                             = 0x8
@@ -2355,6 +2380,7 @@ const (
 	PR_FP_EXC_UND                               = 0x40000
 	PR_FP_MODE_FR                               = 0x1
 	PR_FP_MODE_FRE                              = 0x2
+	PR_GET_AUXV                                 = 0x41555856
 	PR_GET_CHILD_SUBREAPER                      = 0x25
 	PR_GET_DUMPABLE                             = 0x3
 	PR_GET_ENDIAN                               = 0x13
@@ -2363,6 +2389,8 @@ const (
 	PR_GET_FP_MODE                              = 0x2e
 	PR_GET_IO_FLUSHER                           = 0x3a
 	PR_GET_KEEPCAPS                             = 0x7
+	PR_GET_MDWE                                 = 0x42
+	PR_GET_MEMORY_MERGE                         = 0x44
 	PR_GET_NAME                                 = 0x10
 	PR_GET_NO_NEW_PRIVS                         = 0x27
 	PR_GET_PDEATHSIG                            = 0x2
@@ -2383,6 +2411,7 @@ const (
 	PR_MCE_KILL_GET                             = 0x22
 	PR_MCE_KILL_LATE                            = 0x0
 	PR_MCE_KILL_SET                             = 0x1
+	PR_MDWE_REFUSE_EXEC_GAIN                    = 0x1
 	PR_MPX_DISABLE_MANAGEMENT                   = 0x2c
 	PR_MPX_ENABLE_MANAGEMENT                    = 0x2b
 	PR_MTE_TAG_MASK                             = 0x7fff8
@@ -2400,6 +2429,15 @@ const (
 	PR_PAC_GET_ENABLED_KEYS                     = 0x3d
 	PR_PAC_RESET_KEYS                           = 0x36
 	PR_PAC_SET_ENABLED_KEYS                     = 0x3c
+	PR_RISCV_V_GET_CONTROL                      = 0x46
+	PR_RISCV_V_SET_CONTROL                      = 0x45
+	PR_RISCV_V_VSTATE_CTRL_CUR_MASK             = 0x3
+	PR_RISCV_V_VSTATE_CTRL_DEFAULT              = 0x0
+	PR_RISCV_V_VSTATE_CTRL_INHERIT              = 0x10
+	PR_RISCV_V_VSTATE_CTRL_MASK                 = 0x1f
+	PR_RISCV_V_VSTATE_CTRL_NEXT_MASK            = 0xc
+	PR_RISCV_V_VSTATE_CTRL_OFF                  = 0x1
+	PR_RISCV_V_VSTATE_CTRL_ON                   = 0x2
 	PR_SCHED_CORE                               = 0x3e
 	PR_SCHED_CORE_CREATE                        = 0x1
 	PR_SCHED_CORE_GET                           = 0x0
@@ -2417,6 +2455,8 @@ const (
 	PR_SET_FP_MODE                              = 0x2d
 	PR_SET_IO_FLUSHER                           = 0x39
 	PR_SET_KEEPCAPS                             = 0x8
+	PR_SET_MDWE                                 = 0x41
+	PR_SET_MEMORY_MERGE                         = 0x43
 	PR_SET_MM                                   = 0x23
 	PR_SET_MM_ARG_END                           = 0x9
 	PR_SET_MM_ARG_START                         = 0x8
@@ -2500,6 +2540,7 @@ const (
 	PTRACE_GETSIGMASK                           = 0x420a
 	PTRACE_GET_RSEQ_CONFIGURATION               = 0x420f
 	PTRACE_GET_SYSCALL_INFO                     = 0x420e
+	PTRACE_GET_SYSCALL_USER_DISPATCH_CONFIG     = 0x4211
 	PTRACE_INTERRUPT                            = 0x4207
 	PTRACE_KILL                                 = 0x8
 	PTRACE_LISTEN                               = 0x4208
@@ -2530,6 +2571,7 @@ const (
 	PTRACE_SETREGSET                            = 0x4205
 	PTRACE_SETSIGINFO                           = 0x4203
 	PTRACE_SETSIGMASK                           = 0x420b
+	PTRACE_SET_SYSCALL_USER_DISPATCH_CONFIG     = 0x4210
 	PTRACE_SINGLESTEP                           = 0x9
 	PTRACE_SYSCALL                              = 0x18
 	PTRACE_SYSCALL_INFO_ENTRY                   = 0x1
@@ -2796,6 +2838,23 @@ const (
 	RWF_SUPPORTED                               = 0x1f
 	RWF_SYNC                                    = 0x4
 	RWF_WRITE_LIFE_NOT_SET                      = 0x0
+	SCHED_BATCH                                 = 0x3
+	SCHED_DEADLINE                              = 0x6
+	SCHED_FIFO                                  = 0x1
+	SCHED_FLAG_ALL                              = 0x7f
+	SCHED_FLAG_DL_OVERRUN                       = 0x4
+	SCHED_FLAG_KEEP_ALL                         = 0x18
+	SCHED_FLAG_KEEP_PARAMS                      = 0x10
+	SCHED_FLAG_KEEP_POLICY                      = 0x8
+	SCHED_FLAG_RECLAIM                          = 0x2
+	SCHED_FLAG_RESET_ON_FORK                    = 0x1
+	SCHED_FLAG_UTIL_CLAMP                       = 0x60
+	SCHED_FLAG_UTIL_CLAMP_MAX                   = 0x40
+	SCHED_FLAG_UTIL_CLAMP_MIN                   = 0x20
+	SCHED_IDLE                                  = 0x5
+	SCHED_NORMAL                                = 0x0
+	SCHED_RESET_ON_FORK                         = 0x40000000
+	SCHED_RR                                    = 0x2
 	SCM_CREDENTIALS                             = 0x2
 	SCM_RIGHTS                                  = 0x1
 	SCM_TIMESTAMP                               = 0x1d
@@ -2961,6 +3020,7 @@ const (
 	SOL_TCP                                     = 0x6
 	SOL_TIPC                                    = 0x10f
 	SOL_TLS                                     = 0x11a
+	SOL_UDP                                     = 0x11
 	SOL_X25                                     = 0x106
 	SOL_XDP                                     = 0x11b
 	SOMAXCONN                                   = 0x1000
@@ -3065,7 +3125,7 @@ const (
 	TASKSTATS_GENL_NAME                         = "TASKSTATS"
 	TASKSTATS_GENL_VERSION                      = 0x1
 	TASKSTATS_TYPE_MAX                          = 0x6
-	TASKSTATS_VERSION                           = 0xd
+	TASKSTATS_VERSION                           = 0xe
 	TCIFLUSH                                    = 0x0
 	TCIOFF                                      = 0x2
 	TCIOFLUSH                                   = 0x2
@@ -3231,6 +3291,7 @@ const (
 	TP_STATUS_COPY                              = 0x2
 	TP_STATUS_CSUMNOTREADY                      = 0x8
 	TP_STATUS_CSUM_VALID                        = 0x80
+	TP_STATUS_GSO_TCP                           = 0x100
 	TP_STATUS_KERNEL                            = 0x0
 	TP_STATUS_LOSING                            = 0x4
 	TP_STATUS_SENDING                           = 0x2
@@ -3245,6 +3306,19 @@ const (
 	TRACEFS_MAGIC                               = 0x74726163
 	TS_COMM_LEN                                 = 0x20
 	UDF_SUPER_MAGIC                             = 0x15013346
+	UDP_CORK                                    = 0x1
+	UDP_ENCAP                                   = 0x64
+	UDP_ENCAP_ESPINUDP                          = 0x2
+	UDP_ENCAP_ESPINUDP_NON_IKE                  = 0x1
+	UDP_ENCAP_GTP0                              = 0x4
+	UDP_ENCAP_GTP1U                             = 0x5
+	UDP_ENCAP_L2TPINUDP                         = 0x3
+	UDP_GRO                                     = 0x68
+	UDP_NO_CHECK6_RX                            = 0x66
+	UDP_NO_CHECK6_TX                            = 0x65
+	UDP_SEGMENT                                 = 0x67
+	UDP_V4_FLOW                                 = 0x2
+	UDP_V6_FLOW                                 = 0x6
 	UMOUNT_NOFOLLOW                             = 0x8
 	USBDEVICE_SUPER_MAGIC                       = 0x9fa2
 	UTIME_NOW                                   = 0x3fffffff
@@ -3395,6 +3469,7 @@ const (
 	XDP_PACKET_HEADROOM                         = 0x100
 	XDP_PGOFF_RX_RING                           = 0x0
 	XDP_PGOFF_TX_RING                           = 0x80000000
+	XDP_PKT_CONTD                               = 0x1
 	XDP_RING_NEED_WAKEUP                        = 0x1
 	XDP_RX_RING                                 = 0x2
 	XDP_SHARED_UMEM                             = 0x1
@@ -3407,6 +3482,7 @@ const (
 	XDP_UMEM_REG                                = 0x4
 	XDP_UMEM_UNALIGNED_CHUNK_FLAG               = 0x1
 	XDP_USE_NEED_WAKEUP                         = 0x8
+	XDP_USE_SG                                  = 0x10
 	XDP_ZEROCOPY                                = 0x4
 	XENFS_SUPER_MAGIC                           = 0xabba1974
 	XFS_SUPER_MAGIC                             = 0x58465342
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
index a46df0f1e57..4920821cf3b 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && linux
-// +build 386,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80041270
 	BLKBSZSET                        = 0x40041271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80041272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -317,10 +325,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
index 6cd4a3ea9d3..a0c1e411275 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && linux
-// +build amd64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80081270
 	BLKBSZSET                        = 0x40081271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80081272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -318,10 +326,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
index c7ebee24df3..c63985560f6 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && linux
-// +build arm,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80041270
 	BLKBSZSET                        = 0x40041271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80041272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -324,10 +332,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
index 9d5352c3e45..47cc62e25c1 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && linux
-// +build arm64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80081270
 	BLKBSZSET                        = 0x40081271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80081272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -314,10 +322,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
@@ -443,6 +453,7 @@ const (
 	TIOCSWINSZ                       = 0x5414
 	TIOCVHANGUP                      = 0x5437
 	TOSTOP                           = 0x100
+	TPIDR2_MAGIC                     = 0x54504902
 	TUNATTACHFILTER                  = 0x401054d5
 	TUNDETACHFILTER                  = 0x401054d6
 	TUNGETDEVNETNS                   = 0x54e3
@@ -515,6 +526,7 @@ const (
 	XCASE                            = 0x4
 	XTABS                            = 0x1800
 	ZA_MAGIC                         = 0x54366345
+	ZT_MAGIC                         = 0x5a544e01
 	_HIDIOCGRAWNAME                  = 0x80804804
 	_HIDIOCGRAWPHYS                  = 0x80404805
 	_HIDIOCGRAWUNIQ                  = 0x80404808
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go
index f26a164f4aa..27ac4a09e22 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_loong64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build loong64 && linux
-// +build loong64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/loong64/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80081270
 	BLKBSZSET                        = 0x40081271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80081272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -109,6 +117,9 @@ const (
 	IUCLC                            = 0x200
 	IXOFF                            = 0x1000
 	IXON                             = 0x400
+	LASX_CTX_MAGIC                   = 0x41535801
+	LBT_CTX_MAGIC                    = 0x42540001
+	LSX_CTX_MAGIC                    = 0x53580001
 	MAP_ANON                         = 0x20
 	MAP_ANONYMOUS                    = 0x20
 	MAP_DENYWRITE                    = 0x800
@@ -308,10 +319,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
index 890bc3c9b70..54694642a5d 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips && linux
-// +build mips,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40041270
 	BLKBSZSET                        = 0x80041271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40041272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -317,10 +325,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1e
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x1028
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
index 549f26ac646..3adb81d7582 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && linux
-// +build mips64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40081270
 	BLKBSZSET                        = 0x80081271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40081272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -317,10 +325,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1e
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x1028
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
index e0365e32c17..2dfe98f0d1b 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64le && linux
-// +build mips64le,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40081270
 	BLKBSZSET                        = 0x80081271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40081272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -317,10 +325,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1e
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x1028
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
index fdccce15ca2..f5398f84f04 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mipsle && linux
-// +build mipsle,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40041270
 	BLKBSZSET                        = 0x80041271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40041272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -317,10 +325,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x11
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x12
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1e
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x1028
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go
index b2205c83faa..c54f152d68f 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && linux
-// +build ppc,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x10
 	B576000                          = 0x15
 	B921600                          = 0x16
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40041270
 	BLKBSZSET                        = 0x80041271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40041272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1f
 	BS1                              = 0x8000
 	BSDLY                            = 0x8000
@@ -372,10 +380,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
index 81aa5ad0f69..76057dc72fb 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && linux
-// +build ppc64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x10
 	B576000                          = 0x15
 	B921600                          = 0x16
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40081270
 	BLKBSZSET                        = 0x80081271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40081272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1f
 	BS1                              = 0x8000
 	BSDLY                            = 0x8000
@@ -376,10 +384,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
index 76807a1fd4f..e0c3725e2b8 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_ppc64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64le && linux
-// +build ppc64le,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64le/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x10
 	B576000                          = 0x15
 	B921600                          = 0x16
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40081270
 	BLKBSZSET                        = 0x80081271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40081272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1f
 	BS1                              = 0x8000
 	BSDLY                            = 0x8000
@@ -376,10 +384,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x14
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x15
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
index d4a5ab9e4e0..18f2813ed54 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && linux
-// +build riscv64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/riscv64/include _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80081270
 	BLKBSZSET                        = 0x40081271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80081272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -219,6 +227,9 @@ const (
 	PPPIOCUNBRIDGECHAN               = 0x7434
 	PPPIOCXFERUNIT                   = 0x744e
 	PR_SET_PTRACER_ANY               = 0xffffffffffffffff
+	PTRACE_GETFDPIC                  = 0x21
+	PTRACE_GETFDPIC_EXEC             = 0x0
+	PTRACE_GETFDPIC_INTERP           = 0x1
 	RLIMIT_AS                        = 0x9
 	RLIMIT_MEMLOCK                   = 0x8
 	RLIMIT_NOFILE                    = 0x7
@@ -305,10 +316,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
index 66e65db9519..11619d4ec88 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_s390x.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build s390x && linux
-// +build s390x,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/s390x/include -fsigned-char _const.go
@@ -27,22 +26,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x127a
 	BLKBSZGET                        = 0x80081270
 	BLKBSZSET                        = 0x40081271
+	BLKDISCARD                       = 0x1277
+	BLKDISCARDZEROES                 = 0x127c
 	BLKFLSBUF                        = 0x1261
 	BLKFRAGET                        = 0x1265
 	BLKFRASET                        = 0x1264
+	BLKGETDISKSEQ                    = 0x80081280
 	BLKGETSIZE                       = 0x1260
 	BLKGETSIZE64                     = 0x80081272
+	BLKIOMIN                         = 0x1278
+	BLKIOOPT                         = 0x1279
 	BLKPBSZGET                       = 0x127b
 	BLKRAGET                         = 0x1263
 	BLKRASET                         = 0x1262
 	BLKROGET                         = 0x125e
 	BLKROSET                         = 0x125d
+	BLKROTATIONAL                    = 0x127e
 	BLKRRPART                        = 0x125f
+	BLKSECDISCARD                    = 0x127d
 	BLKSECTGET                       = 0x1267
 	BLKSECTSET                       = 0x1266
 	BLKSSZGET                        = 0x1268
+	BLKZEROOUT                       = 0x127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -380,10 +388,12 @@ const (
 	SO_NOFCS                         = 0x2b
 	SO_OOBINLINE                     = 0xa
 	SO_PASSCRED                      = 0x10
+	SO_PASSPIDFD                     = 0x4c
 	SO_PASSSEC                       = 0x22
 	SO_PEEK_OFF                      = 0x2a
 	SO_PEERCRED                      = 0x11
 	SO_PEERGROUPS                    = 0x3b
+	SO_PEERPIDFD                     = 0x4d
 	SO_PEERSEC                       = 0x1f
 	SO_PREFER_BUSY_POLL              = 0x45
 	SO_PROTOCOL                      = 0x26
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
index f619252691e..396d994da79 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build sparc64 && linux
-// +build sparc64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -Wall -Werror -static -I/tmp/sparc64/include _const.go
@@ -30,22 +29,31 @@ const (
 	B57600                           = 0x1001
 	B576000                          = 0x1006
 	B921600                          = 0x1007
+	BLKALIGNOFF                      = 0x2000127a
 	BLKBSZGET                        = 0x40081270
 	BLKBSZSET                        = 0x80081271
+	BLKDISCARD                       = 0x20001277
+	BLKDISCARDZEROES                 = 0x2000127c
 	BLKFLSBUF                        = 0x20001261
 	BLKFRAGET                        = 0x20001265
 	BLKFRASET                        = 0x20001264
+	BLKGETDISKSEQ                    = 0x40081280
 	BLKGETSIZE                       = 0x20001260
 	BLKGETSIZE64                     = 0x40081272
+	BLKIOMIN                         = 0x20001278
+	BLKIOOPT                         = 0x20001279
 	BLKPBSZGET                       = 0x2000127b
 	BLKRAGET                         = 0x20001263
 	BLKRASET                         = 0x20001262
 	BLKROGET                         = 0x2000125e
 	BLKROSET                         = 0x2000125d
+	BLKROTATIONAL                    = 0x2000127e
 	BLKRRPART                        = 0x2000125f
+	BLKSECDISCARD                    = 0x2000127d
 	BLKSECTGET                       = 0x20001267
 	BLKSECTSET                       = 0x20001266
 	BLKSSZGET                        = 0x20001268
+	BLKZEROOUT                       = 0x2000127f
 	BOTHER                           = 0x1000
 	BS1                              = 0x2000
 	BSDLY                            = 0x2000
@@ -329,6 +337,54 @@ const (
 	SCM_WIFI_STATUS                  = 0x25
 	SFD_CLOEXEC                      = 0x400000
 	SFD_NONBLOCK                     = 0x4000
+	SF_FP                            = 0x38
+	SF_I0                            = 0x20
+	SF_I1                            = 0x24
+	SF_I2                            = 0x28
+	SF_I3                            = 0x2c
+	SF_I4                            = 0x30
+	SF_I5                            = 0x34
+	SF_L0                            = 0x0
+	SF_L1                            = 0x4
+	SF_L2                            = 0x8
+	SF_L3                            = 0xc
+	SF_L4                            = 0x10
+	SF_L5                            = 0x14
+	SF_L6                            = 0x18
+	SF_L7                            = 0x1c
+	SF_PC                            = 0x3c
+	SF_RETP                          = 0x40
+	SF_V9_FP                         = 0x70
+	SF_V9_I0                         = 0x40
+	SF_V9_I1                         = 0x48
+	SF_V9_I2                         = 0x50
+	SF_V9_I3                         = 0x58
+	SF_V9_I4                         = 0x60
+	SF_V9_I5                         = 0x68
+	SF_V9_L0                         = 0x0
+	SF_V9_L1                         = 0x8
+	SF_V9_L2                         = 0x10
+	SF_V9_L3                         = 0x18
+	SF_V9_L4                         = 0x20
+	SF_V9_L5                         = 0x28
+	SF_V9_L6                         = 0x30
+	SF_V9_L7                         = 0x38
+	SF_V9_PC                         = 0x78
+	SF_V9_RETP                       = 0x80
+	SF_V9_XARG0                      = 0x88
+	SF_V9_XARG1                      = 0x90
+	SF_V9_XARG2                      = 0x98
+	SF_V9_XARG3                      = 0xa0
+	SF_V9_XARG4                      = 0xa8
+	SF_V9_XARG5                      = 0xb0
+	SF_V9_XXARG                      = 0xb8
+	SF_XARG0                         = 0x44
+	SF_XARG1                         = 0x48
+	SF_XARG2                         = 0x4c
+	SF_XARG3                         = 0x50
+	SF_XARG4                         = 0x54
+	SF_XARG5                         = 0x58
+	SF_XXARG                         = 0x5c
 	SIOCATMARK                       = 0x8905
 	SIOCGPGRP                        = 0x8904
 	SIOCGSTAMPNS_NEW                 = 0x40108907
@@ -371,10 +427,12 @@ const (
 	SO_NOFCS                         = 0x27
 	SO_OOBINLINE                     = 0x100
 	SO_PASSCRED                      = 0x2
+	SO_PASSPIDFD                     = 0x55
 	SO_PASSSEC                       = 0x1f
 	SO_PEEK_OFF                      = 0x26
 	SO_PEERCRED                      = 0x40
 	SO_PEERGROUPS                    = 0x3d
+	SO_PEERPIDFD                     = 0x56
 	SO_PEERSEC                       = 0x1e
 	SO_PREFER_BUSY_POLL              = 0x48
 	SO_PROTOCOL                      = 0x1028
diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go
index 72f7420d20a..130085df407 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && netbsd
-// +build 386,netbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m32 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go
index 8d4eb0c0804..84769a1a386 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && netbsd
-// +build amd64,netbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go
index 9eef9749f6a..602ded00333 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && netbsd
-// +build arm,netbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -marm _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go
index 3b62ba192c3..efc0406ee1d 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_netbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && netbsd
-// +build arm64,netbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go
index af20e474b38..5a6500f8377 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && openbsd
-// +build 386,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m32 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go
index 6015fcb2bf6..a5aeeb979de 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && openbsd
-// +build amd64,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go
index 8d44955e44d..0e9748a7229 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && openbsd
-// +build arm,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go
index ae16fe7542a..4f4449abc17 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && openbsd
-// +build arm64,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go
index 03d90fe3550..76a363f0fe0 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && openbsd
-// +build mips64,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go
index 8e2c51b1eec..43ca0cdfdcf 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && openbsd
-// +build ppc64,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go
index 13d403031ed..b1b8bb2005c 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_openbsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && openbsd
-// +build riscv64,openbsd
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go
index 1afee6a0890..d2ddd3176e3 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_solaris_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && solaris
-// +build amd64,solaris
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
 // cgo -godefs -- -m64 _const.go
diff --git a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go
index fc7d0506f6c..4dfd2e051d3 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_zos_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 // Hand edited based on zerrors_linux_s390x.go
 // TODO: auto-generate.
diff --git a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go
index bd001a6e1cc..586317c78e7 100644
--- a/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go
+++ b/vendor/golang.org/x/sys/unix/zptrace_armnn_linux.go
@@ -1,8 +1,6 @@
 // Code generated by linux/mkall.go generatePtracePair("arm", "arm64"). DO NOT EDIT.
 
 //go:build linux && (arm || arm64)
-// +build linux
-// +build arm arm64
 
 package unix
 
@@ -15,12 +13,12 @@ type PtraceRegsArm struct {
 
 // PtraceGetRegsArm fetches the registers used by arm binaries.
 func PtraceGetRegsArm(pid int, regsout *PtraceRegsArm) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsArm sets the registers used by arm binaries.
 func PtraceSetRegsArm(pid int, regs *PtraceRegsArm) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
 
 // PtraceRegsArm64 is the registers used by arm64 binaries.
@@ -33,10 +31,10 @@ type PtraceRegsArm64 struct {
 
 // PtraceGetRegsArm64 fetches the registers used by arm64 binaries.
 func PtraceGetRegsArm64(pid int, regsout *PtraceRegsArm64) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsArm64 sets the registers used by arm64 binaries.
 func PtraceSetRegsArm64(pid int, regs *PtraceRegsArm64) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
diff --git a/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go b/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go
index 6cb6d688aa4..834d2856dd4 100644
--- a/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zptrace_linux_arm64.go
@@ -7,11 +7,11 @@ import "unsafe"
 // PtraceGetRegSetArm64 fetches the registers used by arm64 binaries.
 func PtraceGetRegSetArm64(pid, addr int, regsout *PtraceRegsArm64) error {
 	iovec := Iovec{(*byte)(unsafe.Pointer(regsout)), uint64(unsafe.Sizeof(*regsout))}
-	return ptrace(PTRACE_GETREGSET, pid, uintptr(addr), uintptr(unsafe.Pointer(&iovec)))
+	return ptracePtr(PTRACE_GETREGSET, pid, uintptr(addr), unsafe.Pointer(&iovec))
 }
 
 // PtraceSetRegSetArm64 sets the registers used by arm64 binaries.
 func PtraceSetRegSetArm64(pid, addr int, regs *PtraceRegsArm64) error {
 	iovec := Iovec{(*byte)(unsafe.Pointer(regs)), uint64(unsafe.Sizeof(*regs))}
-	return ptrace(PTRACE_SETREGSET, pid, uintptr(addr), uintptr(unsafe.Pointer(&iovec)))
+	return ptracePtr(PTRACE_SETREGSET, pid, uintptr(addr), unsafe.Pointer(&iovec))
 }
diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go
index c34d0639be3..d7c881be77d 100644
--- a/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go
+++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnn_linux.go
@@ -1,8 +1,6 @@
 // Code generated by linux/mkall.go generatePtracePair("mips", "mips64"). DO NOT EDIT.
 
 //go:build linux && (mips || mips64)
-// +build linux
-// +build mips mips64
 
 package unix
 
@@ -21,12 +19,12 @@ type PtraceRegsMips struct {
 
 // PtraceGetRegsMips fetches the registers used by mips binaries.
 func PtraceGetRegsMips(pid int, regsout *PtraceRegsMips) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsMips sets the registers used by mips binaries.
 func PtraceSetRegsMips(pid int, regs *PtraceRegsMips) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
 
 // PtraceRegsMips64 is the registers used by mips64 binaries.
@@ -42,10 +40,10 @@ type PtraceRegsMips64 struct {
 
 // PtraceGetRegsMips64 fetches the registers used by mips64 binaries.
 func PtraceGetRegsMips64(pid int, regsout *PtraceRegsMips64) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsMips64 sets the registers used by mips64 binaries.
 func PtraceSetRegsMips64(pid int, regs *PtraceRegsMips64) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
diff --git a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go
index 3ccf0c0c4a8..2d2de5d2922 100644
--- a/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go
+++ b/vendor/golang.org/x/sys/unix/zptrace_mipsnnle_linux.go
@@ -1,8 +1,6 @@
 // Code generated by linux/mkall.go generatePtracePair("mipsle", "mips64le"). DO NOT EDIT.
 
 //go:build linux && (mipsle || mips64le)
-// +build linux
-// +build mipsle mips64le
 
 package unix
 
@@ -21,12 +19,12 @@ type PtraceRegsMipsle struct {
 
 // PtraceGetRegsMipsle fetches the registers used by mipsle binaries.
 func PtraceGetRegsMipsle(pid int, regsout *PtraceRegsMipsle) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsMipsle sets the registers used by mipsle binaries.
 func PtraceSetRegsMipsle(pid int, regs *PtraceRegsMipsle) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
 
 // PtraceRegsMips64le is the registers used by mips64le binaries.
@@ -42,10 +40,10 @@ type PtraceRegsMips64le struct {
 
 // PtraceGetRegsMips64le fetches the registers used by mips64le binaries.
 func PtraceGetRegsMips64le(pid int, regsout *PtraceRegsMips64le) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsMips64le sets the registers used by mips64le binaries.
 func PtraceSetRegsMips64le(pid int, regs *PtraceRegsMips64le) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
diff --git a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go
index 7d65857004c..5adc79fb5ea 100644
--- a/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go
+++ b/vendor/golang.org/x/sys/unix/zptrace_x86_linux.go
@@ -1,8 +1,6 @@
 // Code generated by linux/mkall.go generatePtracePair("386", "amd64"). DO NOT EDIT.
 
 //go:build linux && (386 || amd64)
-// +build linux
-// +build 386 amd64
 
 package unix
 
@@ -31,12 +29,12 @@ type PtraceRegs386 struct {
 
 // PtraceGetRegs386 fetches the registers used by 386 binaries.
 func PtraceGetRegs386(pid int, regsout *PtraceRegs386) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegs386 sets the registers used by 386 binaries.
 func PtraceSetRegs386(pid int, regs *PtraceRegs386) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
 
 // PtraceRegsAmd64 is the registers used by amd64 binaries.
@@ -72,10 +70,10 @@ type PtraceRegsAmd64 struct {
 
 // PtraceGetRegsAmd64 fetches the registers used by amd64 binaries.
 func PtraceGetRegsAmd64(pid int, regsout *PtraceRegsAmd64) error {
-	return ptrace(PTRACE_GETREGS, pid, 0, uintptr(unsafe.Pointer(regsout)))
+	return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
 }
 
 // PtraceSetRegsAmd64 sets the registers used by amd64 binaries.
 func PtraceSetRegsAmd64(pid int, regs *PtraceRegsAmd64) error {
-	return ptrace(PTRACE_SETREGS, pid, 0, uintptr(unsafe.Pointer(regs)))
+	return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
 }
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
index 870215d2c47..6ea64a3c0c3 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build aix && ppc
-// +build aix,ppc
 
 package unix
 
@@ -124,7 +123,6 @@ int utime(uintptr_t, uintptr_t);
 unsigned long long getsystemcfg(int);
 int umount(uintptr_t);
 int getrlimit64(int, uintptr_t);
-int setrlimit64(int, uintptr_t);
 long long lseek64(int, long long, int);
 uintptr_t mmap(uintptr_t, uintptr_t, int, int, int, long long);
 
@@ -213,7 +211,7 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t,
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func ioctl(fd int, req uint, arg uintptr) (err error) {
+func ioctl(fd int, req int, arg uintptr) (err error) {
 	r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(arg))
 	if r0 == -1 && er != nil {
 		err = er
@@ -223,6 +221,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) {
+	r0, er := C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg)))
+	if r0 == -1 && er != nil {
+		err = er
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func FcntlInt(fd uintptr, cmd int, arg int) (r int, err error) {
 	r0, er := C.fcntl(C.uintptr_t(fd), C.int(cmd), C.uintptr_t(arg))
 	r = int(r0)
@@ -808,28 +816,6 @@ func write(fd int, p []byte) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, p *byte, np int) (n int, err error) {
-	r0, er := C.read(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np))
-	n = int(r0)
-	if r0 == -1 && er != nil {
-		err = er
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, p *byte, np int) (n int, err error) {
-	r0, er := C.write(C.int(fd), C.uintptr_t(uintptr(unsafe.Pointer(p))), C.size_t(np))
-	n = int(r0)
-	if r0 == -1 && er != nil {
-		err = er
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Dup2(oldfd int, newfd int) (err error) {
 	r0, er := C.dup2(C.int(oldfd), C.int(newfd))
 	if r0 == -1 && er != nil {
@@ -1454,16 +1440,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	r0, er := C.setrlimit64(C.int(resource), C.uintptr_t(uintptr(unsafe.Pointer(rlim))))
-	if r0 == -1 && er != nil {
-		err = er
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Seek(fd int, offset int64, whence int) (off int64, err error) {
 	r0, er := C.lseek64(C.int(fd), C.longlong(offset), C.int(whence))
 	off = int64(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
index a89b0bfa53c..99ee4399a3a 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build aix && ppc64
-// +build aix,ppc64
 
 package unix
 
@@ -93,8 +92,18 @@ func wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t,
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func ioctl(fd int, req uint, arg uintptr) (err error) {
-	_, e1 := callioctl(fd, int(req), arg)
+func ioctl(fd int, req int, arg uintptr) (err error) {
+	_, e1 := callioctl(fd, req, arg)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) {
+	_, e1 := callioctl_ptr(fd, req, arg)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -752,28 +761,6 @@ func write(fd int, p []byte) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, p *byte, np int) (n int, err error) {
-	r0, e1 := callread(fd, uintptr(unsafe.Pointer(p)), np)
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, p *byte, np int) (n int, err error) {
-	r0, e1 := callwrite(fd, uintptr(unsafe.Pointer(p)), np)
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Dup2(oldfd int, newfd int) (err error) {
 	_, e1 := calldup2(oldfd, newfd)
 	if e1 != 0 {
@@ -1412,16 +1399,6 @@ func Getrlimit(resource int, rlim *Rlimit) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, e1 := callsetrlimit(resource, uintptr(unsafe.Pointer(rlim)))
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Seek(fd int, offset int64, whence int) (off int64, err error) {
 	r0, e1 := calllseek(fd, offset, whence)
 	off = int64(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
index 2caa5adf950..b68a78362b2 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build aix && ppc64 && gc
-// +build aix,ppc64,gc
 
 package unix
 
@@ -124,7 +123,6 @@ import (
 //go:cgo_import_dynamic libc_getsystemcfg getsystemcfg "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_umount umount "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_getrlimit getrlimit "libc.a/shr_64.o"
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_lseek lseek "libc.a/shr_64.o"
 //go:cgo_import_dynamic libc_mmap64 mmap64 "libc.a/shr_64.o"
 
@@ -242,7 +240,6 @@ import (
 //go:linkname libc_getsystemcfg libc_getsystemcfg
 //go:linkname libc_umount libc_umount
 //go:linkname libc_getrlimit libc_getrlimit
-//go:linkname libc_setrlimit libc_setrlimit
 //go:linkname libc_lseek libc_lseek
 //go:linkname libc_mmap64 libc_mmap64
 
@@ -363,7 +360,6 @@ var (
 	libc_getsystemcfg,
 	libc_umount,
 	libc_getrlimit,
-	libc_setrlimit,
 	libc_lseek,
 	libc_mmap64 syscallFunc
 )
@@ -423,6 +419,13 @@ func callioctl(fd int, req int, arg uintptr) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callioctl_ptr(fd int, req int, arg unsafe.Pointer) (r1 uintptr, e1 Errno) {
+	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_ioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0)
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callfcntl(fd uintptr, cmd int, arg uintptr) (r1 uintptr, e1 Errno) {
 	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_fcntl)), 3, fd, uintptr(cmd), arg, 0, 0, 0)
 	return
@@ -1172,13 +1175,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
-	r1, _, e1 = rawSyscall6(uintptr(unsafe.Pointer(&libc_setrlimit)), 2, uintptr(resource), rlim, 0, 0, 0, 0)
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) {
 	r1, _, e1 = syscall6(uintptr(unsafe.Pointer(&libc_lseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0)
 	return
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
index 944a714b1ad..0a87450bf8e 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_aix_ppc64_gccgo.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build aix && ppc64 && gccgo
-// +build aix,ppc64,gccgo
 
 package unix
 
@@ -123,7 +122,6 @@ int utime(uintptr_t, uintptr_t);
 unsigned long long getsystemcfg(int);
 int umount(uintptr_t);
 int getrlimit(int, uintptr_t);
-int setrlimit(int, uintptr_t);
 long long lseek(int, long long, int);
 uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long);
 
@@ -131,6 +129,7 @@ uintptr_t mmap64(uintptr_t, uintptr_t, int, int, int, long long);
 import "C"
 import (
 	"syscall"
+	"unsafe"
 )
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
@@ -191,6 +190,14 @@ func callioctl(fd int, req int, arg uintptr) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func callioctl_ptr(fd int, req int, arg unsafe.Pointer) (r1 uintptr, e1 Errno) {
+	r1 = uintptr(C.ioctl(C.int(fd), C.int(req), C.uintptr_t(uintptr(arg))))
+	e1 = syscall.GetErrno()
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func callfcntl(fd uintptr, cmd int, arg uintptr) (r1 uintptr, e1 Errno) {
 	r1 = uintptr(C.fcntl(C.uintptr_t(fd), C.int(cmd), C.uintptr_t(arg)))
 	e1 = syscall.GetErrno()
@@ -1047,14 +1054,6 @@ func callgetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func callsetrlimit(resource int, rlim uintptr) (r1 uintptr, e1 Errno) {
-	r1 = uintptr(C.setrlimit(C.int(resource), C.uintptr_t(rlim)))
-	e1 = syscall.GetErrno()
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func calllseek(fd int, offset int64, whence int) (r1 uintptr, e1 Errno) {
 	r1 = uintptr(C.lseek(C.int(fd), C.longlong(offset), C.int(whence)))
 	e1 = syscall.GetErrno()
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go
index c2461c49679..ccb02f240a4 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build darwin && amd64
-// +build darwin,amd64
 
 package unix
 
@@ -731,6 +730,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1984,6 +1993,31 @@ var libc_select_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 unsafe.Pointer
+	if len(attrBuf) > 0 {
+		_p1 = unsafe.Pointer(&attrBuf[0])
+	} else {
+		_p1 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_setattrlist_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Setegid(egid int) (err error) {
 	_, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0)
 	if e1 != 0 {
@@ -2115,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0)
 	pid = int(r0)
@@ -2391,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Fstat(fd int, stat *Stat_t) (err error) {
 	_, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s
index 95fe4c0eb96..8b8bb284028 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s
@@ -5,900 +5,750 @@
 
 TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fdopendir(SB)
-
 GLOBL	·libc_fdopendir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB)
 
 TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getgroups(SB)
-
 GLOBL	·libc_getgroups_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB)
 
 TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setgroups(SB)
-
 GLOBL	·libc_setgroups_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB)
 
 TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_wait4(SB)
-
 GLOBL	·libc_wait4_trampoline_addr(SB), RODATA, $8
 DATA	·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB)
 
 TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_accept(SB)
-
 GLOBL	·libc_accept_trampoline_addr(SB), RODATA, $8
 DATA	·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB)
 
 TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_bind(SB)
-
 GLOBL	·libc_bind_trampoline_addr(SB), RODATA, $8
 DATA	·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB)
 
 TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_connect(SB)
-
 GLOBL	·libc_connect_trampoline_addr(SB), RODATA, $8
 DATA	·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB)
 
 TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_socket(SB)
-
 GLOBL	·libc_socket_trampoline_addr(SB), RODATA, $8
 DATA	·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB)
 
 TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsockopt(SB)
-
 GLOBL	·libc_getsockopt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB)
 
 TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setsockopt(SB)
-
 GLOBL	·libc_setsockopt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB)
 
 TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpeername(SB)
-
 GLOBL	·libc_getpeername_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB)
 
 TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsockname(SB)
-
 GLOBL	·libc_getsockname_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB)
 
 TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shutdown(SB)
-
 GLOBL	·libc_shutdown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB)
 
 TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_socketpair(SB)
-
 GLOBL	·libc_socketpair_trampoline_addr(SB), RODATA, $8
 DATA	·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB)
 
 TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_recvfrom(SB)
-
 GLOBL	·libc_recvfrom_trampoline_addr(SB), RODATA, $8
 DATA	·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB)
 
 TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendto(SB)
-
 GLOBL	·libc_sendto_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB)
 
 TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_recvmsg(SB)
-
 GLOBL	·libc_recvmsg_trampoline_addr(SB), RODATA, $8
 DATA	·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB)
 
 TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendmsg(SB)
-
 GLOBL	·libc_sendmsg_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB)
 
 TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kevent(SB)
-
 GLOBL	·libc_kevent_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB)
 
 TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimes(SB)
-
 GLOBL	·libc_utimes_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB)
 
 TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_futimes(SB)
-
 GLOBL	·libc_futimes_trampoline_addr(SB), RODATA, $8
 DATA	·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB)
 
 TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_poll(SB)
-
 GLOBL	·libc_poll_trampoline_addr(SB), RODATA, $8
 DATA	·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB)
 
 TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_madvise(SB)
-
 GLOBL	·libc_madvise_trampoline_addr(SB), RODATA, $8
 DATA	·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB)
 
 TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mlock(SB)
-
 GLOBL	·libc_mlock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB)
 
 TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mlockall(SB)
-
 GLOBL	·libc_mlockall_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB)
 
 TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mprotect(SB)
-
 GLOBL	·libc_mprotect_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB)
 
 TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_msync(SB)
-
 GLOBL	·libc_msync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB)
 
 TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munlock(SB)
-
 GLOBL	·libc_munlock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB)
 
 TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munlockall(SB)
-
 GLOBL	·libc_munlockall_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB)
 
 TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_closedir(SB)
-
 GLOBL	·libc_closedir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB)
 
 TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readdir_r(SB)
-
 GLOBL	·libc_readdir_r_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB)
 
 TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pipe(SB)
-
 GLOBL	·libc_pipe_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB)
 
 TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getxattr(SB)
-
 GLOBL	·libc_getxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB)
 
 TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fgetxattr(SB)
-
 GLOBL	·libc_fgetxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB)
 
 TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setxattr(SB)
-
 GLOBL	·libc_setxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB)
 
 TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fsetxattr(SB)
-
 GLOBL	·libc_fsetxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB)
 
 TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_removexattr(SB)
-
 GLOBL	·libc_removexattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB)
 
 TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fremovexattr(SB)
-
 GLOBL	·libc_fremovexattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB)
 
 TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_listxattr(SB)
-
 GLOBL	·libc_listxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB)
 
 TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_flistxattr(SB)
-
 GLOBL	·libc_flistxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB)
 
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
-
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
 
 TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fcntl(SB)
-
 GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
 
 TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kill(SB)
-
 GLOBL	·libc_kill_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB)
 
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
-
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB)
 
 TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sysctl(SB)
-
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
 TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendfile(SB)
-
 GLOBL	·libc_sendfile_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB)
 
 TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmat(SB)
-
 GLOBL	·libc_shmat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB)
 
 TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmctl(SB)
-
 GLOBL	·libc_shmctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB)
 
 TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmdt(SB)
-
 GLOBL	·libc_shmdt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB)
 
 TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmget(SB)
-
 GLOBL	·libc_shmget_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB)
 
 TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_access(SB)
-
 GLOBL	·libc_access_trampoline_addr(SB), RODATA, $8
 DATA	·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB)
 
 TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_adjtime(SB)
-
 GLOBL	·libc_adjtime_trampoline_addr(SB), RODATA, $8
 DATA	·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB)
 
 TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chdir(SB)
-
 GLOBL	·libc_chdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB)
 
 TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chflags(SB)
-
 GLOBL	·libc_chflags_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB)
 
 TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chmod(SB)
-
 GLOBL	·libc_chmod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB)
 
 TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chown(SB)
-
 GLOBL	·libc_chown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB)
 
 TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chroot(SB)
-
 GLOBL	·libc_chroot_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB)
 
 TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clock_gettime(SB)
-
 GLOBL	·libc_clock_gettime_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB)
 
 TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_close(SB)
-
 GLOBL	·libc_close_trampoline_addr(SB), RODATA, $8
 DATA	·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB)
 
 TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clonefile(SB)
-
 GLOBL	·libc_clonefile_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB)
 
 TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clonefileat(SB)
-
 GLOBL	·libc_clonefileat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB)
 
 TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_dup(SB)
-
 GLOBL	·libc_dup_trampoline_addr(SB), RODATA, $8
 DATA	·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB)
 
 TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_dup2(SB)
-
 GLOBL	·libc_dup2_trampoline_addr(SB), RODATA, $8
 DATA	·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB)
 
 TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_exchangedata(SB)
-
 GLOBL	·libc_exchangedata_trampoline_addr(SB), RODATA, $8
 DATA	·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB)
 
 TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_exit(SB)
-
 GLOBL	·libc_exit_trampoline_addr(SB), RODATA, $8
 DATA	·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB)
 
 TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_faccessat(SB)
-
 GLOBL	·libc_faccessat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB)
 
 TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchdir(SB)
-
 GLOBL	·libc_fchdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB)
 
 TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchflags(SB)
-
 GLOBL	·libc_fchflags_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB)
 
 TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchmod(SB)
-
 GLOBL	·libc_fchmod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB)
 
 TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchmodat(SB)
-
 GLOBL	·libc_fchmodat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB)
 
 TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchown(SB)
-
 GLOBL	·libc_fchown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB)
 
 TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchownat(SB)
-
 GLOBL	·libc_fchownat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB)
 
 TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fclonefileat(SB)
-
 GLOBL	·libc_fclonefileat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB)
 
 TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_flock(SB)
-
 GLOBL	·libc_flock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB)
 
 TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fpathconf(SB)
-
 GLOBL	·libc_fpathconf_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB)
 
 TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fsync(SB)
-
 GLOBL	·libc_fsync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB)
 
 TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ftruncate(SB)
-
 GLOBL	·libc_ftruncate_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB)
 
 TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getcwd(SB)
-
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
 TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getdtablesize(SB)
-
 GLOBL	·libc_getdtablesize_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB)
 
 TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getegid(SB)
-
 GLOBL	·libc_getegid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB)
 
 TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_geteuid(SB)
-
 GLOBL	·libc_geteuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB)
 
 TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getgid(SB)
-
 GLOBL	·libc_getgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB)
 
 TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpgid(SB)
-
 GLOBL	·libc_getpgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB)
 
 TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpgrp(SB)
-
 GLOBL	·libc_getpgrp_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB)
 
 TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpid(SB)
-
 GLOBL	·libc_getpid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB)
 
 TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getppid(SB)
-
 GLOBL	·libc_getppid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB)
 
 TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpriority(SB)
-
 GLOBL	·libc_getpriority_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB)
 
 TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getrlimit(SB)
-
 GLOBL	·libc_getrlimit_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB)
 
 TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getrusage(SB)
-
 GLOBL	·libc_getrusage_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB)
 
 TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsid(SB)
-
 GLOBL	·libc_getsid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB)
 
 TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_gettimeofday(SB)
-
 GLOBL	·libc_gettimeofday_trampoline_addr(SB), RODATA, $8
 DATA	·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB)
 
 TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getuid(SB)
-
 GLOBL	·libc_getuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB)
 
 TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_issetugid(SB)
-
 GLOBL	·libc_issetugid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB)
 
 TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kqueue(SB)
-
 GLOBL	·libc_kqueue_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB)
 
 TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lchown(SB)
-
 GLOBL	·libc_lchown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB)
 
 TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_link(SB)
-
 GLOBL	·libc_link_trampoline_addr(SB), RODATA, $8
 DATA	·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB)
 
 TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_linkat(SB)
-
 GLOBL	·libc_linkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB)
 
 TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_listen(SB)
-
 GLOBL	·libc_listen_trampoline_addr(SB), RODATA, $8
 DATA	·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB)
 
 TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkdir(SB)
-
 GLOBL	·libc_mkdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB)
 
 TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkdirat(SB)
-
 GLOBL	·libc_mkdirat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB)
 
 TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkfifo(SB)
-
 GLOBL	·libc_mkfifo_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB)
 
 TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mknod(SB)
-
 GLOBL	·libc_mknod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB)
 
 TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mount(SB)
-
 GLOBL	·libc_mount_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB)
 
 TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_open(SB)
-
 GLOBL	·libc_open_trampoline_addr(SB), RODATA, $8
 DATA	·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB)
 
 TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_openat(SB)
-
 GLOBL	·libc_openat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB)
 
 TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pathconf(SB)
-
 GLOBL	·libc_pathconf_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB)
 
 TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pread(SB)
-
 GLOBL	·libc_pread_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB)
 
 TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pwrite(SB)
-
 GLOBL	·libc_pwrite_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB)
 
 TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_read(SB)
-
 GLOBL	·libc_read_trampoline_addr(SB), RODATA, $8
 DATA	·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB)
 
 TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readlink(SB)
-
 GLOBL	·libc_readlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB)
 
 TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readlinkat(SB)
-
 GLOBL	·libc_readlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB)
 
 TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_rename(SB)
-
 GLOBL	·libc_rename_trampoline_addr(SB), RODATA, $8
 DATA	·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB)
 
 TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_renameat(SB)
-
 GLOBL	·libc_renameat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB)
 
 TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_revoke(SB)
-
 GLOBL	·libc_revoke_trampoline_addr(SB), RODATA, $8
 DATA	·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB)
 
 TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_rmdir(SB)
-
 GLOBL	·libc_rmdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB)
 
 TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lseek(SB)
-
 GLOBL	·libc_lseek_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB)
 
 TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_select(SB)
-
 GLOBL	·libc_select_trampoline_addr(SB), RODATA, $8
 DATA	·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB)
 
+TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_setattrlist(SB)
+GLOBL	·libc_setattrlist_trampoline_addr(SB), RODATA, $8
+DATA	·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB)
+
 TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setegid(SB)
-
 GLOBL	·libc_setegid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB)
 
 TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_seteuid(SB)
-
 GLOBL	·libc_seteuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB)
 
 TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setgid(SB)
-
 GLOBL	·libc_setgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB)
 
 TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setlogin(SB)
-
 GLOBL	·libc_setlogin_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB)
 
 TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setpgid(SB)
-
 GLOBL	·libc_setpgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB)
 
 TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setpriority(SB)
-
 GLOBL	·libc_setpriority_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB)
 
 TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setprivexec(SB)
-
 GLOBL	·libc_setprivexec_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB)
 
 TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setregid(SB)
-
 GLOBL	·libc_setregid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB)
 
 TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setreuid(SB)
-
 GLOBL	·libc_setreuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setsid(SB)
-
 GLOBL	·libc_setsid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB)
 
 TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_settimeofday(SB)
-
 GLOBL	·libc_settimeofday_trampoline_addr(SB), RODATA, $8
 DATA	·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB)
 
 TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setuid(SB)
-
 GLOBL	·libc_setuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB)
 
 TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_symlink(SB)
-
 GLOBL	·libc_symlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB)
 
 TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_symlinkat(SB)
-
 GLOBL	·libc_symlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB)
 
 TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sync(SB)
-
 GLOBL	·libc_sync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB)
 
 TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_truncate(SB)
-
 GLOBL	·libc_truncate_trampoline_addr(SB), RODATA, $8
 DATA	·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB)
 
 TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_umask(SB)
-
 GLOBL	·libc_umask_trampoline_addr(SB), RODATA, $8
 DATA	·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB)
 
 TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_undelete(SB)
-
 GLOBL	·libc_undelete_trampoline_addr(SB), RODATA, $8
 DATA	·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB)
 
 TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unlink(SB)
-
 GLOBL	·libc_unlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB)
 
 TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unlinkat(SB)
-
 GLOBL	·libc_unlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB)
 
 TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unmount(SB)
-
 GLOBL	·libc_unmount_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB)
 
 TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_write(SB)
-
 GLOBL	·libc_write_trampoline_addr(SB), RODATA, $8
 DATA	·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB)
 
 TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mmap(SB)
-
 GLOBL	·libc_mmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB)
 
 TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munmap(SB)
-
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
 TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstat64(SB)
-
 GLOBL	·libc_fstat64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstat64_trampoline_addr(SB)/8, $libc_fstat64_trampoline<>(SB)
 
 TEXT libc_fstatat64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstatat64(SB)
-
 GLOBL	·libc_fstatat64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstatat64_trampoline_addr(SB)/8, $libc_fstatat64_trampoline<>(SB)
 
 TEXT libc_fstatfs64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstatfs64(SB)
-
 GLOBL	·libc_fstatfs64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstatfs64_trampoline_addr(SB)/8, $libc_fstatfs64_trampoline<>(SB)
 
 TEXT libc_getfsstat64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getfsstat64(SB)
-
 GLOBL	·libc_getfsstat64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getfsstat64_trampoline_addr(SB)/8, $libc_getfsstat64_trampoline<>(SB)
 
 TEXT libc_lstat64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lstat64(SB)
-
 GLOBL	·libc_lstat64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lstat64_trampoline_addr(SB)/8, $libc_lstat64_trampoline<>(SB)
 
 TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ptrace(SB)
-
 GLOBL	·libc_ptrace_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB)
 
 TEXT libc_stat64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_stat64(SB)
-
 GLOBL	·libc_stat64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_stat64_trampoline_addr(SB)/8, $libc_stat64_trampoline<>(SB)
 
 TEXT libc_statfs64_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_statfs64(SB)
-
 GLOBL	·libc_statfs64_trampoline_addr(SB), RODATA, $8
 DATA	·libc_statfs64_trampoline_addr(SB)/8, $libc_statfs64_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go
index 26a0fdc505b..1b40b997b52 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build darwin && arm64
-// +build darwin,arm64
 
 package unix
 
@@ -731,6 +730,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1984,6 +1993,31 @@ var libc_select_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func Setattrlist(path string, attrlist *Attrlist, attrBuf []byte, options int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	var _p1 unsafe.Pointer
+	if len(attrBuf) > 0 {
+		_p1 = unsafe.Pointer(&attrBuf[0])
+	} else {
+		_p1 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := syscall_syscall6(libc_setattrlist_trampoline_addr, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(attrlist)), uintptr(_p1), uintptr(len(attrBuf)), uintptr(options), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_setattrlist_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_setattrlist setattrlist "/usr/lib/libSystem.B.dylib"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Setegid(egid int) (err error) {
 	_, _, e1 := syscall_syscall(libc_setegid_trampoline_addr, uintptr(egid), 0, 0)
 	if e1 != 0 {
@@ -2115,20 +2149,6 @@ var libc_setreuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "/usr/lib/libSystem.B.dylib"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := syscall_rawSyscall(libc_setsid_trampoline_addr, 0, 0, 0)
 	pid = int(r0)
@@ -2391,28 +2411,6 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Fstat(fd int, stat *Stat_t) (err error) {
 	_, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s
index efa5b4c987c..08362c1ab74 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s
@@ -5,900 +5,750 @@
 
 TEXT libc_fdopendir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fdopendir(SB)
-
 GLOBL	·libc_fdopendir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fdopendir_trampoline_addr(SB)/8, $libc_fdopendir_trampoline<>(SB)
 
 TEXT libc_getgroups_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getgroups(SB)
-
 GLOBL	·libc_getgroups_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getgroups_trampoline_addr(SB)/8, $libc_getgroups_trampoline<>(SB)
 
 TEXT libc_setgroups_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setgroups(SB)
-
 GLOBL	·libc_setgroups_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setgroups_trampoline_addr(SB)/8, $libc_setgroups_trampoline<>(SB)
 
 TEXT libc_wait4_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_wait4(SB)
-
 GLOBL	·libc_wait4_trampoline_addr(SB), RODATA, $8
 DATA	·libc_wait4_trampoline_addr(SB)/8, $libc_wait4_trampoline<>(SB)
 
 TEXT libc_accept_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_accept(SB)
-
 GLOBL	·libc_accept_trampoline_addr(SB), RODATA, $8
 DATA	·libc_accept_trampoline_addr(SB)/8, $libc_accept_trampoline<>(SB)
 
 TEXT libc_bind_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_bind(SB)
-
 GLOBL	·libc_bind_trampoline_addr(SB), RODATA, $8
 DATA	·libc_bind_trampoline_addr(SB)/8, $libc_bind_trampoline<>(SB)
 
 TEXT libc_connect_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_connect(SB)
-
 GLOBL	·libc_connect_trampoline_addr(SB), RODATA, $8
 DATA	·libc_connect_trampoline_addr(SB)/8, $libc_connect_trampoline<>(SB)
 
 TEXT libc_socket_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_socket(SB)
-
 GLOBL	·libc_socket_trampoline_addr(SB), RODATA, $8
 DATA	·libc_socket_trampoline_addr(SB)/8, $libc_socket_trampoline<>(SB)
 
 TEXT libc_getsockopt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsockopt(SB)
-
 GLOBL	·libc_getsockopt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsockopt_trampoline_addr(SB)/8, $libc_getsockopt_trampoline<>(SB)
 
 TEXT libc_setsockopt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setsockopt(SB)
-
 GLOBL	·libc_setsockopt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setsockopt_trampoline_addr(SB)/8, $libc_setsockopt_trampoline<>(SB)
 
 TEXT libc_getpeername_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpeername(SB)
-
 GLOBL	·libc_getpeername_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpeername_trampoline_addr(SB)/8, $libc_getpeername_trampoline<>(SB)
 
 TEXT libc_getsockname_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsockname(SB)
-
 GLOBL	·libc_getsockname_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsockname_trampoline_addr(SB)/8, $libc_getsockname_trampoline<>(SB)
 
 TEXT libc_shutdown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shutdown(SB)
-
 GLOBL	·libc_shutdown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shutdown_trampoline_addr(SB)/8, $libc_shutdown_trampoline<>(SB)
 
 TEXT libc_socketpair_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_socketpair(SB)
-
 GLOBL	·libc_socketpair_trampoline_addr(SB), RODATA, $8
 DATA	·libc_socketpair_trampoline_addr(SB)/8, $libc_socketpair_trampoline<>(SB)
 
 TEXT libc_recvfrom_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_recvfrom(SB)
-
 GLOBL	·libc_recvfrom_trampoline_addr(SB), RODATA, $8
 DATA	·libc_recvfrom_trampoline_addr(SB)/8, $libc_recvfrom_trampoline<>(SB)
 
 TEXT libc_sendto_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendto(SB)
-
 GLOBL	·libc_sendto_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendto_trampoline_addr(SB)/8, $libc_sendto_trampoline<>(SB)
 
 TEXT libc_recvmsg_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_recvmsg(SB)
-
 GLOBL	·libc_recvmsg_trampoline_addr(SB), RODATA, $8
 DATA	·libc_recvmsg_trampoline_addr(SB)/8, $libc_recvmsg_trampoline<>(SB)
 
 TEXT libc_sendmsg_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendmsg(SB)
-
 GLOBL	·libc_sendmsg_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendmsg_trampoline_addr(SB)/8, $libc_sendmsg_trampoline<>(SB)
 
 TEXT libc_kevent_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kevent(SB)
-
 GLOBL	·libc_kevent_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kevent_trampoline_addr(SB)/8, $libc_kevent_trampoline<>(SB)
 
 TEXT libc_utimes_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimes(SB)
-
 GLOBL	·libc_utimes_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimes_trampoline_addr(SB)/8, $libc_utimes_trampoline<>(SB)
 
 TEXT libc_futimes_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_futimes(SB)
-
 GLOBL	·libc_futimes_trampoline_addr(SB), RODATA, $8
 DATA	·libc_futimes_trampoline_addr(SB)/8, $libc_futimes_trampoline<>(SB)
 
 TEXT libc_poll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_poll(SB)
-
 GLOBL	·libc_poll_trampoline_addr(SB), RODATA, $8
 DATA	·libc_poll_trampoline_addr(SB)/8, $libc_poll_trampoline<>(SB)
 
 TEXT libc_madvise_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_madvise(SB)
-
 GLOBL	·libc_madvise_trampoline_addr(SB), RODATA, $8
 DATA	·libc_madvise_trampoline_addr(SB)/8, $libc_madvise_trampoline<>(SB)
 
 TEXT libc_mlock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mlock(SB)
-
 GLOBL	·libc_mlock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mlock_trampoline_addr(SB)/8, $libc_mlock_trampoline<>(SB)
 
 TEXT libc_mlockall_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mlockall(SB)
-
 GLOBL	·libc_mlockall_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mlockall_trampoline_addr(SB)/8, $libc_mlockall_trampoline<>(SB)
 
 TEXT libc_mprotect_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mprotect(SB)
-
 GLOBL	·libc_mprotect_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mprotect_trampoline_addr(SB)/8, $libc_mprotect_trampoline<>(SB)
 
 TEXT libc_msync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_msync(SB)
-
 GLOBL	·libc_msync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_msync_trampoline_addr(SB)/8, $libc_msync_trampoline<>(SB)
 
 TEXT libc_munlock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munlock(SB)
-
 GLOBL	·libc_munlock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munlock_trampoline_addr(SB)/8, $libc_munlock_trampoline<>(SB)
 
 TEXT libc_munlockall_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munlockall(SB)
-
 GLOBL	·libc_munlockall_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munlockall_trampoline_addr(SB)/8, $libc_munlockall_trampoline<>(SB)
 
 TEXT libc_closedir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_closedir(SB)
-
 GLOBL	·libc_closedir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_closedir_trampoline_addr(SB)/8, $libc_closedir_trampoline<>(SB)
 
 TEXT libc_readdir_r_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readdir_r(SB)
-
 GLOBL	·libc_readdir_r_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readdir_r_trampoline_addr(SB)/8, $libc_readdir_r_trampoline<>(SB)
 
 TEXT libc_pipe_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pipe(SB)
-
 GLOBL	·libc_pipe_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pipe_trampoline_addr(SB)/8, $libc_pipe_trampoline<>(SB)
 
 TEXT libc_getxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getxattr(SB)
-
 GLOBL	·libc_getxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getxattr_trampoline_addr(SB)/8, $libc_getxattr_trampoline<>(SB)
 
 TEXT libc_fgetxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fgetxattr(SB)
-
 GLOBL	·libc_fgetxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fgetxattr_trampoline_addr(SB)/8, $libc_fgetxattr_trampoline<>(SB)
 
 TEXT libc_setxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setxattr(SB)
-
 GLOBL	·libc_setxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setxattr_trampoline_addr(SB)/8, $libc_setxattr_trampoline<>(SB)
 
 TEXT libc_fsetxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fsetxattr(SB)
-
 GLOBL	·libc_fsetxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fsetxattr_trampoline_addr(SB)/8, $libc_fsetxattr_trampoline<>(SB)
 
 TEXT libc_removexattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_removexattr(SB)
-
 GLOBL	·libc_removexattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_removexattr_trampoline_addr(SB)/8, $libc_removexattr_trampoline<>(SB)
 
 TEXT libc_fremovexattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fremovexattr(SB)
-
 GLOBL	·libc_fremovexattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fremovexattr_trampoline_addr(SB)/8, $libc_fremovexattr_trampoline<>(SB)
 
 TEXT libc_listxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_listxattr(SB)
-
 GLOBL	·libc_listxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_listxattr_trampoline_addr(SB)/8, $libc_listxattr_trampoline<>(SB)
 
 TEXT libc_flistxattr_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_flistxattr(SB)
-
 GLOBL	·libc_flistxattr_trampoline_addr(SB), RODATA, $8
 DATA	·libc_flistxattr_trampoline_addr(SB)/8, $libc_flistxattr_trampoline<>(SB)
 
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
-
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
 
 TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fcntl(SB)
-
 GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
 
 TEXT libc_kill_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kill(SB)
-
 GLOBL	·libc_kill_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kill_trampoline_addr(SB)/8, $libc_kill_trampoline<>(SB)
 
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
-
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ioctl_trampoline_addr(SB)/8, $libc_ioctl_trampoline<>(SB)
 
 TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sysctl(SB)
-
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
 TEXT libc_sendfile_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sendfile(SB)
-
 GLOBL	·libc_sendfile_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sendfile_trampoline_addr(SB)/8, $libc_sendfile_trampoline<>(SB)
 
 TEXT libc_shmat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmat(SB)
-
 GLOBL	·libc_shmat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmat_trampoline_addr(SB)/8, $libc_shmat_trampoline<>(SB)
 
 TEXT libc_shmctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmctl(SB)
-
 GLOBL	·libc_shmctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmctl_trampoline_addr(SB)/8, $libc_shmctl_trampoline<>(SB)
 
 TEXT libc_shmdt_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmdt(SB)
-
 GLOBL	·libc_shmdt_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmdt_trampoline_addr(SB)/8, $libc_shmdt_trampoline<>(SB)
 
 TEXT libc_shmget_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_shmget(SB)
-
 GLOBL	·libc_shmget_trampoline_addr(SB), RODATA, $8
 DATA	·libc_shmget_trampoline_addr(SB)/8, $libc_shmget_trampoline<>(SB)
 
 TEXT libc_access_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_access(SB)
-
 GLOBL	·libc_access_trampoline_addr(SB), RODATA, $8
 DATA	·libc_access_trampoline_addr(SB)/8, $libc_access_trampoline<>(SB)
 
 TEXT libc_adjtime_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_adjtime(SB)
-
 GLOBL	·libc_adjtime_trampoline_addr(SB), RODATA, $8
 DATA	·libc_adjtime_trampoline_addr(SB)/8, $libc_adjtime_trampoline<>(SB)
 
 TEXT libc_chdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chdir(SB)
-
 GLOBL	·libc_chdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chdir_trampoline_addr(SB)/8, $libc_chdir_trampoline<>(SB)
 
 TEXT libc_chflags_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chflags(SB)
-
 GLOBL	·libc_chflags_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chflags_trampoline_addr(SB)/8, $libc_chflags_trampoline<>(SB)
 
 TEXT libc_chmod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chmod(SB)
-
 GLOBL	·libc_chmod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chmod_trampoline_addr(SB)/8, $libc_chmod_trampoline<>(SB)
 
 TEXT libc_chown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chown(SB)
-
 GLOBL	·libc_chown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chown_trampoline_addr(SB)/8, $libc_chown_trampoline<>(SB)
 
 TEXT libc_chroot_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_chroot(SB)
-
 GLOBL	·libc_chroot_trampoline_addr(SB), RODATA, $8
 DATA	·libc_chroot_trampoline_addr(SB)/8, $libc_chroot_trampoline<>(SB)
 
 TEXT libc_clock_gettime_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clock_gettime(SB)
-
 GLOBL	·libc_clock_gettime_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clock_gettime_trampoline_addr(SB)/8, $libc_clock_gettime_trampoline<>(SB)
 
 TEXT libc_close_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_close(SB)
-
 GLOBL	·libc_close_trampoline_addr(SB), RODATA, $8
 DATA	·libc_close_trampoline_addr(SB)/8, $libc_close_trampoline<>(SB)
 
 TEXT libc_clonefile_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clonefile(SB)
-
 GLOBL	·libc_clonefile_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clonefile_trampoline_addr(SB)/8, $libc_clonefile_trampoline<>(SB)
 
 TEXT libc_clonefileat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_clonefileat(SB)
-
 GLOBL	·libc_clonefileat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_clonefileat_trampoline_addr(SB)/8, $libc_clonefileat_trampoline<>(SB)
 
 TEXT libc_dup_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_dup(SB)
-
 GLOBL	·libc_dup_trampoline_addr(SB), RODATA, $8
 DATA	·libc_dup_trampoline_addr(SB)/8, $libc_dup_trampoline<>(SB)
 
 TEXT libc_dup2_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_dup2(SB)
-
 GLOBL	·libc_dup2_trampoline_addr(SB), RODATA, $8
 DATA	·libc_dup2_trampoline_addr(SB)/8, $libc_dup2_trampoline<>(SB)
 
 TEXT libc_exchangedata_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_exchangedata(SB)
-
 GLOBL	·libc_exchangedata_trampoline_addr(SB), RODATA, $8
 DATA	·libc_exchangedata_trampoline_addr(SB)/8, $libc_exchangedata_trampoline<>(SB)
 
 TEXT libc_exit_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_exit(SB)
-
 GLOBL	·libc_exit_trampoline_addr(SB), RODATA, $8
 DATA	·libc_exit_trampoline_addr(SB)/8, $libc_exit_trampoline<>(SB)
 
 TEXT libc_faccessat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_faccessat(SB)
-
 GLOBL	·libc_faccessat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_faccessat_trampoline_addr(SB)/8, $libc_faccessat_trampoline<>(SB)
 
 TEXT libc_fchdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchdir(SB)
-
 GLOBL	·libc_fchdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchdir_trampoline_addr(SB)/8, $libc_fchdir_trampoline<>(SB)
 
 TEXT libc_fchflags_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchflags(SB)
-
 GLOBL	·libc_fchflags_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchflags_trampoline_addr(SB)/8, $libc_fchflags_trampoline<>(SB)
 
 TEXT libc_fchmod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchmod(SB)
-
 GLOBL	·libc_fchmod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchmod_trampoline_addr(SB)/8, $libc_fchmod_trampoline<>(SB)
 
 TEXT libc_fchmodat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchmodat(SB)
-
 GLOBL	·libc_fchmodat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchmodat_trampoline_addr(SB)/8, $libc_fchmodat_trampoline<>(SB)
 
 TEXT libc_fchown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchown(SB)
-
 GLOBL	·libc_fchown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchown_trampoline_addr(SB)/8, $libc_fchown_trampoline<>(SB)
 
 TEXT libc_fchownat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fchownat(SB)
-
 GLOBL	·libc_fchownat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fchownat_trampoline_addr(SB)/8, $libc_fchownat_trampoline<>(SB)
 
 TEXT libc_fclonefileat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fclonefileat(SB)
-
 GLOBL	·libc_fclonefileat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fclonefileat_trampoline_addr(SB)/8, $libc_fclonefileat_trampoline<>(SB)
 
 TEXT libc_flock_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_flock(SB)
-
 GLOBL	·libc_flock_trampoline_addr(SB), RODATA, $8
 DATA	·libc_flock_trampoline_addr(SB)/8, $libc_flock_trampoline<>(SB)
 
 TEXT libc_fpathconf_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fpathconf(SB)
-
 GLOBL	·libc_fpathconf_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fpathconf_trampoline_addr(SB)/8, $libc_fpathconf_trampoline<>(SB)
 
 TEXT libc_fsync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fsync(SB)
-
 GLOBL	·libc_fsync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fsync_trampoline_addr(SB)/8, $libc_fsync_trampoline<>(SB)
 
 TEXT libc_ftruncate_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ftruncate(SB)
-
 GLOBL	·libc_ftruncate_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ftruncate_trampoline_addr(SB)/8, $libc_ftruncate_trampoline<>(SB)
 
 TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getcwd(SB)
-
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
 TEXT libc_getdtablesize_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getdtablesize(SB)
-
 GLOBL	·libc_getdtablesize_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getdtablesize_trampoline_addr(SB)/8, $libc_getdtablesize_trampoline<>(SB)
 
 TEXT libc_getegid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getegid(SB)
-
 GLOBL	·libc_getegid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getegid_trampoline_addr(SB)/8, $libc_getegid_trampoline<>(SB)
 
 TEXT libc_geteuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_geteuid(SB)
-
 GLOBL	·libc_geteuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_geteuid_trampoline_addr(SB)/8, $libc_geteuid_trampoline<>(SB)
 
 TEXT libc_getgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getgid(SB)
-
 GLOBL	·libc_getgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getgid_trampoline_addr(SB)/8, $libc_getgid_trampoline<>(SB)
 
 TEXT libc_getpgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpgid(SB)
-
 GLOBL	·libc_getpgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpgid_trampoline_addr(SB)/8, $libc_getpgid_trampoline<>(SB)
 
 TEXT libc_getpgrp_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpgrp(SB)
-
 GLOBL	·libc_getpgrp_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpgrp_trampoline_addr(SB)/8, $libc_getpgrp_trampoline<>(SB)
 
 TEXT libc_getpid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpid(SB)
-
 GLOBL	·libc_getpid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpid_trampoline_addr(SB)/8, $libc_getpid_trampoline<>(SB)
 
 TEXT libc_getppid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getppid(SB)
-
 GLOBL	·libc_getppid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getppid_trampoline_addr(SB)/8, $libc_getppid_trampoline<>(SB)
 
 TEXT libc_getpriority_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getpriority(SB)
-
 GLOBL	·libc_getpriority_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getpriority_trampoline_addr(SB)/8, $libc_getpriority_trampoline<>(SB)
 
 TEXT libc_getrlimit_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getrlimit(SB)
-
 GLOBL	·libc_getrlimit_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getrlimit_trampoline_addr(SB)/8, $libc_getrlimit_trampoline<>(SB)
 
 TEXT libc_getrusage_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getrusage(SB)
-
 GLOBL	·libc_getrusage_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getrusage_trampoline_addr(SB)/8, $libc_getrusage_trampoline<>(SB)
 
 TEXT libc_getsid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getsid(SB)
-
 GLOBL	·libc_getsid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getsid_trampoline_addr(SB)/8, $libc_getsid_trampoline<>(SB)
 
 TEXT libc_gettimeofday_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_gettimeofday(SB)
-
 GLOBL	·libc_gettimeofday_trampoline_addr(SB), RODATA, $8
 DATA	·libc_gettimeofday_trampoline_addr(SB)/8, $libc_gettimeofday_trampoline<>(SB)
 
 TEXT libc_getuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getuid(SB)
-
 GLOBL	·libc_getuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getuid_trampoline_addr(SB)/8, $libc_getuid_trampoline<>(SB)
 
 TEXT libc_issetugid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_issetugid(SB)
-
 GLOBL	·libc_issetugid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_issetugid_trampoline_addr(SB)/8, $libc_issetugid_trampoline<>(SB)
 
 TEXT libc_kqueue_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_kqueue(SB)
-
 GLOBL	·libc_kqueue_trampoline_addr(SB), RODATA, $8
 DATA	·libc_kqueue_trampoline_addr(SB)/8, $libc_kqueue_trampoline<>(SB)
 
 TEXT libc_lchown_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lchown(SB)
-
 GLOBL	·libc_lchown_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lchown_trampoline_addr(SB)/8, $libc_lchown_trampoline<>(SB)
 
 TEXT libc_link_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_link(SB)
-
 GLOBL	·libc_link_trampoline_addr(SB), RODATA, $8
 DATA	·libc_link_trampoline_addr(SB)/8, $libc_link_trampoline<>(SB)
 
 TEXT libc_linkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_linkat(SB)
-
 GLOBL	·libc_linkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_linkat_trampoline_addr(SB)/8, $libc_linkat_trampoline<>(SB)
 
 TEXT libc_listen_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_listen(SB)
-
 GLOBL	·libc_listen_trampoline_addr(SB), RODATA, $8
 DATA	·libc_listen_trampoline_addr(SB)/8, $libc_listen_trampoline<>(SB)
 
 TEXT libc_mkdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkdir(SB)
-
 GLOBL	·libc_mkdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkdir_trampoline_addr(SB)/8, $libc_mkdir_trampoline<>(SB)
 
 TEXT libc_mkdirat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkdirat(SB)
-
 GLOBL	·libc_mkdirat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkdirat_trampoline_addr(SB)/8, $libc_mkdirat_trampoline<>(SB)
 
 TEXT libc_mkfifo_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mkfifo(SB)
-
 GLOBL	·libc_mkfifo_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mkfifo_trampoline_addr(SB)/8, $libc_mkfifo_trampoline<>(SB)
 
 TEXT libc_mknod_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mknod(SB)
-
 GLOBL	·libc_mknod_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mknod_trampoline_addr(SB)/8, $libc_mknod_trampoline<>(SB)
 
 TEXT libc_mount_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mount(SB)
-
 GLOBL	·libc_mount_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mount_trampoline_addr(SB)/8, $libc_mount_trampoline<>(SB)
 
 TEXT libc_open_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_open(SB)
-
 GLOBL	·libc_open_trampoline_addr(SB), RODATA, $8
 DATA	·libc_open_trampoline_addr(SB)/8, $libc_open_trampoline<>(SB)
 
 TEXT libc_openat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_openat(SB)
-
 GLOBL	·libc_openat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_openat_trampoline_addr(SB)/8, $libc_openat_trampoline<>(SB)
 
 TEXT libc_pathconf_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pathconf(SB)
-
 GLOBL	·libc_pathconf_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pathconf_trampoline_addr(SB)/8, $libc_pathconf_trampoline<>(SB)
 
 TEXT libc_pread_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pread(SB)
-
 GLOBL	·libc_pread_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pread_trampoline_addr(SB)/8, $libc_pread_trampoline<>(SB)
 
 TEXT libc_pwrite_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_pwrite(SB)
-
 GLOBL	·libc_pwrite_trampoline_addr(SB), RODATA, $8
 DATA	·libc_pwrite_trampoline_addr(SB)/8, $libc_pwrite_trampoline<>(SB)
 
 TEXT libc_read_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_read(SB)
-
 GLOBL	·libc_read_trampoline_addr(SB), RODATA, $8
 DATA	·libc_read_trampoline_addr(SB)/8, $libc_read_trampoline<>(SB)
 
 TEXT libc_readlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readlink(SB)
-
 GLOBL	·libc_readlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readlink_trampoline_addr(SB)/8, $libc_readlink_trampoline<>(SB)
 
 TEXT libc_readlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_readlinkat(SB)
-
 GLOBL	·libc_readlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_readlinkat_trampoline_addr(SB)/8, $libc_readlinkat_trampoline<>(SB)
 
 TEXT libc_rename_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_rename(SB)
-
 GLOBL	·libc_rename_trampoline_addr(SB), RODATA, $8
 DATA	·libc_rename_trampoline_addr(SB)/8, $libc_rename_trampoline<>(SB)
 
 TEXT libc_renameat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_renameat(SB)
-
 GLOBL	·libc_renameat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_renameat_trampoline_addr(SB)/8, $libc_renameat_trampoline<>(SB)
 
 TEXT libc_revoke_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_revoke(SB)
-
 GLOBL	·libc_revoke_trampoline_addr(SB), RODATA, $8
 DATA	·libc_revoke_trampoline_addr(SB)/8, $libc_revoke_trampoline<>(SB)
 
 TEXT libc_rmdir_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_rmdir(SB)
-
 GLOBL	·libc_rmdir_trampoline_addr(SB), RODATA, $8
 DATA	·libc_rmdir_trampoline_addr(SB)/8, $libc_rmdir_trampoline<>(SB)
 
 TEXT libc_lseek_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lseek(SB)
-
 GLOBL	·libc_lseek_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lseek_trampoline_addr(SB)/8, $libc_lseek_trampoline<>(SB)
 
 TEXT libc_select_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_select(SB)
-
 GLOBL	·libc_select_trampoline_addr(SB), RODATA, $8
 DATA	·libc_select_trampoline_addr(SB)/8, $libc_select_trampoline<>(SB)
 
+TEXT libc_setattrlist_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_setattrlist(SB)
+GLOBL	·libc_setattrlist_trampoline_addr(SB), RODATA, $8
+DATA	·libc_setattrlist_trampoline_addr(SB)/8, $libc_setattrlist_trampoline<>(SB)
+
 TEXT libc_setegid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setegid(SB)
-
 GLOBL	·libc_setegid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setegid_trampoline_addr(SB)/8, $libc_setegid_trampoline<>(SB)
 
 TEXT libc_seteuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_seteuid(SB)
-
 GLOBL	·libc_seteuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_seteuid_trampoline_addr(SB)/8, $libc_seteuid_trampoline<>(SB)
 
 TEXT libc_setgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setgid(SB)
-
 GLOBL	·libc_setgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setgid_trampoline_addr(SB)/8, $libc_setgid_trampoline<>(SB)
 
 TEXT libc_setlogin_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setlogin(SB)
-
 GLOBL	·libc_setlogin_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setlogin_trampoline_addr(SB)/8, $libc_setlogin_trampoline<>(SB)
 
 TEXT libc_setpgid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setpgid(SB)
-
 GLOBL	·libc_setpgid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setpgid_trampoline_addr(SB)/8, $libc_setpgid_trampoline<>(SB)
 
 TEXT libc_setpriority_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setpriority(SB)
-
 GLOBL	·libc_setpriority_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setpriority_trampoline_addr(SB)/8, $libc_setpriority_trampoline<>(SB)
 
 TEXT libc_setprivexec_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setprivexec(SB)
-
 GLOBL	·libc_setprivexec_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setprivexec_trampoline_addr(SB)/8, $libc_setprivexec_trampoline<>(SB)
 
 TEXT libc_setregid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setregid(SB)
-
 GLOBL	·libc_setregid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setregid_trampoline_addr(SB)/8, $libc_setregid_trampoline<>(SB)
 
 TEXT libc_setreuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setreuid(SB)
-
 GLOBL	·libc_setreuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setreuid_trampoline_addr(SB)/8, $libc_setreuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setsid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setsid(SB)
-
 GLOBL	·libc_setsid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setsid_trampoline_addr(SB)/8, $libc_setsid_trampoline<>(SB)
 
 TEXT libc_settimeofday_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_settimeofday(SB)
-
 GLOBL	·libc_settimeofday_trampoline_addr(SB), RODATA, $8
 DATA	·libc_settimeofday_trampoline_addr(SB)/8, $libc_settimeofday_trampoline<>(SB)
 
 TEXT libc_setuid_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setuid(SB)
-
 GLOBL	·libc_setuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setuid_trampoline_addr(SB)/8, $libc_setuid_trampoline<>(SB)
 
 TEXT libc_symlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_symlink(SB)
-
 GLOBL	·libc_symlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_symlink_trampoline_addr(SB)/8, $libc_symlink_trampoline<>(SB)
 
 TEXT libc_symlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_symlinkat(SB)
-
 GLOBL	·libc_symlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_symlinkat_trampoline_addr(SB)/8, $libc_symlinkat_trampoline<>(SB)
 
 TEXT libc_sync_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_sync(SB)
-
 GLOBL	·libc_sync_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sync_trampoline_addr(SB)/8, $libc_sync_trampoline<>(SB)
 
 TEXT libc_truncate_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_truncate(SB)
-
 GLOBL	·libc_truncate_trampoline_addr(SB), RODATA, $8
 DATA	·libc_truncate_trampoline_addr(SB)/8, $libc_truncate_trampoline<>(SB)
 
 TEXT libc_umask_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_umask(SB)
-
 GLOBL	·libc_umask_trampoline_addr(SB), RODATA, $8
 DATA	·libc_umask_trampoline_addr(SB)/8, $libc_umask_trampoline<>(SB)
 
 TEXT libc_undelete_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_undelete(SB)
-
 GLOBL	·libc_undelete_trampoline_addr(SB), RODATA, $8
 DATA	·libc_undelete_trampoline_addr(SB)/8, $libc_undelete_trampoline<>(SB)
 
 TEXT libc_unlink_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unlink(SB)
-
 GLOBL	·libc_unlink_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unlink_trampoline_addr(SB)/8, $libc_unlink_trampoline<>(SB)
 
 TEXT libc_unlinkat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unlinkat(SB)
-
 GLOBL	·libc_unlinkat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unlinkat_trampoline_addr(SB)/8, $libc_unlinkat_trampoline<>(SB)
 
 TEXT libc_unmount_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_unmount(SB)
-
 GLOBL	·libc_unmount_trampoline_addr(SB), RODATA, $8
 DATA	·libc_unmount_trampoline_addr(SB)/8, $libc_unmount_trampoline<>(SB)
 
 TEXT libc_write_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_write(SB)
-
 GLOBL	·libc_write_trampoline_addr(SB), RODATA, $8
 DATA	·libc_write_trampoline_addr(SB)/8, $libc_write_trampoline<>(SB)
 
 TEXT libc_mmap_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_mmap(SB)
-
 GLOBL	·libc_mmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_mmap_trampoline_addr(SB)/8, $libc_mmap_trampoline<>(SB)
 
 TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_munmap(SB)
-
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
 TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstat(SB)
-
 GLOBL	·libc_fstat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstat_trampoline_addr(SB)/8, $libc_fstat_trampoline<>(SB)
 
 TEXT libc_fstatat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstatat(SB)
-
 GLOBL	·libc_fstatat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstatat_trampoline_addr(SB)/8, $libc_fstatat_trampoline<>(SB)
 
 TEXT libc_fstatfs_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_fstatfs(SB)
-
 GLOBL	·libc_fstatfs_trampoline_addr(SB), RODATA, $8
 DATA	·libc_fstatfs_trampoline_addr(SB)/8, $libc_fstatfs_trampoline<>(SB)
 
 TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_getfsstat(SB)
-
 GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
 
 TEXT libc_lstat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_lstat(SB)
-
 GLOBL	·libc_lstat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_lstat_trampoline_addr(SB)/8, $libc_lstat_trampoline<>(SB)
 
 TEXT libc_ptrace_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ptrace(SB)
-
 GLOBL	·libc_ptrace_trampoline_addr(SB), RODATA, $8
 DATA	·libc_ptrace_trampoline_addr(SB)/8, $libc_ptrace_trampoline<>(SB)
 
 TEXT libc_stat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_stat(SB)
-
 GLOBL	·libc_stat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_stat_trampoline_addr(SB)/8, $libc_stat_trampoline<>(SB)
 
 TEXT libc_statfs_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_statfs(SB)
-
 GLOBL	·libc_statfs_trampoline_addr(SB), RODATA, $8
 DATA	·libc_statfs_trampoline_addr(SB)/8, $libc_statfs_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
index 54749f9c5ed..aad65fc7932 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_dragonfly_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build dragonfly && amd64
-// +build dragonfly,amd64
 
 package unix
 
@@ -436,6 +435,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1400,16 +1409,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1642,28 +1641,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
index 77479d45815..c0096391af9 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build freebsd && 386
-// +build freebsd,386
 
 package unix
 
@@ -388,6 +387,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -414,6 +423,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Access(path string, mode uint32) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1625,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1852,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
index 2e966d4d7a6..7664df74960 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build freebsd && amd64
-// +build freebsd,amd64
 
 package unix
 
@@ -388,6 +387,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -414,6 +423,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Access(path string, mode uint32) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1625,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1852,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
index d65a7c0fa6e..ae099182c9f 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build freebsd && arm
-// +build freebsd,arm
 
 package unix
 
@@ -388,6 +387,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -414,6 +423,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Access(path string, mode uint32) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1625,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1852,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
index 6f0b97c6db3..11fd5d45bbb 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build freebsd && arm64
-// +build freebsd,arm64
 
 package unix
 
@@ -388,6 +387,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -414,6 +423,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Access(path string, mode uint32) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1625,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1852,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go
index e1c23b52723..c3d2d653072 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_freebsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build freebsd && riscv64
-// +build freebsd,riscv64
 
 package unix
 
@@ -388,6 +387,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -414,6 +423,16 @@ func ptrace(request int, pid int, addr uintptr, data int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr unsafe.Pointer, data int) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Access(path string, mode uint32) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
@@ -1625,16 +1644,6 @@ func Setresuid(ruid int, euid int, suid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1852,28 +1861,6 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func accept4(fd int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (nfd int, err error) {
 	r0, _, e1 := Syscall6(SYS_ACCEPT4, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	nfd = int(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go
index b57c7050d7a..c698cbc01a5 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_illumos_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build illumos && amd64
-// +build illumos,amd64
 
 package unix
 
@@ -40,7 +39,7 @@ func readv(fd int, iovs []Iovec) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procreadv)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -55,7 +54,7 @@ func preadv(fd int, iovs []Iovec, off int64) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpreadv)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -70,7 +69,7 @@ func writev(fd int, iovs []Iovec) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwritev)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -85,7 +84,7 @@ func pwritev(fd int, iovs []Iovec, off int64) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwritev)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(iovs)), uintptr(off), 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -96,7 +95,7 @@ func accept4(s int, rsa *RawSockaddrAny, addrlen *_Socklen, flags int) (fd int,
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept4)), 4, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), uintptr(flags), 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go
index 36ea3a55b72..1488d27128c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go
@@ -1,7 +1,6 @@
 // Code generated by mkmerge; DO NOT EDIT.
 
 //go:build linux
-// +build linux
 
 package unix
 
@@ -38,6 +37,21 @@ func fchmodat(dirfd int, path string, mode uint32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fchmodat2(dirfd int, path string, mode uint32, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
+	}
+	_, _, e1 := Syscall6(SYS_FCHMODAT2, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -379,6 +393,16 @@ func ptrace(request int, pid int, addr uintptr, data uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ptracePtr(request int, pid int, addr uintptr, data unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall6(SYS_PTRACE, uintptr(request), uintptr(pid), uintptr(addr), uintptr(data), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func reboot(magic1 uint, magic2 uint, cmd int, arg string) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(arg)
@@ -1336,16 +1360,6 @@ func PivotRoot(newroot string, putold string) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Prlimit(pid int, resource int, newlimit *Rlimit, old *Rlimit) (err error) {
-	_, _, e1 := RawSyscall6(SYS_PRLIMIT64, uintptr(pid), uintptr(resource), uintptr(unsafe.Pointer(newlimit)), uintptr(unsafe.Pointer(old)), 0, 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (err error) {
 	_, _, e1 := Syscall6(SYS_PRCTL, uintptr(option), uintptr(arg2), uintptr(arg3), uintptr(arg4), uintptr(arg5), 0)
 	if e1 != 0 {
@@ -1356,7 +1370,7 @@ func Prctl(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uintptr) (
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Pselect(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
+func pselect6(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timespec, sigmask *sigset_argpack) (n int, err error) {
 	r0, _, e1 := Syscall6(SYS_PSELECT6, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)))
 	n = int(r0)
 	if e1 != 0 {
@@ -1734,28 +1748,6 @@ func exitThread(code int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, p *byte, np int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, p *byte, np int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(p)), uintptr(np))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func readv(fd int, iovs []Iovec) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(iovs) > 0 {
@@ -1868,6 +1860,17 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func mremap(oldaddr uintptr, oldlength uintptr, newlength uintptr, flags int, newaddr uintptr) (xaddr uintptr, err error) {
+	r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldaddr), uintptr(oldlength), uintptr(newlength), uintptr(flags), uintptr(newaddr), 0)
+	xaddr = uintptr(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func Madvise(b []byte, advice int) (err error) {
 	var _p0 unsafe.Pointer
 	if len(b) > 0 {
@@ -2172,3 +2175,47 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr)
 	}
 	return
 }
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func schedSetattr(pid int, attr *SchedAttr, flags uint) (err error) {
+	_, _, e1 := Syscall(SYS_SCHED_SETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(flags))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func schedGetattr(pid int, attr *SchedAttr, size uint, flags uint) (err error) {
+	_, _, e1 := Syscall6(SYS_SCHED_GETATTR, uintptr(pid), uintptr(unsafe.Pointer(attr)), uintptr(size), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func Cachestat(fd uint, crange *CachestatRange, cstat *Cachestat_t, flags uint) (err error) {
+	_, _, e1 := Syscall6(SYS_CACHESTAT, uintptr(fd), uintptr(unsafe.Pointer(crange)), uintptr(unsafe.Pointer(cstat)), uintptr(flags), 0, 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
index c81b0ad4777..4def3e9fcb0 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && 386
-// +build linux,386
 
 package unix
 
@@ -411,16 +410,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *rlimit32) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func futimesat(dirfd int, path string, times *[2]Timeval) (err error) {
 	var _p0 *byte
 	_p0, err = BytePtrFromString(path)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
index 2206bce7f4d..fef2bc8ba9c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && amd64
-// +build linux,amd64
 
 package unix
 
@@ -334,16 +333,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
index edf6b39f161..a9fd76a8841 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && arm
-// +build linux,arm
 
 package unix
 
@@ -578,16 +577,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *rlimit32) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func armSyncFileRange(fd int, flags int, off int64, n int64) (err error) {
 	_, _, e1 := Syscall6(SYS_ARM_SYNC_FILE_RANGE, uintptr(fd), uintptr(flags), uintptr(off), uintptr(off>>32), uintptr(n), uintptr(n>>32))
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
index 190609f2140..4600650280a 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && arm64
-// +build linux,arm64
 
 package unix
 
@@ -289,16 +288,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go
index 806ffd1e125..c8987d26465 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_loong64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && loong64
-// +build linux,loong64
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
index 5f984cbb1ca..921f4306110 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && mips
-// +build linux,mips
 
 package unix
 
@@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *rlimit32) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Alarm(seconds uint) (remaining uint, err error) {
 	r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0)
 	remaining = uint(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
index 46fc380a40e..44f067829c4 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && mips64
-// +build linux,mips64
 
 package unix
 
@@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
index cbd0d4dadba..e7fa0abf0d1 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mips64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && mips64le
-// +build linux,mips64le
 
 package unix
 
@@ -278,16 +277,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
index 0c13d15f07c..8c5125675e8 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_mipsle.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && mipsle
-// +build linux,mipsle
 
 package unix
 
@@ -644,16 +643,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *rlimit32) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Alarm(seconds uint) (remaining uint, err error) {
 	r0, _, e1 := Syscall(SYS_ALARM, uintptr(seconds), 0, 0)
 	remaining = uint(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go
index e01432aed51..7392fd45e43 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && ppc
-// +build linux,ppc
 
 package unix
 
@@ -624,16 +623,6 @@ func getrlimit(resource int, rlim *rlimit32) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func setrlimit(resource int, rlim *rlimit32) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func syncFileRange2(fd int, flags int, off int64, n int64) (err error) {
 	_, _, e1 := Syscall6(SYS_SYNC_FILE_RANGE2, uintptr(fd), uintptr(flags), uintptr(off>>32), uintptr(off), uintptr(n>>32), uintptr(n))
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
index 13c7ee7baff..41180434e60 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && ppc64
-// +build linux,ppc64
 
 package unix
 
@@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
index 02d0c0fd61e..40c6ce7ae54 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_ppc64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && ppc64le
-// +build linux,ppc64le
 
 package unix
 
@@ -349,16 +348,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
index 9fee3b1d239..2cfe34adb12 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && riscv64
-// +build linux,riscv64
 
 package unix
 
@@ -269,16 +268,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
@@ -541,3 +530,19 @@ func kexecFileLoad(kernelFd int, initrdFd int, cmdlineLen int, cmdline string, f
 	}
 	return
 }
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func riscvHWProbe(pairs []RISCVHWProbePairs, cpuCount uintptr, cpus *CPUSet, flags uint) (err error) {
+	var _p0 unsafe.Pointer
+	if len(pairs) > 0 {
+		_p0 = unsafe.Pointer(&pairs[0])
+	} else {
+		_p0 = unsafe.Pointer(&_zero)
+	}
+	_, _, e1 := Syscall6(SYS_RISCV_HWPROBE, uintptr(_p0), uintptr(len(pairs)), uintptr(cpuCount), uintptr(unsafe.Pointer(cpus)), uintptr(flags), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
index 647bbfecd6a..61e6f070971 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_s390x.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && s390x
-// +build linux,s390x
 
 package unix
 
@@ -319,16 +318,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error) {
 	r0, _, e1 := Syscall6(SYS_SPLICE, uintptr(rfd), uintptr(unsafe.Pointer(roff)), uintptr(wfd), uintptr(unsafe.Pointer(woff)), uintptr(len), uintptr(flags))
 	n = int64(r0)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
index ada057f8914..834b8420428 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux_sparc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build linux && sparc64
-// +build linux,sparc64
 
 package unix
 
@@ -329,16 +328,6 @@ func setfsuid(uid int) (prev int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(resource int, rlim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(resource), uintptr(unsafe.Pointer(rlim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Shutdown(fd int, how int) (err error) {
 	_, _, e1 := Syscall(SYS_SHUTDOWN, uintptr(fd), uintptr(how), 0)
 	if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
index 79f7389963e..e91ebc14a19 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build netbsd && 386
-// +build netbsd,386
 
 package unix
 
@@ -405,6 +404,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1597,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
+func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
 	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
+	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
-	var _p0 *byte
-	_p0, err = BytePtrFromString(path)
-	if err != nil {
-		return
-	}
-	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
+func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) {
+	r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0)
+	xaddr = uintptr(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
index fb161f3a263..be28babbcd6 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build netbsd && amd64
-// +build netbsd,amd64
 
 package unix
 
@@ -405,6 +404,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1597,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
+func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
 	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
+	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
-	var _p0 *byte
-	_p0, err = BytePtrFromString(path)
-	if err != nil {
-		return
-	}
-	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
+func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) {
+	r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0)
+	xaddr = uintptr(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
index 4c8ac993a88..fb587e8261f 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build netbsd && arm
-// +build netbsd,arm
 
 package unix
 
@@ -405,6 +404,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1597,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
+func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
 	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
+	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
-	var _p0 *byte
-	_p0, err = BytePtrFromString(path)
-	if err != nil {
-		return
-	}
-	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
+func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) {
+	r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0)
+	xaddr = uintptr(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
index 76dd8ec4fdb..d576438bb08 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_netbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build netbsd && arm64
-// +build netbsd,arm64
 
 package unix
 
@@ -405,6 +404,16 @@ func ioctl(fd int, req uint, arg uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := Syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -1597,16 +1606,6 @@ func Setreuid(ruid int, euid int) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := RawSyscall(SYS_SETRLIMIT, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setsid() (pid int, err error) {
 	r0, _, e1 := RawSyscall(SYS_SETSID, 0, 0, 0)
 	pid = int(r0)
@@ -1824,20 +1823,13 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
+func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
+	var _p0 *byte
+	_p0, err = BytePtrFromString(path)
+	if err != nil {
+		return
 	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := Syscall(SYS_WRITE, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
+	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
@@ -1846,13 +1838,9 @@ func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error) {
-	var _p0 *byte
-	_p0, err = BytePtrFromString(path)
-	if err != nil {
-		return
-	}
-	_, _, e1 := Syscall6(SYS_UTIMENSAT, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flags), 0, 0)
+func mremapNetBSD(oldp uintptr, oldsize uintptr, newp uintptr, newsize uintptr, flags int) (xaddr uintptr, err error) {
+	r0, _, e1 := Syscall6(SYS_MREMAP, uintptr(oldp), uintptr(oldsize), uintptr(newp), uintptr(newsize), uintptr(flags), 0)
+	xaddr = uintptr(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
 	}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
index caeb807bd4e..a1d061597cc 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && 386
-// +build openbsd,386
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
index 087444250c9..41b5617316c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $4
 DATA	·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $4
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $4
 DATA	·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $4
+DATA	·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $4
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $4
 DATA	·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $4
-DATA	·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $4
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $4
 DATA	·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $4
 DATA	·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $4
+DATA	·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $4
+DATA	·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
index a05e5f4fff6..5b2a7409778 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && amd64
-// +build openbsd,amd64
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
index 5782cd10844..4019a656f6d 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
+DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $8
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $8
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $8
+DATA	·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $8
+DATA	·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
index b2da8e50cc7..f6eda1344a8 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && arm
-// +build openbsd,arm
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
index cf310420c94..ac4af24f908 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $4
 DATA	·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $4
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $4
 DATA	·libc_sysctl_trampoline_addr(SB)/4, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $4
+DATA	·libc_fcntl_trampoline_addr(SB)/4, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $4
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $4
 DATA	·libc_setresuid_trampoline_addr(SB)/4, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $4
-DATA	·libc_setrlimit_trampoline_addr(SB)/4, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $4
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $4
 DATA	·libc_munmap_trampoline_addr(SB)/4, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $4
+DATA	·libc_getfsstat_trampoline_addr(SB)/4, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $4
 DATA	·libc_utimensat_trampoline_addr(SB)/4, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $4
+DATA	·libc_pledge_trampoline_addr(SB)/4, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $4
+DATA	·libc_unveil_trampoline_addr(SB)/4, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
index 048b2655e6f..55df20ae9d8 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && arm64
-// +build openbsd,arm64
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
index 484bb42e0a8..f77d532121b 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
+DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $8
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $8
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $8
+DATA	·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $8
+DATA	·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
index 6f33e37e723..8c1155cbc08 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && mips64
-// +build openbsd,mips64
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
index 55af27263ad..fae140b62c9 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
+DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $8
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $8
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $8
+DATA	·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $8
+DATA	·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
index 330cf7f7ac6..7cc80c58d98 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && ppc64
-// +build openbsd,ppc64
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
index 4028255b0d5..9d1e0ff06d0 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
@@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_getresuid(SB)
+	RET
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_getresgid(SB)
+	RET
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	CALL	libc_ioctl(SB)
 	RET
@@ -201,6 +213,12 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_fcntl(SB)
+	RET
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
+DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	CALL	libc_ppoll(SB)
 	RET
@@ -687,12 +705,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	CALL	libc_setrlimit(SB)
-	RET
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	CALL	libc_setrtable(SB)
 	RET
@@ -795,8 +807,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_getfsstat(SB)
+	RET
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	CALL	libc_utimensat(SB)
 	RET
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_pledge(SB)
+	RET
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $8
+DATA	·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	CALL	libc_unveil(SB)
+	RET
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $8
+DATA	·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
index 5f24de0d9d7..0688737f494 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build openbsd && riscv64
-// +build openbsd,riscv64
 
 package unix
 
@@ -519,6 +518,28 @@ var libc_getcwd_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+	syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+	return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+	syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+	return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ioctl(fd int, req uint, arg uintptr) (err error) {
 	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
@@ -533,6 +554,16 @@ var libc_ioctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+	_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
 	var _p0 unsafe.Pointer
 	if len(mib) > 0 {
@@ -553,6 +584,32 @@ var libc_sysctl_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
+func fcntl(fd int, cmd int, arg int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_fcntl_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_fcntl fcntl "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func fcntlPtr(fd int, cmd int, arg unsafe.Pointer) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_fcntl_trampoline_addr, uintptr(fd), uintptr(cmd), uintptr(arg))
+	n = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
 func ppoll(fds *PollFd, nfds int, timeout *Timespec, sigmask *Sigset_t) (n int, err error) {
 	r0, _, e1 := syscall_syscall6(libc_ppoll_trampoline_addr, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(unsafe.Pointer(timeout)), uintptr(unsafe.Pointer(sigmask)), 0, 0)
 	n = int(r0)
@@ -1886,20 +1943,6 @@ var libc_setresuid_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := syscall_rawSyscall(libc_setrlimit_trampoline_addr, uintptr(which), uintptr(unsafe.Pointer(lim)), 0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-var libc_setrlimit_trampoline_addr uintptr
-
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func Setrtable(rtable int) (err error) {
 	_, _, e1 := syscall_rawSyscall(libc_setrtable_trampoline_addr, uintptr(rtable), 0, 0)
 	if e1 != 0 {
@@ -2195,8 +2238,8 @@ var libc_munmap_trampoline_addr uintptr
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_read_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
+func getfsstat(stat *Statfs_t, bufsize uintptr, flags int) (n int, err error) {
+	r0, _, e1 := syscall_syscall(libc_getfsstat_trampoline_addr, uintptr(unsafe.Pointer(stat)), uintptr(bufsize), uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = errnoErr(e1)
@@ -2204,16 +2247,9 @@ func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
 	return
 }
 
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+var libc_getfsstat_trampoline_addr uintptr
 
-func writelen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(libc_write_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
+//go:cgo_import_dynamic libc_getfsstat getfsstat "libc.so"
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
@@ -2233,3 +2269,33 @@ func utimensat(dirfd int, path string, times *[2]Timespec, flags int) (err error
 var libc_utimensat_trampoline_addr uintptr
 
 //go:cgo_import_dynamic libc_utimensat utimensat "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func pledge(promises *byte, execpromises *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_pledge_trampoline_addr, uintptr(unsafe.Pointer(promises)), uintptr(unsafe.Pointer(execpromises)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_pledge_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_pledge pledge "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func unveil(path *byte, flags *byte) (err error) {
+	_, _, e1 := syscall_syscall(libc_unveil_trampoline_addr, uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(flags)), 0)
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+var libc_unveil_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_unveil unveil "libc.so"
+
+
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
index e1fbd4dfa8c..da115f9a4b6 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_getcwd_trampoline_addr(SB), RODATA, $8
 DATA	·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
 
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresuid(SB)
+GLOBL	·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getresgid(SB)
+GLOBL	·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
 TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ioctl(SB)
 GLOBL	·libc_ioctl_trampoline_addr(SB), RODATA, $8
@@ -168,6 +178,11 @@ TEXT libc_sysctl_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_sysctl_trampoline_addr(SB), RODATA, $8
 DATA	·libc_sysctl_trampoline_addr(SB)/8, $libc_sysctl_trampoline<>(SB)
 
+TEXT libc_fcntl_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_fcntl(SB)
+GLOBL	·libc_fcntl_trampoline_addr(SB), RODATA, $8
+DATA	·libc_fcntl_trampoline_addr(SB)/8, $libc_fcntl_trampoline<>(SB)
+
 TEXT libc_ppoll_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_ppoll(SB)
 GLOBL	·libc_ppoll_trampoline_addr(SB), RODATA, $8
@@ -573,11 +588,6 @@ TEXT libc_setresuid_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_setresuid_trampoline_addr(SB), RODATA, $8
 DATA	·libc_setresuid_trampoline_addr(SB)/8, $libc_setresuid_trampoline<>(SB)
 
-TEXT libc_setrlimit_trampoline<>(SB),NOSPLIT,$0-0
-	JMP	libc_setrlimit(SB)
-GLOBL	·libc_setrlimit_trampoline_addr(SB), RODATA, $8
-DATA	·libc_setrlimit_trampoline_addr(SB)/8, $libc_setrlimit_trampoline<>(SB)
-
 TEXT libc_setrtable_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_setrtable(SB)
 GLOBL	·libc_setrtable_trampoline_addr(SB), RODATA, $8
@@ -663,7 +673,22 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0
 GLOBL	·libc_munmap_trampoline_addr(SB), RODATA, $8
 DATA	·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB)
 
+TEXT libc_getfsstat_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_getfsstat(SB)
+GLOBL	·libc_getfsstat_trampoline_addr(SB), RODATA, $8
+DATA	·libc_getfsstat_trampoline_addr(SB)/8, $libc_getfsstat_trampoline<>(SB)
+
 TEXT libc_utimensat_trampoline<>(SB),NOSPLIT,$0-0
 	JMP	libc_utimensat(SB)
 GLOBL	·libc_utimensat_trampoline_addr(SB), RODATA, $8
 DATA	·libc_utimensat_trampoline_addr(SB)/8, $libc_utimensat_trampoline<>(SB)
+
+TEXT libc_pledge_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_pledge(SB)
+GLOBL	·libc_pledge_trampoline_addr(SB), RODATA, $8
+DATA	·libc_pledge_trampoline_addr(SB)/8, $libc_pledge_trampoline<>(SB)
+
+TEXT libc_unveil_trampoline<>(SB),NOSPLIT,$0-0
+	JMP	libc_unveil(SB)
+GLOBL	·libc_unveil_trampoline_addr(SB), RODATA, $8
+DATA	·libc_unveil_trampoline_addr(SB)/8, $libc_unveil_trampoline<>(SB)
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go
index 78d4a4240e9..829b87feb8d 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_solaris_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build solaris && amd64
-// +build solaris,amd64
 
 package unix
 
@@ -110,7 +109,6 @@ import (
 //go:cgo_import_dynamic libc_setpriority setpriority "libc.so"
 //go:cgo_import_dynamic libc_setregid setregid "libc.so"
 //go:cgo_import_dynamic libc_setreuid setreuid "libc.so"
-//go:cgo_import_dynamic libc_setrlimit setrlimit "libc.so"
 //go:cgo_import_dynamic libc_setsid setsid "libc.so"
 //go:cgo_import_dynamic libc_setuid setuid "libc.so"
 //go:cgo_import_dynamic libc_shutdown shutdown "libsocket.so"
@@ -250,7 +248,6 @@ import (
 //go:linkname procSetpriority libc_setpriority
 //go:linkname procSetregid libc_setregid
 //go:linkname procSetreuid libc_setreuid
-//go:linkname procSetrlimit libc_setrlimit
 //go:linkname procSetsid libc_setsid
 //go:linkname procSetuid libc_setuid
 //go:linkname procshutdown libc_shutdown
@@ -391,7 +388,6 @@ var (
 	procSetpriority,
 	procSetregid,
 	procSetreuid,
-	procSetrlimit,
 	procSetsid,
 	procSetuid,
 	procshutdown,
@@ -439,7 +435,7 @@ func pipe(p *[2]_C_int) (n int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe)), 1, uintptr(unsafe.Pointer(p)), 0, 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -449,7 +445,7 @@ func pipe(p *[2]_C_int) (n int, err error) {
 func pipe2(p *[2]_C_int, flags int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procpipe2)), 2, uintptr(unsafe.Pointer(p)), uintptr(flags), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -459,7 +455,7 @@ func pipe2(p *[2]_C_int, flags int) (err error) {
 func getsockname(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetsockname)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -474,7 +470,7 @@ func Getcwd(buf []byte) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetcwd)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -485,7 +481,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -495,7 +491,7 @@ func getgroups(ngid int, gid *_Gid_t) (n int, err error) {
 func setgroups(ngid int, gid *_Gid_t) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procsetgroups)), 2, uintptr(ngid), uintptr(unsafe.Pointer(gid)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -506,7 +502,7 @@ func wait4(pid int32, statusp *_C_int, options int, rusage *Rusage) (wpid int32,
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwait4)), 4, uintptr(pid), uintptr(unsafe.Pointer(statusp)), uintptr(options), uintptr(unsafe.Pointer(rusage)), 0, 0)
 	wpid = int32(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -521,7 +517,7 @@ func gethostname(buf []byte) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -536,7 +532,7 @@ func utimes(path string, times *[2]Timeval) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimes)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -551,7 +547,7 @@ func utimensat(fd int, path string, times *[2]Timespec, flag int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procutimensat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(times)), uintptr(flag), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -562,7 +558,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfcntl)), 3, uintptr(fd), uintptr(cmd), uintptr(arg), 0, 0, 0)
 	val = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -572,7 +568,7 @@ func fcntl(fd int, cmd int, arg int) (val int, err error) {
 func futimesat(fildes int, path *byte, times *[2]Timeval) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procfutimesat)), 3, uintptr(fildes), uintptr(unsafe.Pointer(path)), uintptr(unsafe.Pointer(times)), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -583,7 +579,7 @@ func accept(s int, rsa *RawSockaddrAny, addrlen *_Socklen) (fd int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procaccept)), 3, uintptr(s), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -594,7 +590,7 @@ func recvmsg(s int, msg *Msghdr, flags int) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_recvmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -605,7 +601,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendmsg)), 3, uintptr(s), uintptr(unsafe.Pointer(msg)), uintptr(flags), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -615,7 +611,7 @@ func sendmsg(s int, msg *Msghdr, flags int) (n int, err error) {
 func acct(path *byte) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procacct)), 1, uintptr(unsafe.Pointer(path)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -646,11 +642,22 @@ func __minor(version int, dev uint64) (val uint) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func ioctlRet(fd int, req uint, arg uintptr) (ret int, err error) {
+func ioctlRet(fd int, req int, arg uintptr) (ret int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0)
 	ret = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ioctlPtrRet(fd int, req int, arg unsafe.Pointer) (ret int, err error) {
+	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procioctl)), 3, uintptr(fd), uintptr(req), uintptr(arg), 0, 0, 0)
+	ret = int(r0)
+	if e1 != 0 {
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -661,7 +668,7 @@ func poll(fds *PollFd, nfds int, timeout int) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpoll)), 3, uintptr(unsafe.Pointer(fds)), uintptr(nfds), uintptr(timeout), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -676,7 +683,7 @@ func Access(path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAccess)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -686,7 +693,7 @@ func Access(path string, mode uint32) (err error) {
 func Adjtime(delta *Timeval, olddelta *Timeval) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procAdjtime)), 2, uintptr(unsafe.Pointer(delta)), uintptr(unsafe.Pointer(olddelta)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -701,7 +708,7 @@ func Chdir(path string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -716,7 +723,7 @@ func Chmod(path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChmod)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -731,7 +738,7 @@ func Chown(path string, uid int, gid int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -746,7 +753,7 @@ func Chroot(path string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procChroot)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -756,7 +763,7 @@ func Chroot(path string) (err error) {
 func ClockGettime(clockid int32, time *Timespec) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClockGettime)), 2, uintptr(clockid), uintptr(unsafe.Pointer(time)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -766,7 +773,7 @@ func ClockGettime(clockid int32, time *Timespec) (err error) {
 func Close(fd int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procClose)), 1, uintptr(fd), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -782,7 +789,7 @@ func Creat(path string, mode uint32) (fd int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procCreat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -793,7 +800,7 @@ func Dup(fd int) (nfd int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup)), 1, uintptr(fd), 0, 0, 0, 0, 0)
 	nfd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -803,7 +810,7 @@ func Dup(fd int) (nfd int, err error) {
 func Dup2(oldfd int, newfd int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procDup2)), 2, uintptr(oldfd), uintptr(newfd), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -825,7 +832,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFaccessat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -835,7 +842,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 func Fchdir(fd int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchdir)), 1, uintptr(fd), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -845,7 +852,7 @@ func Fchdir(fd int) (err error) {
 func Fchmod(fd int, mode uint32) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmod)), 2, uintptr(fd), uintptr(mode), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -860,7 +867,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchmodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(flags), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -870,7 +877,7 @@ func Fchmodat(dirfd int, path string, mode uint32, flags int) (err error) {
 func Fchown(fd int, uid int, gid int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchown)), 3, uintptr(fd), uintptr(uid), uintptr(gid), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -885,7 +892,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFchownat)), 5, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), uintptr(flags), 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -895,7 +902,7 @@ func Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error) {
 func Fdatasync(fd int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFdatasync)), 1, uintptr(fd), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -905,7 +912,7 @@ func Fdatasync(fd int) (err error) {
 func Flock(fd int, how int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFlock)), 2, uintptr(fd), uintptr(how), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -916,7 +923,7 @@ func Fpathconf(fd int, name int) (val int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFpathconf)), 2, uintptr(fd), uintptr(name), 0, 0, 0, 0)
 	val = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -926,7 +933,7 @@ func Fpathconf(fd int, name int) (val int, err error) {
 func Fstat(fd int, stat *Stat_t) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstat)), 2, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -941,7 +948,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatat)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), uintptr(flags), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -951,7 +958,7 @@ func Fstatat(fd int, path string, stat *Stat_t, flags int) (err error) {
 func Fstatvfs(fd int, vfsstat *Statvfs_t) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFstatvfs)), 2, uintptr(fd), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -966,7 +973,7 @@ func Getdents(fd int, buf []byte, basep *uintptr) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetdents)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(unsafe.Pointer(basep)), 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -993,7 +1000,7 @@ func Getpgid(pid int) (pgid int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgid)), 1, uintptr(pid), 0, 0, 0, 0, 0)
 	pgid = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1004,7 +1011,7 @@ func Getpgrp() (pgid int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetpgrp)), 0, 0, 0, 0, 0, 0, 0)
 	pgid = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1039,7 +1046,7 @@ func Getpriority(which int, who int) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procGetpriority)), 2, uintptr(which), uintptr(who), 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1049,7 +1056,7 @@ func Getpriority(which int, who int) (n int, err error) {
 func Getrlimit(which int, lim *Rlimit) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1059,7 +1066,7 @@ func Getrlimit(which int, lim *Rlimit) (err error) {
 func Getrusage(who int, rusage *Rusage) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetrusage)), 2, uintptr(who), uintptr(unsafe.Pointer(rusage)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1070,7 +1077,7 @@ func Getsid(pid int) (sid int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGetsid)), 1, uintptr(pid), 0, 0, 0, 0, 0)
 	sid = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1080,7 +1087,7 @@ func Getsid(pid int) (sid int, err error) {
 func Gettimeofday(tv *Timeval) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procGettimeofday)), 1, uintptr(unsafe.Pointer(tv)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1098,7 +1105,7 @@ func Getuid() (uid int) {
 func Kill(pid int, signum syscall.Signal) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procKill)), 2, uintptr(pid), uintptr(signum), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1113,7 +1120,7 @@ func Lchown(path string, uid int, gid int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLchown)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(uid), uintptr(gid), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1133,7 +1140,7 @@ func Link(path string, link string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1143,7 +1150,7 @@ func Link(path string, link string) (err error) {
 func Listen(s int, backlog int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_llisten)), 2, uintptr(s), uintptr(backlog), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1158,7 +1165,7 @@ func Lstat(path string, stat *Stat_t) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procLstat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1172,7 +1179,7 @@ func Madvise(b []byte, advice int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMadvise)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(advice), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1187,7 +1194,7 @@ func Mkdir(path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdir)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1202,7 +1209,7 @@ func Mkdirat(dirfd int, path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkdirat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1217,7 +1224,7 @@ func Mkfifo(path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifo)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1232,7 +1239,7 @@ func Mkfifoat(dirfd int, path string, mode uint32) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMkfifoat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1247,7 +1254,7 @@ func Mknod(path string, mode uint32, dev int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknod)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1262,7 +1269,7 @@ func Mknodat(dirfd int, path string, mode uint32, dev int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMknodat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(dev), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1276,7 +1283,7 @@ func Mlock(b []byte) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1286,7 +1293,7 @@ func Mlock(b []byte) (err error) {
 func Mlockall(flags int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMlockall)), 1, uintptr(flags), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1300,7 +1307,7 @@ func Mprotect(b []byte, prot int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMprotect)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(prot), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1314,7 +1321,7 @@ func Msync(b []byte, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMsync)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), uintptr(flags), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1328,7 +1335,7 @@ func Munlock(b []byte) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlock)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(b)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1338,7 +1345,7 @@ func Munlock(b []byte) (err error) {
 func Munlockall() (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procMunlockall)), 0, 0, 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1348,7 +1355,7 @@ func Munlockall() (err error) {
 func Nanosleep(time *Timespec, leftover *Timespec) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procNanosleep)), 2, uintptr(unsafe.Pointer(time)), uintptr(unsafe.Pointer(leftover)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1364,7 +1371,7 @@ func Open(path string, mode int, perm uint32) (fd int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpen)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(mode), uintptr(perm), 0, 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1380,7 +1387,7 @@ func Openat(dirfd int, path string, flags int, mode uint32) (fd int, err error)
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procOpenat)), 4, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), uintptr(mode), 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1396,7 +1403,7 @@ func Pathconf(path string, name int) (val int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPathconf)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(name), 0, 0, 0, 0)
 	val = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1406,7 +1413,7 @@ func Pathconf(path string, name int) (val int, err error) {
 func Pause() (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procPause)), 0, 0, 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1421,7 +1428,7 @@ func pread(fd int, p []byte, offset int64) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpread)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1436,7 +1443,7 @@ func pwrite(fd int, p []byte, offset int64) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procpwrite)), 4, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(offset), 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1451,7 +1458,7 @@ func read(fd int, p []byte) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procread)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1471,7 +1478,7 @@ func Readlink(path string, buf []byte) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procReadlink)), 3, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), uintptr(len(buf)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1491,7 +1498,7 @@ func Rename(from string, to string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRename)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1511,7 +1518,7 @@ func Renameat(olddirfd int, oldpath string, newdirfd int, newpath string) (err e
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRenameat)), 4, uintptr(olddirfd), uintptr(unsafe.Pointer(_p0)), uintptr(newdirfd), uintptr(unsafe.Pointer(_p1)), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1526,7 +1533,7 @@ func Rmdir(path string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procRmdir)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1537,7 +1544,7 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proclseek)), 3, uintptr(fd), uintptr(offset), uintptr(whence), 0, 0, 0)
 	newoffset = int64(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1548,7 +1555,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSelect)), 5, uintptr(nfd), uintptr(unsafe.Pointer(r)), uintptr(unsafe.Pointer(w)), uintptr(unsafe.Pointer(e)), uintptr(unsafe.Pointer(timeout)), 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1558,7 +1565,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 func Setegid(egid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetegid)), 1, uintptr(egid), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1568,7 +1575,7 @@ func Setegid(egid int) (err error) {
 func Seteuid(euid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSeteuid)), 1, uintptr(euid), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1578,7 +1585,7 @@ func Seteuid(euid int) (err error) {
 func Setgid(gid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetgid)), 1, uintptr(gid), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1592,7 +1599,7 @@ func Sethostname(p []byte) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSethostname)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1602,7 +1609,7 @@ func Sethostname(p []byte) (err error) {
 func Setpgid(pid int, pgid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetpgid)), 2, uintptr(pid), uintptr(pgid), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1612,7 +1619,7 @@ func Setpgid(pid int, pgid int) (err error) {
 func Setpriority(which int, who int, prio int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSetpriority)), 3, uintptr(which), uintptr(who), uintptr(prio), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1622,7 +1629,7 @@ func Setpriority(which int, who int, prio int) (err error) {
 func Setregid(rgid int, egid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetregid)), 2, uintptr(rgid), uintptr(egid), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1632,17 +1639,7 @@ func Setregid(rgid int, egid int) (err error) {
 func Setreuid(ruid int, euid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetreuid)), 2, uintptr(ruid), uintptr(euid), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
-func Setrlimit(which int, lim *Rlimit) (err error) {
-	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetrlimit)), 2, uintptr(which), uintptr(unsafe.Pointer(lim)), 0, 0, 0, 0)
-	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1653,7 +1650,7 @@ func Setsid() (pid int, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetsid)), 0, 0, 0, 0, 0, 0, 0)
 	pid = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1663,7 +1660,7 @@ func Setsid() (pid int, err error) {
 func Setuid(uid int) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procSetuid)), 1, uintptr(uid), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1673,7 +1670,7 @@ func Setuid(uid int) (err error) {
 func Shutdown(s int, how int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procshutdown)), 2, uintptr(s), uintptr(how), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1688,7 +1685,7 @@ func Stat(path string, stat *Stat_t) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStat)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(stat)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1703,7 +1700,7 @@ func Statvfs(path string, vfsstat *Statvfs_t) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procStatvfs)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(vfsstat)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1723,7 +1720,7 @@ func Symlink(path string, link string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSymlink)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(_p1)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1733,7 +1730,7 @@ func Symlink(path string, link string) (err error) {
 func Sync() (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSync)), 0, 0, 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1744,7 +1741,7 @@ func Sysconf(which int) (n int64, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procSysconf)), 1, uintptr(which), 0, 0, 0, 0, 0)
 	n = int64(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1755,7 +1752,7 @@ func Times(tms *Tms) (ticks uintptr, err error) {
 	r0, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procTimes)), 1, uintptr(unsafe.Pointer(tms)), 0, 0, 0, 0, 0)
 	ticks = uintptr(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1770,7 +1767,7 @@ func Truncate(path string, length int64) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procTruncate)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(length), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1780,7 +1777,7 @@ func Truncate(path string, length int64) (err error) {
 func Fsync(fd int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFsync)), 1, uintptr(fd), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1790,7 +1787,7 @@ func Fsync(fd int) (err error) {
 func Ftruncate(fd int, length int64) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procFtruncate)), 2, uintptr(fd), uintptr(length), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1808,7 +1805,7 @@ func Umask(mask int) (oldmask int) {
 func Uname(buf *Utsname) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procUname)), 1, uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1823,7 +1820,7 @@ func Unmount(target string, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procumount)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1838,7 +1835,7 @@ func Unlink(path string) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlink)), 1, uintptr(unsafe.Pointer(_p0)), 0, 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1853,7 +1850,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUnlinkat)), 3, uintptr(dirfd), uintptr(unsafe.Pointer(_p0)), uintptr(flags), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1863,7 +1860,7 @@ func Unlinkat(dirfd int, path string, flags int) (err error) {
 func Ustat(dev int, ubuf *Ustat_t) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUstat)), 2, uintptr(dev), uintptr(unsafe.Pointer(ubuf)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1878,7 +1875,7 @@ func Utime(path string, buf *Utimbuf) (err error) {
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procUtime)), 2, uintptr(unsafe.Pointer(_p0)), uintptr(unsafe.Pointer(buf)), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1888,7 +1885,7 @@ func Utime(path string, buf *Utimbuf) (err error) {
 func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_bind)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1898,7 +1895,7 @@ func bind(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) {
 func connect(s int, addr unsafe.Pointer, addrlen _Socklen) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_connect)), 3, uintptr(s), uintptr(addr), uintptr(addrlen), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1909,7 +1906,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmmap)), 6, uintptr(addr), uintptr(length), uintptr(prot), uintptr(flag), uintptr(fd), uintptr(pos))
 	ret = uintptr(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1919,7 +1916,7 @@ func mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (
 func munmap(addr uintptr, length uintptr) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procmunmap)), 2, uintptr(addr), uintptr(length), 0, 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1930,7 +1927,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsendfile)), 4, uintptr(outfd), uintptr(infd), uintptr(unsafe.Pointer(offset)), uintptr(count), 0, 0)
 	written = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1944,7 +1941,7 @@ func sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (
 	}
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_sendto)), 6, uintptr(s), uintptr(unsafe.Pointer(_p0)), uintptr(len(buf)), uintptr(flags), uintptr(to), uintptr(addrlen))
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1955,7 +1952,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socket)), 3, uintptr(domain), uintptr(typ), uintptr(proto), 0, 0, 0)
 	fd = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1965,7 +1962,7 @@ func socket(domain int, typ int, proto int) (fd int, err error) {
 func socketpair(domain int, typ int, proto int, fd *[2]int32) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&proc__xnet_socketpair)), 4, uintptr(domain), uintptr(typ), uintptr(proto), uintptr(unsafe.Pointer(fd)), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1980,7 +1977,7 @@ func write(fd int, p []byte) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procwrite)), 3, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -1990,7 +1987,7 @@ func write(fd int, p []byte) (n int, err error) {
 func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&proc__xnet_getsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(unsafe.Pointer(vallen)), 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2000,7 +1997,7 @@ func getsockopt(s int, level int, name int, val unsafe.Pointer, vallen *_Socklen
 func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) {
 	_, _, e1 := rawSysvicall6(uintptr(unsafe.Pointer(&procgetpeername)), 3, uintptr(fd), uintptr(unsafe.Pointer(rsa)), uintptr(unsafe.Pointer(addrlen)), 0, 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2010,7 +2007,7 @@ func getpeername(fd int, rsa *RawSockaddrAny, addrlen *_Socklen) (err error) {
 func setsockopt(s int, level int, name int, val unsafe.Pointer, vallen uintptr) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procsetsockopt)), 5, uintptr(s), uintptr(level), uintptr(name), uintptr(val), uintptr(vallen), 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2025,7 +2022,7 @@ func recvfrom(fd int, p []byte, flags int, from *RawSockaddrAny, fromlen *_Sockl
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procrecvfrom)), 6, uintptr(fd), uintptr(unsafe.Pointer(_p0)), uintptr(len(p)), uintptr(flags), uintptr(unsafe.Pointer(from)), uintptr(unsafe.Pointer(fromlen)))
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2036,7 +2033,7 @@ func port_create() (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_create)), 0, 0, 0, 0, 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2047,7 +2044,7 @@ func port_associate(port int, source int, object uintptr, events int, user *byte
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_associate)), 5, uintptr(port), uintptr(source), uintptr(object), uintptr(events), uintptr(unsafe.Pointer(user)), 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2058,7 +2055,7 @@ func port_dissociate(port int, source int, object uintptr) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_dissociate)), 3, uintptr(port), uintptr(source), uintptr(object), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2069,7 +2066,7 @@ func port_get(port int, pe *portEvent, timeout *Timespec) (n int, err error) {
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_get)), 3, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(unsafe.Pointer(timeout)), 0, 0, 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2080,7 +2077,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times
 	r0, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procport_getn)), 5, uintptr(port), uintptr(unsafe.Pointer(pe)), uintptr(max), uintptr(unsafe.Pointer(nget)), uintptr(unsafe.Pointer(timeout)), 0)
 	n = int(r0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2090,7 +2087,7 @@ func port_getn(port int, pe *portEvent, max uint32, nget *uint32, timeout *Times
 func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procputmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(flags), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
@@ -2100,7 +2097,7 @@ func putmsg(fd int, clptr *strbuf, dataptr *strbuf, flags int) (err error) {
 func getmsg(fd int, clptr *strbuf, dataptr *strbuf, flags *int) (err error) {
 	_, _, e1 := sysvicall6(uintptr(unsafe.Pointer(&procgetmsg)), 4, uintptr(fd), uintptr(unsafe.Pointer(clptr)), uintptr(unsafe.Pointer(dataptr)), uintptr(unsafe.Pointer(flags)), 0, 0)
 	if e1 != 0 {
-		err = e1
+		err = errnoErr(e1)
 	}
 	return
 }
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go
index f2079457c6b..94f01123831 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_zos_s390x.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
@@ -40,17 +39,6 @@ func read(fd int, p []byte) (n int, err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func readlen(fd int, buf *byte, nbuf int) (n int, err error) {
-	r0, _, e1 := syscall_syscall(SYS_READ, uintptr(fd), uintptr(unsafe.Pointer(buf)), uintptr(nbuf))
-	n = int(r0)
-	if e1 != 0 {
-		err = errnoErr(e1)
-	}
-	return
-}
-
-// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-
 func write(fd int, p []byte) (n int, err error) {
 	var _p0 unsafe.Pointer
 	if len(p) > 0 {
@@ -257,7 +245,17 @@ func munmap(addr uintptr, length uintptr) (err error) {
 
 // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
 
-func ioctl(fd int, req uint, arg uintptr) (err error) {
+func ioctl(fd int, req int, arg uintptr) (err error) {
+	_, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
+	if e1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ioctlPtr(fd int, req int, arg unsafe.Pointer) (err error) {
 	_, _, e1 := syscall_syscall(SYS_IOCTL, uintptr(fd), uintptr(req), uintptr(arg))
 	if e1 != 0 {
 		err = errnoErr(e1)
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
index 55e0484719c..3a58ae819ad 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build 386 && openbsd
-// +build 386,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
index d2243cf83f5..dcb7a0eb729 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build amd64 && openbsd
-// +build amd64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
index 82dc51bd8b5..db5a7bf13c6 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build arm && openbsd
-// +build arm,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go
index cbdda1a4ae2..7be575a7770 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build arm64 && openbsd
-// +build arm64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go
index f55eae1a821..d6e3174c696 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build mips64 && openbsd
-// +build mips64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go
index e44054470b7..ee97157d013 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build ppc64 && openbsd
-// +build ppc64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go
index a0db82fce20..35c3b91d0f4 100644
--- a/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsysctl_openbsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build riscv64 && openbsd
-// +build riscv64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go
index f8298ff9b58..5edda76870b 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && darwin
-// +build amd64,darwin
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go
index 5eb433bbf01..0dc9e8b4d95 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_darwin_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && darwin
-// +build arm64,darwin
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go
index 703675c0c4a..308ddf3a1f4 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_dragonfly_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && dragonfly
-// +build amd64,dragonfly
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
index 4e0d96107b9..418664e3dc2 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && freebsd
-// +build 386,freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
index 01636b838d3..34d0b86d7cc 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && freebsd
-// +build amd64,freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
index ad99bc106a8..b71cf45e2ea 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && freebsd
-// +build arm,freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
index 89dcc427476..e32df1c1ee3 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && freebsd
-// +build arm64,freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go
index ee37aaa0c90..15ad6111f35 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_freebsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && freebsd
-// +build riscv64,freebsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
index c9c4ad0314f..fcf3ecbddee 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && linux
-// +build 386,linux
 
 package unix
 
@@ -447,4 +446,6 @@ const (
 	SYS_PROCESS_MRELEASE             = 448
 	SYS_FUTEX_WAITV                  = 449
 	SYS_SET_MEMPOLICY_HOME_NODE      = 450
+	SYS_CACHESTAT                    = 451
+	SYS_FCHMODAT2                    = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
index 12ff3417c5f..f56dc2504ae 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && linux
-// +build amd64,linux
 
 package unix
 
@@ -369,4 +368,7 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
+	SYS_MAP_SHADOW_STACK        = 453
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
index c3fb5e77ab4..974bf246767 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && linux
-// +build arm,linux
 
 package unix
 
@@ -411,4 +410,6 @@ const (
 	SYS_PROCESS_MRELEASE             = 448
 	SYS_FUTEX_WAITV                  = 449
 	SYS_SET_MEMPOLICY_HOME_NODE      = 450
+	SYS_CACHESTAT                    = 451
+	SYS_FCHMODAT2                    = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
index 358c847a40c..39a2739e231 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && linux
-// +build arm64,linux
 
 package unix
 
@@ -314,4 +313,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go
index 81c4849b161..cf9c9d77e10 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_loong64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build loong64 && linux
-// +build loong64,linux
 
 package unix
 
@@ -308,4 +307,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
index 202a57e9008..10b7362ef44 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips && linux
-// +build mips,linux
 
 package unix
 
@@ -431,4 +430,6 @@ const (
 	SYS_PROCESS_MRELEASE             = 4448
 	SYS_FUTEX_WAITV                  = 4449
 	SYS_SET_MEMPOLICY_HOME_NODE      = 4450
+	SYS_CACHESTAT                    = 4451
+	SYS_FCHMODAT2                    = 4452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
index 1fbceb52d7c..cd4d8b4fd35 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && linux
-// +build mips64,linux
 
 package unix
 
@@ -361,4 +360,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 5448
 	SYS_FUTEX_WAITV             = 5449
 	SYS_SET_MEMPOLICY_HOME_NODE = 5450
+	SYS_CACHESTAT               = 5451
+	SYS_FCHMODAT2               = 5452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
index b4ffb7a207d..2c0efca818b 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mips64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64le && linux
-// +build mips64le,linux
 
 package unix
 
@@ -361,4 +360,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 5448
 	SYS_FUTEX_WAITV             = 5449
 	SYS_SET_MEMPOLICY_HOME_NODE = 5450
+	SYS_CACHESTAT               = 5451
+	SYS_FCHMODAT2               = 5452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
index 867985f9b44..a72e31d391d 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_mipsle.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mipsle && linux
-// +build mipsle,linux
 
 package unix
 
@@ -431,4 +430,6 @@ const (
 	SYS_PROCESS_MRELEASE             = 4448
 	SYS_FUTEX_WAITV                  = 4449
 	SYS_SET_MEMPOLICY_HOME_NODE      = 4450
+	SYS_CACHESTAT                    = 4451
+	SYS_FCHMODAT2                    = 4452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go
index a8cce69ede2..c7d1e374713 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && linux
-// +build ppc,linux
 
 package unix
 
@@ -438,4 +437,6 @@ const (
 	SYS_PROCESS_MRELEASE             = 448
 	SYS_FUTEX_WAITV                  = 449
 	SYS_SET_MEMPOLICY_HOME_NODE      = 450
+	SYS_CACHESTAT                    = 451
+	SYS_FCHMODAT2                    = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
index d44c5b39d79..f4d4838c870 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && linux
-// +build ppc64,linux
 
 package unix
 
@@ -410,4 +409,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
index 4214dd9c03a..b64f0e59114 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_ppc64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64le && linux
-// +build ppc64le,linux
 
 package unix
 
@@ -410,4 +409,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
index 3e594a8c091..95711195a06 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && linux
-// +build riscv64,linux
 
 package unix
 
@@ -251,6 +250,8 @@ const (
 	SYS_ACCEPT4                 = 242
 	SYS_RECVMMSG                = 243
 	SYS_ARCH_SPECIFIC_SYSCALL   = 244
+	SYS_RISCV_HWPROBE           = 258
+	SYS_RISCV_FLUSH_ICACHE      = 259
 	SYS_WAIT4                   = 260
 	SYS_PRLIMIT64               = 261
 	SYS_FANOTIFY_INIT           = 262
@@ -313,4 +314,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
index 7ea465204b7..f94e943bc4f 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_s390x.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build s390x && linux
-// +build s390x,linux
 
 package unix
 
@@ -372,7 +371,10 @@ const (
 	SYS_LANDLOCK_CREATE_RULESET = 444
 	SYS_LANDLOCK_ADD_RULE       = 445
 	SYS_LANDLOCK_RESTRICT_SELF  = 446
+	SYS_MEMFD_SECRET            = 447
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
index 92f628ef4f2..ba0c2bc5154 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_linux_sparc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build sparc64 && linux
-// +build sparc64,linux
 
 package unix
 
@@ -389,4 +388,6 @@ const (
 	SYS_PROCESS_MRELEASE        = 448
 	SYS_FUTEX_WAITV             = 449
 	SYS_SET_MEMPOLICY_HOME_NODE = 450
+	SYS_CACHESTAT               = 451
+	SYS_FCHMODAT2               = 452
 )
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go
index 3a6699eba98..b2aa8cd495e 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && netbsd
-// +build 386,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go
index 5677cd4f158..524a1b1c9a7 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && netbsd
-// +build amd64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go
index e784cb6db1c..d59b943ac22 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && netbsd
-// +build arm,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go
index bd4952efa5b..31e771d53e6 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_netbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; DO NOT EDIT.
 
 //go:build arm64 && netbsd
-// +build arm64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go
index 597733813e3..9fd77c6cb46 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && openbsd
-// +build 386,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go
index 16af2918994..af10af28cbe 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && openbsd
-// +build amd64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go
index f59b18a9779..cc2028af4ba 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && openbsd
-// +build arm,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go
index 721ef591032..c06dd4415a3 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && openbsd
-// +build arm64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go
index 01c43a01fda..9ddbf3e08fd 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && openbsd
-// +build mips64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go
index f258cfa24ed..19a6ee41340 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && openbsd
-// +build ppc64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go
index 07919e0eccd..05192a782d8 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_openbsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && openbsd
-// +build riscv64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go
index 073daad43b7..b2e30858199 100644
--- a/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go
+++ b/vendor/golang.org/x/sys/unix/zsysnum_zos_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
index 7a8161c1d1c..3e6d57cae7f 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && aix
-// +build ppc,aix
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
index 07ed733c51b..3a219bdce7e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_aix_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && aix
-// +build ppc64,aix
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
index e2a64f0991a..091d107f3a5 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && darwin
-// +build amd64,darwin
 
 package unix
 
@@ -151,6 +150,16 @@ type Dirent struct {
 	_       [3]byte
 }
 
+type Attrlist struct {
+	Bitmapcount uint16
+	Reserved    uint16
+	Commonattr  uint32
+	Volattr     uint32
+	Dirattr     uint32
+	Fileattr    uint32
+	Forkattr    uint32
+}
+
 const (
 	PathMax = 0x400
 )
@@ -610,6 +619,7 @@ const (
 	AT_REMOVEDIR        = 0x80
 	AT_SYMLINK_FOLLOW   = 0x40
 	AT_SYMLINK_NOFOLLOW = 0x20
+	AT_EACCESS          = 0x10
 )
 
 type PollFd struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
index 34aa775219f..28ff4ef74d0 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_darwin_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && darwin
-// +build arm64,darwin
 
 package unix
 
@@ -151,6 +150,16 @@ type Dirent struct {
 	_       [3]byte
 }
 
+type Attrlist struct {
+	Bitmapcount uint16
+	Reserved    uint16
+	Commonattr  uint32
+	Volattr     uint32
+	Dirattr     uint32
+	Fileattr    uint32
+	Forkattr    uint32
+}
+
 const (
 	PathMax = 0x400
 )
@@ -610,6 +619,7 @@ const (
 	AT_REMOVEDIR        = 0x80
 	AT_SYMLINK_FOLLOW   = 0x40
 	AT_SYMLINK_NOFOLLOW = 0x20
+	AT_EACCESS          = 0x10
 )
 
 type PollFd struct {
diff --git a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
index d0ba8e9b86a..30e405bb4cd 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_dragonfly_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && dragonfly
-// +build amd64,dragonfly
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
index d9c78cdcbc4..6cbd094a3aa 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && freebsd
-// +build 386,freebsd
 
 package unix
 
@@ -362,7 +361,7 @@ type FpExtendedPrecision struct{}
 type PtraceIoDesc struct {
 	Op   int32
 	Offs uintptr
-	Addr uintptr
+	Addr *byte
 	Len  uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
index 26991b16559..7c03b6ee77f 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && freebsd
-// +build amd64,freebsd
 
 package unix
 
@@ -367,7 +366,7 @@ type FpExtendedPrecision struct{}
 type PtraceIoDesc struct {
 	Op   int32
 	Offs uintptr
-	Addr uintptr
+	Addr *byte
 	Len  uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
index f8324e7e7f4..422107ee8b1 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && freebsd
-// +build arm,freebsd
 
 package unix
 
@@ -350,7 +349,7 @@ type FpExtendedPrecision struct {
 type PtraceIoDesc struct {
 	Op   int32
 	Offs uintptr
-	Addr uintptr
+	Addr *byte
 	Len  uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
index 4220411f341..505a12acfd9 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && freebsd
-// +build arm64,freebsd
 
 package unix
 
@@ -347,7 +346,7 @@ type FpExtendedPrecision struct{}
 type PtraceIoDesc struct {
 	Op   int32
 	Offs uintptr
-	Addr uintptr
+	Addr *byte
 	Len  uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go
index 0660fd45c7c..cc986c79006 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_freebsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && freebsd
-// +build riscv64,freebsd
 
 package unix
 
@@ -348,7 +347,7 @@ type FpExtendedPrecision struct{}
 type PtraceIoDesc struct {
 	Op   int32
 	Offs uintptr
-	Addr uintptr
+	Addr *byte
 	Len  uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go
index 7d9fc8f1c91..bbf8399ff58 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go
@@ -1,7 +1,6 @@
 // Code generated by mkmerge; DO NOT EDIT.
 
 //go:build linux
-// +build linux
 
 package unix
 
@@ -456,36 +455,60 @@ type Ucred struct {
 }
 
 type TCPInfo struct {
-	State          uint8
-	Ca_state       uint8
-	Retransmits    uint8
-	Probes         uint8
-	Backoff        uint8
-	Options        uint8
-	Rto            uint32
-	Ato            uint32
-	Snd_mss        uint32
-	Rcv_mss        uint32
-	Unacked        uint32
-	Sacked         uint32
-	Lost           uint32
-	Retrans        uint32
-	Fackets        uint32
-	Last_data_sent uint32
-	Last_ack_sent  uint32
-	Last_data_recv uint32
-	Last_ack_recv  uint32
-	Pmtu           uint32
-	Rcv_ssthresh   uint32
-	Rtt            uint32
-	Rttvar         uint32
-	Snd_ssthresh   uint32
-	Snd_cwnd       uint32
-	Advmss         uint32
-	Reordering     uint32
-	Rcv_rtt        uint32
-	Rcv_space      uint32
-	Total_retrans  uint32
+	State           uint8
+	Ca_state        uint8
+	Retransmits     uint8
+	Probes          uint8
+	Backoff         uint8
+	Options         uint8
+	Rto             uint32
+	Ato             uint32
+	Snd_mss         uint32
+	Rcv_mss         uint32
+	Unacked         uint32
+	Sacked          uint32
+	Lost            uint32
+	Retrans         uint32
+	Fackets         uint32
+	Last_data_sent  uint32
+	Last_ack_sent   uint32
+	Last_data_recv  uint32
+	Last_ack_recv   uint32
+	Pmtu            uint32
+	Rcv_ssthresh    uint32
+	Rtt             uint32
+	Rttvar          uint32
+	Snd_ssthresh    uint32
+	Snd_cwnd        uint32
+	Advmss          uint32
+	Reordering      uint32
+	Rcv_rtt         uint32
+	Rcv_space       uint32
+	Total_retrans   uint32
+	Pacing_rate     uint64
+	Max_pacing_rate uint64
+	Bytes_acked     uint64
+	Bytes_received  uint64
+	Segs_out        uint32
+	Segs_in         uint32
+	Notsent_bytes   uint32
+	Min_rtt         uint32
+	Data_segs_in    uint32
+	Data_segs_out   uint32
+	Delivery_rate   uint64
+	Busy_time       uint64
+	Rwnd_limited    uint64
+	Sndbuf_limited  uint64
+	Delivered       uint32
+	Delivered_ce    uint32
+	Bytes_sent      uint64
+	Bytes_retrans   uint64
+	Dsack_dups      uint32
+	Reord_seen      uint32
+	Rcv_ooopack     uint32
+	Snd_wnd         uint32
+	Rcv_wnd         uint32
+	Rehash          uint32
 }
 
 type CanFilter struct {
@@ -528,7 +551,7 @@ const (
 	SizeofIPv6MTUInfo       = 0x20
 	SizeofICMPv6Filter      = 0x20
 	SizeofUcred             = 0xc
-	SizeofTCPInfo           = 0x68
+	SizeofTCPInfo           = 0xf0
 	SizeofCanFilter         = 0x8
 	SizeofTCPRepairOpt      = 0x8
 )
@@ -842,6 +865,11 @@ const (
 	POLLNVAL = 0x20
 )
 
+type sigset_argpack struct {
+	ss    *Sigset_t
+	ssLen uintptr
+}
+
 type SignalfdSiginfo struct {
 	Signo     uint32
 	Errno     int32
@@ -1043,6 +1071,7 @@ const (
 	PerfBitCommExec                      = CBitFieldMaskBit24
 	PerfBitUseClockID                    = CBitFieldMaskBit25
 	PerfBitContextSwitch                 = CBitFieldMaskBit26
+	PerfBitWriteBackward                 = CBitFieldMaskBit27
 )
 
 const (
@@ -1239,7 +1268,7 @@ type TCPMD5Sig struct {
 	Flags     uint8
 	Prefixlen uint8
 	Keylen    uint16
-	_         uint32
+	Ifindex   int32
 	Key       [80]uint8
 }
 
@@ -1513,6 +1542,10 @@ const (
 	IFLA_GRO_MAX_SIZE                          = 0x3a
 	IFLA_TSO_MAX_SIZE                          = 0x3b
 	IFLA_TSO_MAX_SEGS                          = 0x3c
+	IFLA_ALLMULTI                              = 0x3d
+	IFLA_DEVLINK_PORT                          = 0x3e
+	IFLA_GSO_IPV4_MAX_SIZE                     = 0x3f
+	IFLA_GRO_IPV4_MAX_SIZE                     = 0x40
 	IFLA_PROTO_DOWN_REASON_UNSPEC              = 0x0
 	IFLA_PROTO_DOWN_REASON_MASK                = 0x1
 	IFLA_PROTO_DOWN_REASON_VALUE               = 0x2
@@ -1939,7 +1972,11 @@ const (
 	NFT_MSG_GETOBJ                    = 0x13
 	NFT_MSG_DELOBJ                    = 0x14
 	NFT_MSG_GETOBJ_RESET              = 0x15
-	NFT_MSG_MAX                       = 0x19
+	NFT_MSG_NEWFLOWTABLE              = 0x16
+	NFT_MSG_GETFLOWTABLE              = 0x17
+	NFT_MSG_DELFLOWTABLE              = 0x18
+	NFT_MSG_GETRULE_RESET             = 0x19
+	NFT_MSG_MAX                       = 0x22
 	NFTA_LIST_UNSPEC                  = 0x0
 	NFTA_LIST_ELEM                    = 0x1
 	NFTA_HOOK_UNSPEC                  = 0x0
@@ -2443,9 +2480,11 @@ const (
 	SOF_TIMESTAMPING_OPT_STATS    = 0x1000
 	SOF_TIMESTAMPING_OPT_PKTINFO  = 0x2000
 	SOF_TIMESTAMPING_OPT_TX_SWHW  = 0x4000
+	SOF_TIMESTAMPING_BIND_PHC     = 0x8000
+	SOF_TIMESTAMPING_OPT_ID_TCP   = 0x10000
 
-	SOF_TIMESTAMPING_LAST = 0x8000
-	SOF_TIMESTAMPING_MASK = 0xffff
+	SOF_TIMESTAMPING_LAST = 0x10000
+	SOF_TIMESTAMPING_MASK = 0x1ffff
 
 	SCM_TSTAMP_SND   = 0x0
 	SCM_TSTAMP_SCHED = 0x1
@@ -2524,6 +2563,11 @@ const (
 	BPF_REG_8                                  = 0x8
 	BPF_REG_9                                  = 0x9
 	BPF_REG_10                                 = 0xa
+	BPF_CGROUP_ITER_ORDER_UNSPEC               = 0x0
+	BPF_CGROUP_ITER_SELF_ONLY                  = 0x1
+	BPF_CGROUP_ITER_DESCENDANTS_PRE            = 0x2
+	BPF_CGROUP_ITER_DESCENDANTS_POST           = 0x3
+	BPF_CGROUP_ITER_ANCESTORS_UP               = 0x4
 	BPF_MAP_CREATE                             = 0x0
 	BPF_MAP_LOOKUP_ELEM                        = 0x1
 	BPF_MAP_UPDATE_ELEM                        = 0x2
@@ -2535,6 +2579,7 @@ const (
 	BPF_PROG_ATTACH                            = 0x8
 	BPF_PROG_DETACH                            = 0x9
 	BPF_PROG_TEST_RUN                          = 0xa
+	BPF_PROG_RUN                               = 0xa
 	BPF_PROG_GET_NEXT_ID                       = 0xb
 	BPF_MAP_GET_NEXT_ID                        = 0xc
 	BPF_PROG_GET_FD_BY_ID                      = 0xd
@@ -2579,6 +2624,7 @@ const (
 	BPF_MAP_TYPE_CPUMAP                        = 0x10
 	BPF_MAP_TYPE_XSKMAP                        = 0x11
 	BPF_MAP_TYPE_SOCKHASH                      = 0x12
+	BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED     = 0x13
 	BPF_MAP_TYPE_CGROUP_STORAGE                = 0x13
 	BPF_MAP_TYPE_REUSEPORT_SOCKARRAY           = 0x14
 	BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE         = 0x15
@@ -2589,6 +2635,10 @@ const (
 	BPF_MAP_TYPE_STRUCT_OPS                    = 0x1a
 	BPF_MAP_TYPE_RINGBUF                       = 0x1b
 	BPF_MAP_TYPE_INODE_STORAGE                 = 0x1c
+	BPF_MAP_TYPE_TASK_STORAGE                  = 0x1d
+	BPF_MAP_TYPE_BLOOM_FILTER                  = 0x1e
+	BPF_MAP_TYPE_USER_RINGBUF                  = 0x1f
+	BPF_MAP_TYPE_CGRP_STORAGE                  = 0x20
 	BPF_PROG_TYPE_UNSPEC                       = 0x0
 	BPF_PROG_TYPE_SOCKET_FILTER                = 0x1
 	BPF_PROG_TYPE_KPROBE                       = 0x2
@@ -2620,6 +2670,8 @@ const (
 	BPF_PROG_TYPE_EXT                          = 0x1c
 	BPF_PROG_TYPE_LSM                          = 0x1d
 	BPF_PROG_TYPE_SK_LOOKUP                    = 0x1e
+	BPF_PROG_TYPE_SYSCALL                      = 0x1f
+	BPF_PROG_TYPE_NETFILTER                    = 0x20
 	BPF_CGROUP_INET_INGRESS                    = 0x0
 	BPF_CGROUP_INET_EGRESS                     = 0x1
 	BPF_CGROUP_INET_SOCK_CREATE                = 0x2
@@ -2658,6 +2710,17 @@ const (
 	BPF_XDP_CPUMAP                             = 0x23
 	BPF_SK_LOOKUP                              = 0x24
 	BPF_XDP                                    = 0x25
+	BPF_SK_SKB_VERDICT                         = 0x26
+	BPF_SK_REUSEPORT_SELECT                    = 0x27
+	BPF_SK_REUSEPORT_SELECT_OR_MIGRATE         = 0x28
+	BPF_PERF_EVENT                             = 0x29
+	BPF_TRACE_KPROBE_MULTI                     = 0x2a
+	BPF_LSM_CGROUP                             = 0x2b
+	BPF_STRUCT_OPS                             = 0x2c
+	BPF_NETFILTER                              = 0x2d
+	BPF_TCX_INGRESS                            = 0x2e
+	BPF_TCX_EGRESS                             = 0x2f
+	BPF_TRACE_UPROBE_MULTI                     = 0x30
 	BPF_LINK_TYPE_UNSPEC                       = 0x0
 	BPF_LINK_TYPE_RAW_TRACEPOINT               = 0x1
 	BPF_LINK_TYPE_TRACING                      = 0x2
@@ -2665,6 +2728,21 @@ const (
 	BPF_LINK_TYPE_ITER                         = 0x4
 	BPF_LINK_TYPE_NETNS                        = 0x5
 	BPF_LINK_TYPE_XDP                          = 0x6
+	BPF_LINK_TYPE_PERF_EVENT                   = 0x7
+	BPF_LINK_TYPE_KPROBE_MULTI                 = 0x8
+	BPF_LINK_TYPE_STRUCT_OPS                   = 0x9
+	BPF_LINK_TYPE_NETFILTER                    = 0xa
+	BPF_LINK_TYPE_TCX                          = 0xb
+	BPF_LINK_TYPE_UPROBE_MULTI                 = 0xc
+	BPF_PERF_EVENT_UNSPEC                      = 0x0
+	BPF_PERF_EVENT_UPROBE                      = 0x1
+	BPF_PERF_EVENT_URETPROBE                   = 0x2
+	BPF_PERF_EVENT_KPROBE                      = 0x3
+	BPF_PERF_EVENT_KRETPROBE                   = 0x4
+	BPF_PERF_EVENT_TRACEPOINT                  = 0x5
+	BPF_PERF_EVENT_EVENT                       = 0x6
+	BPF_F_KPROBE_MULTI_RETURN                  = 0x1
+	BPF_F_UPROBE_MULTI_RETURN                  = 0x1
 	BPF_ANY                                    = 0x0
 	BPF_NOEXIST                                = 0x1
 	BPF_EXIST                                  = 0x2
@@ -2682,6 +2760,8 @@ const (
 	BPF_F_MMAPABLE                             = 0x400
 	BPF_F_PRESERVE_ELEMS                       = 0x800
 	BPF_F_INNER_MAP                            = 0x1000
+	BPF_F_LINK                                 = 0x2000
+	BPF_F_PATH_FD                              = 0x4000
 	BPF_STATS_RUN_TIME                         = 0x0
 	BPF_STACK_BUILD_ID_EMPTY                   = 0x0
 	BPF_STACK_BUILD_ID_VALID                   = 0x1
@@ -2702,6 +2782,8 @@ const (
 	BPF_F_ZERO_CSUM_TX                         = 0x2
 	BPF_F_DONT_FRAGMENT                        = 0x4
 	BPF_F_SEQ_NUMBER                           = 0x8
+	BPF_F_NO_TUNNEL_KEY                        = 0x10
+	BPF_F_TUNINFO_FLAGS                        = 0x10
 	BPF_F_INDEX_MASK                           = 0xffffffff
 	BPF_F_CURRENT_CPU                          = 0xffffffff
 	BPF_F_CTXLEN_MASK                          = 0xfffff00000000
@@ -2716,6 +2798,9 @@ const (
 	BPF_F_ADJ_ROOM_ENCAP_L4_GRE                = 0x8
 	BPF_F_ADJ_ROOM_ENCAP_L4_UDP                = 0x10
 	BPF_F_ADJ_ROOM_NO_CSUM_RESET               = 0x20
+	BPF_F_ADJ_ROOM_ENCAP_L2_ETH                = 0x40
+	BPF_F_ADJ_ROOM_DECAP_L3_IPV4               = 0x80
+	BPF_F_ADJ_ROOM_DECAP_L3_IPV6               = 0x100
 	BPF_ADJ_ROOM_ENCAP_L2_MASK                 = 0xff
 	BPF_ADJ_ROOM_ENCAP_L2_SHIFT                = 0x38
 	BPF_F_SYSCTL_BASE_NAME                     = 0x1
@@ -2740,10 +2825,16 @@ const (
 	BPF_LWT_ENCAP_SEG6                         = 0x0
 	BPF_LWT_ENCAP_SEG6_INLINE                  = 0x1
 	BPF_LWT_ENCAP_IP                           = 0x2
+	BPF_F_BPRM_SECUREEXEC                      = 0x1
+	BPF_F_BROADCAST                            = 0x8
+	BPF_F_EXCLUDE_INGRESS                      = 0x10
+	BPF_SKB_TSTAMP_UNSPEC                      = 0x0
+	BPF_SKB_TSTAMP_DELIVERY_MONO               = 0x1
 	BPF_OK                                     = 0x0
 	BPF_DROP                                   = 0x2
 	BPF_REDIRECT                               = 0x7
 	BPF_LWT_REROUTE                            = 0x80
+	BPF_FLOW_DISSECTOR_CONTINUE                = 0x81
 	BPF_SOCK_OPS_RTO_CB_FLAG                   = 0x1
 	BPF_SOCK_OPS_RETRANS_CB_FLAG               = 0x2
 	BPF_SOCK_OPS_STATE_CB_FLAG                 = 0x4
@@ -2798,6 +2889,8 @@ const (
 	BPF_DEVCG_DEV_CHAR                         = 0x2
 	BPF_FIB_LOOKUP_DIRECT                      = 0x1
 	BPF_FIB_LOOKUP_OUTPUT                      = 0x2
+	BPF_FIB_LOOKUP_SKIP_NEIGH                  = 0x4
+	BPF_FIB_LOOKUP_TBID                        = 0x8
 	BPF_FIB_LKUP_RET_SUCCESS                   = 0x0
 	BPF_FIB_LKUP_RET_BLACKHOLE                 = 0x1
 	BPF_FIB_LKUP_RET_UNREACHABLE               = 0x2
@@ -2807,6 +2900,10 @@ const (
 	BPF_FIB_LKUP_RET_UNSUPP_LWT                = 0x6
 	BPF_FIB_LKUP_RET_NO_NEIGH                  = 0x7
 	BPF_FIB_LKUP_RET_FRAG_NEEDED               = 0x8
+	BPF_MTU_CHK_SEGS                           = 0x1
+	BPF_MTU_CHK_RET_SUCCESS                    = 0x0
+	BPF_MTU_CHK_RET_FRAG_NEEDED                = 0x1
+	BPF_MTU_CHK_RET_SEGS_TOOBIG                = 0x2
 	BPF_FD_TYPE_RAW_TRACEPOINT                 = 0x0
 	BPF_FD_TYPE_TRACEPOINT                     = 0x1
 	BPF_FD_TYPE_KPROBE                         = 0x2
@@ -2816,6 +2913,20 @@ const (
 	BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG        = 0x1
 	BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL    = 0x2
 	BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP         = 0x4
+	BPF_CORE_FIELD_BYTE_OFFSET                 = 0x0
+	BPF_CORE_FIELD_BYTE_SIZE                   = 0x1
+	BPF_CORE_FIELD_EXISTS                      = 0x2
+	BPF_CORE_FIELD_SIGNED                      = 0x3
+	BPF_CORE_FIELD_LSHIFT_U64                  = 0x4
+	BPF_CORE_FIELD_RSHIFT_U64                  = 0x5
+	BPF_CORE_TYPE_ID_LOCAL                     = 0x6
+	BPF_CORE_TYPE_ID_TARGET                    = 0x7
+	BPF_CORE_TYPE_EXISTS                       = 0x8
+	BPF_CORE_TYPE_SIZE                         = 0x9
+	BPF_CORE_ENUMVAL_EXISTS                    = 0xa
+	BPF_CORE_ENUMVAL_VALUE                     = 0xb
+	BPF_CORE_TYPE_MATCHES                      = 0xc
+	BPF_F_TIMER_ABS                            = 0x1
 )
 
 const (
@@ -2894,6 +3005,12 @@ type LoopInfo64 struct {
 	Encrypt_key      [32]uint8
 	Init             [2]uint64
 }
+type LoopConfig struct {
+	Fd   uint32
+	Size uint32
+	Info LoopInfo64
+	_    [8]uint64
+}
 
 type TIPCSocketAddr struct {
 	Ref  uint32
@@ -3265,7 +3382,7 @@ const (
 	DEVLINK_ATTR_LINECARD_SUPPORTED_TYPES              = 0xae
 	DEVLINK_ATTR_NESTED_DEVLINK                        = 0xaf
 	DEVLINK_ATTR_SELFTESTS                             = 0xb0
-	DEVLINK_ATTR_MAX                                   = 0xb0
+	DEVLINK_ATTR_MAX                                   = 0xb3
 	DEVLINK_DPIPE_FIELD_MAPPING_TYPE_NONE              = 0x0
 	DEVLINK_DPIPE_FIELD_MAPPING_TYPE_IFINDEX           = 0x1
 	DEVLINK_DPIPE_MATCH_TYPE_FIELD_EXACT               = 0x0
@@ -3281,7 +3398,8 @@ const (
 	DEVLINK_PORT_FUNCTION_ATTR_HW_ADDR                 = 0x1
 	DEVLINK_PORT_FN_ATTR_STATE                         = 0x2
 	DEVLINK_PORT_FN_ATTR_OPSTATE                       = 0x3
-	DEVLINK_PORT_FUNCTION_ATTR_MAX                     = 0x3
+	DEVLINK_PORT_FN_ATTR_CAPS                          = 0x4
+	DEVLINK_PORT_FUNCTION_ATTR_MAX                     = 0x4
 )
 
 type FsverityDigest struct {
@@ -3572,7 +3690,8 @@ const (
 	ETHTOOL_MSG_MODULE_SET                    = 0x23
 	ETHTOOL_MSG_PSE_GET                       = 0x24
 	ETHTOOL_MSG_PSE_SET                       = 0x25
-	ETHTOOL_MSG_USER_MAX                      = 0x25
+	ETHTOOL_MSG_RSS_GET                       = 0x26
+	ETHTOOL_MSG_USER_MAX                      = 0x2b
 	ETHTOOL_MSG_KERNEL_NONE                   = 0x0
 	ETHTOOL_MSG_STRSET_GET_REPLY              = 0x1
 	ETHTOOL_MSG_LINKINFO_GET_REPLY            = 0x2
@@ -3611,7 +3730,8 @@ const (
 	ETHTOOL_MSG_MODULE_GET_REPLY              = 0x23
 	ETHTOOL_MSG_MODULE_NTF                    = 0x24
 	ETHTOOL_MSG_PSE_GET_REPLY                 = 0x25
-	ETHTOOL_MSG_KERNEL_MAX                    = 0x25
+	ETHTOOL_MSG_RSS_GET_REPLY                 = 0x26
+	ETHTOOL_MSG_KERNEL_MAX                    = 0x2b
 	ETHTOOL_A_HEADER_UNSPEC                   = 0x0
 	ETHTOOL_A_HEADER_DEV_INDEX                = 0x1
 	ETHTOOL_A_HEADER_DEV_NAME                 = 0x2
@@ -3679,7 +3799,8 @@ const (
 	ETHTOOL_A_LINKSTATE_SQI_MAX               = 0x4
 	ETHTOOL_A_LINKSTATE_EXT_STATE             = 0x5
 	ETHTOOL_A_LINKSTATE_EXT_SUBSTATE          = 0x6
-	ETHTOOL_A_LINKSTATE_MAX                   = 0x6
+	ETHTOOL_A_LINKSTATE_EXT_DOWN_CNT          = 0x7
+	ETHTOOL_A_LINKSTATE_MAX                   = 0x7
 	ETHTOOL_A_DEBUG_UNSPEC                    = 0x0
 	ETHTOOL_A_DEBUG_HEADER                    = 0x1
 	ETHTOOL_A_DEBUG_MSGMASK                   = 0x2
@@ -3714,7 +3835,7 @@ const (
 	ETHTOOL_A_RINGS_TCP_DATA_SPLIT            = 0xb
 	ETHTOOL_A_RINGS_CQE_SIZE                  = 0xc
 	ETHTOOL_A_RINGS_TX_PUSH                   = 0xd
-	ETHTOOL_A_RINGS_MAX                       = 0xd
+	ETHTOOL_A_RINGS_MAX                       = 0x10
 	ETHTOOL_A_CHANNELS_UNSPEC                 = 0x0
 	ETHTOOL_A_CHANNELS_HEADER                 = 0x1
 	ETHTOOL_A_CHANNELS_RX_MAX                 = 0x2
@@ -3752,14 +3873,14 @@ const (
 	ETHTOOL_A_COALESCE_RATE_SAMPLE_INTERVAL   = 0x17
 	ETHTOOL_A_COALESCE_USE_CQE_MODE_TX        = 0x18
 	ETHTOOL_A_COALESCE_USE_CQE_MODE_RX        = 0x19
-	ETHTOOL_A_COALESCE_MAX                    = 0x19
+	ETHTOOL_A_COALESCE_MAX                    = 0x1c
 	ETHTOOL_A_PAUSE_UNSPEC                    = 0x0
 	ETHTOOL_A_PAUSE_HEADER                    = 0x1
 	ETHTOOL_A_PAUSE_AUTONEG                   = 0x2
 	ETHTOOL_A_PAUSE_RX                        = 0x3
 	ETHTOOL_A_PAUSE_TX                        = 0x4
 	ETHTOOL_A_PAUSE_STATS                     = 0x5
-	ETHTOOL_A_PAUSE_MAX                       = 0x5
+	ETHTOOL_A_PAUSE_MAX                       = 0x6
 	ETHTOOL_A_PAUSE_STAT_UNSPEC               = 0x0
 	ETHTOOL_A_PAUSE_STAT_PAD                  = 0x1
 	ETHTOOL_A_PAUSE_STAT_TX_FRAMES            = 0x2
@@ -4409,7 +4530,7 @@ const (
 	NL80211_ATTR_MAC_HINT                                   = 0xc8
 	NL80211_ATTR_MAC_MASK                                   = 0xd7
 	NL80211_ATTR_MAX_AP_ASSOC_STA                           = 0xca
-	NL80211_ATTR_MAX                                        = 0x140
+	NL80211_ATTR_MAX                                        = 0x146
 	NL80211_ATTR_MAX_CRIT_PROT_DURATION                     = 0xb4
 	NL80211_ATTR_MAX_CSA_COUNTERS                           = 0xce
 	NL80211_ATTR_MAX_MATCH_SETS                             = 0x85
@@ -4552,6 +4673,7 @@ const (
 	NL80211_ATTR_SUPPORT_MESH_AUTH                          = 0x73
 	NL80211_ATTR_SURVEY_INFO                                = 0x54
 	NL80211_ATTR_SURVEY_RADIO_STATS                         = 0xda
+	NL80211_ATTR_TD_BITMAP                                  = 0x141
 	NL80211_ATTR_TDLS_ACTION                                = 0x88
 	NL80211_ATTR_TDLS_DIALOG_TOKEN                          = 0x89
 	NL80211_ATTR_TDLS_EXTERNAL_SETUP                        = 0x8c
@@ -4637,7 +4759,7 @@ const (
 	NL80211_BAND_ATTR_HT_CAPA                               = 0x4
 	NL80211_BAND_ATTR_HT_MCS_SET                            = 0x3
 	NL80211_BAND_ATTR_IFTYPE_DATA                           = 0x9
-	NL80211_BAND_ATTR_MAX                                   = 0xb
+	NL80211_BAND_ATTR_MAX                                   = 0xd
 	NL80211_BAND_ATTR_RATES                                 = 0x2
 	NL80211_BAND_ATTR_VHT_CAPA                              = 0x8
 	NL80211_BAND_ATTR_VHT_MCS_SET                           = 0x7
@@ -4778,7 +4900,7 @@ const (
 	NL80211_CMD_LEAVE_IBSS                                  = 0x2c
 	NL80211_CMD_LEAVE_MESH                                  = 0x45
 	NL80211_CMD_LEAVE_OCB                                   = 0x6d
-	NL80211_CMD_MAX                                         = 0x98
+	NL80211_CMD_MAX                                         = 0x9a
 	NL80211_CMD_MICHAEL_MIC_FAILURE                         = 0x29
 	NL80211_CMD_MODIFY_LINK_STA                             = 0x97
 	NL80211_CMD_NAN_MATCH                                   = 0x78
@@ -5412,7 +5534,7 @@ const (
 	NL80211_RATE_INFO_HE_RU_ALLOC_52                        = 0x1
 	NL80211_RATE_INFO_HE_RU_ALLOC_996                       = 0x5
 	NL80211_RATE_INFO_HE_RU_ALLOC                           = 0x11
-	NL80211_RATE_INFO_MAX                                   = 0x16
+	NL80211_RATE_INFO_MAX                                   = 0x1d
 	NL80211_RATE_INFO_MCS                                   = 0x2
 	NL80211_RATE_INFO_SHORT_GI                              = 0x4
 	NL80211_RATE_INFO_VHT_MCS                               = 0x6
@@ -5752,3 +5874,55 @@ const (
 	AUDIT_NLGRP_NONE    = 0x0
 	AUDIT_NLGRP_READLOG = 0x1
 )
+
+const (
+	TUN_F_CSUM    = 0x1
+	TUN_F_TSO4    = 0x2
+	TUN_F_TSO6    = 0x4
+	TUN_F_TSO_ECN = 0x8
+	TUN_F_UFO     = 0x10
+	TUN_F_USO4    = 0x20
+	TUN_F_USO6    = 0x40
+)
+
+const (
+	VIRTIO_NET_HDR_F_NEEDS_CSUM = 0x1
+	VIRTIO_NET_HDR_F_DATA_VALID = 0x2
+	VIRTIO_NET_HDR_F_RSC_INFO   = 0x4
+)
+
+const (
+	VIRTIO_NET_HDR_GSO_NONE   = 0x0
+	VIRTIO_NET_HDR_GSO_TCPV4  = 0x1
+	VIRTIO_NET_HDR_GSO_UDP    = 0x3
+	VIRTIO_NET_HDR_GSO_TCPV6  = 0x4
+	VIRTIO_NET_HDR_GSO_UDP_L4 = 0x5
+	VIRTIO_NET_HDR_GSO_ECN    = 0x80
+)
+
+type SchedAttr struct {
+	Size     uint32
+	Policy   uint32
+	Flags    uint64
+	Nice     int32
+	Priority uint32
+	Runtime  uint64
+	Deadline uint64
+	Period   uint64
+	Util_min uint32
+	Util_max uint32
+}
+
+const SizeofSchedAttr = 0x38
+
+type Cachestat_t struct {
+	Cache            uint64
+	Dirty            uint64
+	Writeback        uint64
+	Evicted          uint64
+	Recently_evicted uint64
+}
+type CachestatRange struct {
+	Off uint64
+	Len uint64
+}
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
index 89c516a29ac..438a30affad 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && linux
-// +build 386,linux
 
 package unix
 
@@ -337,6 +336,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint32
@@ -414,7 +415,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [122]int8
+	Data   [122]byte
 	_      uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
index 62b4fb26996..adceca3553b 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && linux
-// +build amd64,linux
 
 package unix
 
@@ -350,6 +349,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -427,7 +428,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
index e86b35893ec..eeaa00a37d6 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && linux
-// +build arm,linux
 
 package unix
 
@@ -328,6 +327,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint32
@@ -405,7 +406,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [122]uint8
+	Data   [122]byte
 	_      uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
index 6c6be4c911d..6739aa91d4e 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && linux
-// +build arm64,linux
 
 package unix
 
@@ -329,6 +328,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -406,7 +407,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go
index 4982ea355a2..9920ef6317d 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_loong64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build loong64 && linux
-// +build loong64,linux
 
 package unix
 
@@ -330,6 +329,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -407,7 +408,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
index 173141a6703..2923b799a48 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips && linux
-// +build mips,linux
 
 package unix
 
@@ -333,6 +332,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint32
@@ -410,7 +411,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [122]int8
+	Data   [122]byte
 	_      uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
index 93ae4c51673..ce2750ee415 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && linux
-// +build mips64,linux
 
 package unix
 
@@ -332,6 +331,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -409,7 +410,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
index 4e4e510ca51..3038811d70b 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mips64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64le && linux
-// +build mips64le,linux
 
 package unix
 
@@ -332,6 +331,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -409,7 +410,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
index 3f5ba013d99..efc6fed18c1 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_mipsle.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mipsle && linux
-// +build mipsle,linux
 
 package unix
 
@@ -333,6 +332,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint32
@@ -410,7 +411,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [122]int8
+	Data   [122]byte
 	_      uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go
index 71dfe7cdb47..9a654b75a90 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && linux
-// +build ppc,linux
 
 package unix
 
@@ -340,6 +339,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint32
@@ -417,7 +418,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [122]uint8
+	Data   [122]byte
 	_      uint32
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
index 3a2b7f0a666..40d358e33e3 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && linux
-// +build ppc64,linux
 
 package unix
 
@@ -339,6 +338,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -416,7 +417,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]uint8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
index a52d6275632..148c6ceb869 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_ppc64le.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64le && linux
-// +build ppc64le,linux
 
 package unix
 
@@ -339,6 +338,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -416,7 +417,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]uint8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
index dfc007d8a69..72ba81543ef 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && linux
-// +build riscv64,linux
 
 package unix
 
@@ -357,6 +356,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -434,7 +435,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]uint8
+	Data   [118]byte
 	_      uint64
 }
 
@@ -716,3 +717,30 @@ type SysvShmDesc struct {
 	_      uint64
 	_      uint64
 }
+
+type RISCVHWProbePairs struct {
+	Key   int64
+	Value uint64
+}
+
+const (
+	RISCV_HWPROBE_KEY_MVENDORID          = 0x0
+	RISCV_HWPROBE_KEY_MARCHID            = 0x1
+	RISCV_HWPROBE_KEY_MIMPID             = 0x2
+	RISCV_HWPROBE_KEY_BASE_BEHAVIOR      = 0x3
+	RISCV_HWPROBE_BASE_BEHAVIOR_IMA      = 0x1
+	RISCV_HWPROBE_KEY_IMA_EXT_0          = 0x4
+	RISCV_HWPROBE_IMA_FD                 = 0x1
+	RISCV_HWPROBE_IMA_C                  = 0x2
+	RISCV_HWPROBE_IMA_V                  = 0x4
+	RISCV_HWPROBE_EXT_ZBA                = 0x8
+	RISCV_HWPROBE_EXT_ZBB                = 0x10
+	RISCV_HWPROBE_EXT_ZBS                = 0x20
+	RISCV_HWPROBE_KEY_CPUPERF_0          = 0x5
+	RISCV_HWPROBE_MISALIGNED_UNKNOWN     = 0x0
+	RISCV_HWPROBE_MISALIGNED_EMULATED    = 0x1
+	RISCV_HWPROBE_MISALIGNED_SLOW        = 0x2
+	RISCV_HWPROBE_MISALIGNED_FAST        = 0x3
+	RISCV_HWPROBE_MISALIGNED_UNSUPPORTED = 0x4
+	RISCV_HWPROBE_MISALIGNED_MASK        = 0x7
+)
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
index b53cb9103d3..71e765508e2 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_s390x.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build s390x && linux
-// +build s390x,linux
 
 package unix
 
@@ -352,6 +351,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -429,7 +430,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
index fe0aa354728..4abbdb9de93 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux_sparc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build sparc64 && linux
-// +build sparc64,linux
 
 package unix
 
@@ -334,6 +333,8 @@ type Taskstats struct {
 	Ac_exe_inode              uint64
 	Wpcopy_count              uint64
 	Wpcopy_delay_total        uint64
+	Irq_count                 uint64
+	Irq_delay_total           uint64
 }
 
 type cpuMask uint64
@@ -411,7 +412,7 @@ const (
 
 type SockaddrStorage struct {
 	Family uint16
-	_      [118]int8
+	Data   [118]byte
 	_      uint64
 }
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
index 9bc4c8f9d88..f22e7947d94 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && netbsd
-// +build 386,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
index bb05f655d22..066a7d83d29 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && netbsd
-// +build amd64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
index db40e3a19c6..439548ec9ad 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && netbsd
-// +build arm,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
index 11121151ccf..16085d3bbcc 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_netbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && netbsd
-// +build arm64,netbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
index 26eba23b729..afd13a3af7b 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_386.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && openbsd
-// +build 386,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
index 5a547988698..5d97f1f9b65 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && openbsd
-// +build amd64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
index be58c4e1ff8..34871cdc159 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && openbsd
-// +build arm,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go
index 52338266cb3..5911bceb319 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_arm64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && openbsd
-// +build arm64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go
index 605cfdb12b1..e4f24f3bc9a 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_mips64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && openbsd
-// +build mips64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go
index d6724c0102c..ca50a793035 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_ppc64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && openbsd
-// +build ppc64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go
index ddfd27a434a..d7d7f79023f 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_openbsd_riscv64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build riscv64 && openbsd
-// +build riscv64,openbsd
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go
index 0400747c67d..14160576d28 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_solaris_amd64.go
@@ -2,7 +2,6 @@
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && solaris
-// +build amd64,solaris
 
 package unix
 
diff --git a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go
index aec1efcb306..54f31be6373 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_zos_s390x.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build zos && s390x
-// +build zos,s390x
 
 // Hand edited based on ztypes_linux_s390x.go
 // TODO: auto-generate.
diff --git a/vendor/golang.org/x/sys/windows/aliases.go b/vendor/golang.org/x/sys/windows/aliases.go
index a20ebea6331..ce2d713d62e 100644
--- a/vendor/golang.org/x/sys/windows/aliases.go
+++ b/vendor/golang.org/x/sys/windows/aliases.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows && go1.9
-// +build windows,go1.9
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/empty.s b/vendor/golang.org/x/sys/windows/empty.s
index fdbbbcd3171..ba64caca5d3 100644
--- a/vendor/golang.org/x/sys/windows/empty.s
+++ b/vendor/golang.org/x/sys/windows/empty.s
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !go1.12
-// +build !go1.12
 
 // This file is here to allow bodyless functions with go:linkname for Go 1.11
 // and earlier (see https://golang.org/issue/23311).
diff --git a/vendor/golang.org/x/sys/windows/env_windows.go b/vendor/golang.org/x/sys/windows/env_windows.go
index 92ac05ff4ea..b8ad1925068 100644
--- a/vendor/golang.org/x/sys/windows/env_windows.go
+++ b/vendor/golang.org/x/sys/windows/env_windows.go
@@ -37,14 +37,14 @@ func (token Token) Environ(inheritExisting bool) (env []string, err error) {
 		return nil, err
 	}
 	defer DestroyEnvironmentBlock(block)
-	blockp := uintptr(unsafe.Pointer(block))
+	blockp := unsafe.Pointer(block)
 	for {
-		entry := UTF16PtrToString((*uint16)(unsafe.Pointer(blockp)))
+		entry := UTF16PtrToString((*uint16)(blockp))
 		if len(entry) == 0 {
 			break
 		}
 		env = append(env, entry)
-		blockp += 2 * (uintptr(len(entry)) + 1)
+		blockp = unsafe.Add(blockp, 2*(len(entry)+1))
 	}
 	return env, nil
 }
diff --git a/vendor/golang.org/x/sys/windows/eventlog.go b/vendor/golang.org/x/sys/windows/eventlog.go
index 2cd60645ee7..6c366955d97 100644
--- a/vendor/golang.org/x/sys/windows/eventlog.go
+++ b/vendor/golang.org/x/sys/windows/eventlog.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows
-// +build windows
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/exec_windows.go b/vendor/golang.org/x/sys/windows/exec_windows.go
index 75980fd44ad..9cabbb69419 100644
--- a/vendor/golang.org/x/sys/windows/exec_windows.go
+++ b/vendor/golang.org/x/sys/windows/exec_windows.go
@@ -22,7 +22,7 @@ import (
 //     but only if there is space or tab inside s.
 func EscapeArg(s string) string {
 	if len(s) == 0 {
-		return "\"\""
+		return `""`
 	}
 	n := len(s)
 	hasSpace := false
@@ -35,7 +35,7 @@ func EscapeArg(s string) string {
 		}
 	}
 	if hasSpace {
-		n += 2
+		n += 2 // Reserve space for quotes.
 	}
 	if n == len(s) {
 		return s
@@ -82,36 +82,106 @@ func EscapeArg(s string) string {
 // in CreateProcess's CommandLine argument, CreateService/ChangeServiceConfig's BinaryPathName argument,
 // or any program that uses CommandLineToArgv.
 func ComposeCommandLine(args []string) string {
-	var commandLine string
-	for i := range args {
-		if i > 0 {
-			commandLine += " "
+	if len(args) == 0 {
+		return ""
+	}
+
+	// Per https://learn.microsoft.com/en-us/windows/win32/api/shellapi/nf-shellapi-commandlinetoargvw:
+	// “This function accepts command lines that contain a program name; the
+	// program name can be enclosed in quotation marks or not.”
+	//
+	// Unfortunately, it provides no means of escaping interior quotation marks
+	// within that program name, and we have no way to report them here.
+	prog := args[0]
+	mustQuote := len(prog) == 0
+	for i := 0; i < len(prog); i++ {
+		c := prog[i]
+		if c <= ' ' || (c == '"' && i == 0) {
+			// Force quotes for not only the ASCII space and tab as described in the
+			// MSDN article, but also ASCII control characters.
+			// The documentation for CommandLineToArgvW doesn't say what happens when
+			// the first argument is not a valid program name, but it empirically
+			// seems to drop unquoted control characters.
+			mustQuote = true
+			break
+		}
+	}
+	var commandLine []byte
+	if mustQuote {
+		commandLine = make([]byte, 0, len(prog)+2)
+		commandLine = append(commandLine, '"')
+		for i := 0; i < len(prog); i++ {
+			c := prog[i]
+			if c == '"' {
+				// This quote would interfere with our surrounding quotes.
+				// We have no way to report an error, so just strip out
+				// the offending character instead.
+				continue
+			}
+			commandLine = append(commandLine, c)
+		}
+		commandLine = append(commandLine, '"')
+	} else {
+		if len(args) == 1 {
+			// args[0] is a valid command line representing itself.
+			// No need to allocate a new slice or string for it.
+			return prog
 		}
-		commandLine += EscapeArg(args[i])
+		commandLine = []byte(prog)
 	}
-	return commandLine
+
+	for _, arg := range args[1:] {
+		commandLine = append(commandLine, ' ')
+		// TODO(bcmills): since we're already appending to a slice, it would be nice
+		// to avoid the intermediate allocations of EscapeArg.
+		// Perhaps we can factor out an appendEscapedArg function.
+		commandLine = append(commandLine, EscapeArg(arg)...)
+	}
+	return string(commandLine)
 }
 
 // DecomposeCommandLine breaks apart its argument command line into unescaped parts using CommandLineToArgv,
 // as gathered from GetCommandLine, QUERY_SERVICE_CONFIG's BinaryPathName argument, or elsewhere that
 // command lines are passed around.
+// DecomposeCommandLine returns an error if commandLine contains NUL.
 func DecomposeCommandLine(commandLine string) ([]string, error) {
 	if len(commandLine) == 0 {
 		return []string{}, nil
 	}
+	utf16CommandLine, err := UTF16FromString(commandLine)
+	if err != nil {
+		return nil, errorspkg.New("string with NUL passed to DecomposeCommandLine")
+	}
 	var argc int32
-	argv, err := CommandLineToArgv(StringToUTF16Ptr(commandLine), &argc)
+	argv, err := commandLineToArgv(&utf16CommandLine[0], &argc)
 	if err != nil {
 		return nil, err
 	}
 	defer LocalFree(Handle(unsafe.Pointer(argv)))
+
 	var args []string
-	for _, v := range (*argv)[:argc] {
-		args = append(args, UTF16ToString((*v)[:]))
+	for _, p := range unsafe.Slice(argv, argc) {
+		args = append(args, UTF16PtrToString(p))
 	}
 	return args, nil
 }
 
+// CommandLineToArgv parses a Unicode command line string and sets
+// argc to the number of parsed arguments.
+//
+// The returned memory should be freed using a single call to LocalFree.
+//
+// Note that although the return type of CommandLineToArgv indicates 8192
+// entries of up to 8192 characters each, the actual count of parsed arguments
+// may exceed 8192, and the documentation for CommandLineToArgvW does not mention
+// any bound on the lengths of the individual argument strings.
+// (See https://go.dev/issue/63236.)
+func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) {
+	argp, err := commandLineToArgv(cmd, argc)
+	argv = (*[8192]*[8192]uint16)(unsafe.Pointer(argp))
+	return argv, err
+}
+
 func CloseOnExec(fd Handle) {
 	SetHandleInformation(Handle(fd), HANDLE_FLAG_INHERIT, 0)
 }
diff --git a/vendor/golang.org/x/sys/windows/mksyscall.go b/vendor/golang.org/x/sys/windows/mksyscall.go
index 8563f79c57f..dbcdb090c0c 100644
--- a/vendor/golang.org/x/sys/windows/mksyscall.go
+++ b/vendor/golang.org/x/sys/windows/mksyscall.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build generate
-// +build generate
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/race.go b/vendor/golang.org/x/sys/windows/race.go
index 9196b089ca1..0f1bdc3860f 100644
--- a/vendor/golang.org/x/sys/windows/race.go
+++ b/vendor/golang.org/x/sys/windows/race.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows && race
-// +build windows,race
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/race0.go b/vendor/golang.org/x/sys/windows/race0.go
index 7bae4817a06..0c78da78b13 100644
--- a/vendor/golang.org/x/sys/windows/race0.go
+++ b/vendor/golang.org/x/sys/windows/race0.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows && !race
-// +build windows,!race
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/security_windows.go b/vendor/golang.org/x/sys/windows/security_windows.go
index d414ef13bef..26be94a8a7b 100644
--- a/vendor/golang.org/x/sys/windows/security_windows.go
+++ b/vendor/golang.org/x/sys/windows/security_windows.go
@@ -7,8 +7,6 @@ package windows
 import (
 	"syscall"
 	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
 )
 
 const (
@@ -1341,21 +1339,14 @@ func (selfRelativeSD *SECURITY_DESCRIPTOR) copySelfRelativeSecurityDescriptor()
 		sdLen = min
 	}
 
-	var src []byte
-	h := (*unsafeheader.Slice)(unsafe.Pointer(&src))
-	h.Data = unsafe.Pointer(selfRelativeSD)
-	h.Len = sdLen
-	h.Cap = sdLen
-
+	src := unsafe.Slice((*byte)(unsafe.Pointer(selfRelativeSD)), sdLen)
+	// SECURITY_DESCRIPTOR has pointers in it, which means checkptr expects for it to
+	// be aligned properly. When we're copying a Windows-allocated struct to a
+	// Go-allocated one, make sure that the Go allocation is aligned to the
+	// pointer size.
 	const psize = int(unsafe.Sizeof(uintptr(0)))
-
-	var dst []byte
-	h = (*unsafeheader.Slice)(unsafe.Pointer(&dst))
 	alloc := make([]uintptr, (sdLen+psize-1)/psize)
-	h.Data = (*unsafeheader.Slice)(unsafe.Pointer(&alloc)).Data
-	h.Len = sdLen
-	h.Cap = sdLen
-
+	dst := unsafe.Slice((*byte)(unsafe.Pointer(&alloc[0])), sdLen)
 	copy(dst, src)
 	return (*SECURITY_DESCRIPTOR)(unsafe.Pointer(&dst[0]))
 }
diff --git a/vendor/golang.org/x/sys/windows/service.go b/vendor/golang.org/x/sys/windows/service.go
index f8deca8397a..a9dc6308d68 100644
--- a/vendor/golang.org/x/sys/windows/service.go
+++ b/vendor/golang.org/x/sys/windows/service.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows
-// +build windows
 
 package windows
 
@@ -141,6 +140,12 @@ const (
 	SERVICE_DYNAMIC_INFORMATION_LEVEL_START_REASON = 1
 )
 
+type ENUM_SERVICE_STATUS struct {
+	ServiceName   *uint16
+	DisplayName   *uint16
+	ServiceStatus SERVICE_STATUS
+}
+
 type SERVICE_STATUS struct {
 	ServiceType             uint32
 	CurrentState            uint32
@@ -212,6 +217,10 @@ type SERVICE_FAILURE_ACTIONS struct {
 	Actions      *SC_ACTION
 }
 
+type SERVICE_FAILURE_ACTIONS_FLAG struct {
+	FailureActionsOnNonCrashFailures int32
+}
+
 type SC_ACTION struct {
 	Type  uint32
 	Delay uint32
@@ -245,3 +254,4 @@ type QUERY_SERVICE_LOCK_STATUS struct {
 //sys	UnsubscribeServiceChangeNotifications(subscription uintptr) = sechost.UnsubscribeServiceChangeNotifications?
 //sys	RegisterServiceCtrlHandlerEx(serviceName *uint16, handlerProc uintptr, context uintptr) (handle Handle, err error) = advapi32.RegisterServiceCtrlHandlerExW
 //sys	QueryServiceDynamicInformation(service Handle, infoLevel uint32, dynamicInfo unsafe.Pointer) (err error) = advapi32.QueryServiceDynamicInformation?
+//sys	EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) = advapi32.EnumDependentServicesW
diff --git a/vendor/golang.org/x/sys/windows/str.go b/vendor/golang.org/x/sys/windows/str.go
index 4fc01434e4a..6a4f9ce6aa0 100644
--- a/vendor/golang.org/x/sys/windows/str.go
+++ b/vendor/golang.org/x/sys/windows/str.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows
-// +build windows
 
 package windows
 
diff --git a/vendor/golang.org/x/sys/windows/syscall.go b/vendor/golang.org/x/sys/windows/syscall.go
index 8732cdb957f..e85ed6b9c84 100644
--- a/vendor/golang.org/x/sys/windows/syscall.go
+++ b/vendor/golang.org/x/sys/windows/syscall.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build windows
-// +build windows
 
 // Package windows contains an interface to the low-level operating system
 // primitives. OS details vary depending on the underlying system, and
diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go
index 41cb3c01fd9..47dc5796769 100644
--- a/vendor/golang.org/x/sys/windows/syscall_windows.go
+++ b/vendor/golang.org/x/sys/windows/syscall_windows.go
@@ -15,8 +15,6 @@ import (
 	"time"
 	"unicode/utf16"
 	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
 )
 
 type Handle uintptr
@@ -135,14 +133,14 @@ func Getpagesize() int { return 4096 }
 
 // NewCallback converts a Go function to a function pointer conforming to the stdcall calling convention.
 // This is useful when interoperating with Windows code requiring callbacks.
-// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr.
+// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr.
 func NewCallback(fn interface{}) uintptr {
 	return syscall.NewCallback(fn)
 }
 
 // NewCallbackCDecl converts a Go function to a function pointer conforming to the cdecl calling convention.
 // This is useful when interoperating with Windows code requiring callbacks.
-// The argument is expected to be a function with with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr.
+// The argument is expected to be a function with one uintptr-sized result. The function must not have arguments with size larger than the size of uintptr.
 func NewCallbackCDecl(fn interface{}) uintptr {
 	return syscall.NewCallbackCDecl(fn)
 }
@@ -157,6 +155,8 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	GetModuleFileName(module Handle, filename *uint16, size uint32) (n uint32, err error) = kernel32.GetModuleFileNameW
 //sys	GetModuleHandleEx(flags uint32, moduleName *uint16, module *Handle) (err error) = kernel32.GetModuleHandleExW
 //sys	SetDefaultDllDirectories(directoryFlags uint32) (err error)
+//sys	AddDllDirectory(path *uint16) (cookie uintptr, err error) = kernel32.AddDllDirectory
+//sys	RemoveDllDirectory(cookie uintptr) (err error) = kernel32.RemoveDllDirectory
 //sys	SetDllDirectory(path string) (err error) = kernel32.SetDllDirectoryW
 //sys	GetVersion() (ver uint32, err error)
 //sys	FormatMessage(flags uint32, msgsrc uintptr, msgid uint32, langid uint32, buf []uint16, args *byte) (n uint32, err error) = FormatMessageW
@@ -216,7 +216,7 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	shGetKnownFolderPath(id *KNOWNFOLDERID, flags uint32, token Token, path **uint16) (ret error) = shell32.SHGetKnownFolderPath
 //sys	TerminateProcess(handle Handle, exitcode uint32) (err error)
 //sys	GetExitCodeProcess(handle Handle, exitcode *uint32) (err error)
-//sys	GetStartupInfo(startupInfo *StartupInfo) (err error) = GetStartupInfoW
+//sys	getStartupInfo(startupInfo *StartupInfo) = GetStartupInfoW
 //sys	GetProcessTimes(handle Handle, creationTime *Filetime, exitTime *Filetime, kernelTime *Filetime, userTime *Filetime) (err error)
 //sys	DuplicateHandle(hSourceProcessHandle Handle, hSourceHandle Handle, hTargetProcessHandle Handle, lpTargetHandle *Handle, dwDesiredAccess uint32, bInheritHandle bool, dwOptions uint32) (err error)
 //sys	WaitForSingleObject(handle Handle, waitMilliseconds uint32) (event uint32, err error) [failretval==0xffffffff]
@@ -235,12 +235,13 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	CreateEnvironmentBlock(block **uint16, token Token, inheritExisting bool) (err error) = userenv.CreateEnvironmentBlock
 //sys	DestroyEnvironmentBlock(block *uint16) (err error) = userenv.DestroyEnvironmentBlock
 //sys	getTickCount64() (ms uint64) = kernel32.GetTickCount64
+//sys   GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error)
 //sys	SetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error)
 //sys	GetFileAttributes(name *uint16) (attrs uint32, err error) [failretval==INVALID_FILE_ATTRIBUTES] = kernel32.GetFileAttributesW
 //sys	SetFileAttributes(name *uint16, attrs uint32) (err error) = kernel32.SetFileAttributesW
 //sys	GetFileAttributesEx(name *uint16, level uint32, info *byte) (err error) = kernel32.GetFileAttributesExW
 //sys	GetCommandLine() (cmd *uint16) = kernel32.GetCommandLineW
-//sys	CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW
+//sys	commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) [failretval==nil] = shell32.CommandLineToArgvW
 //sys	LocalFree(hmem Handle) (handle Handle, err error) [failretval!=0]
 //sys	LocalAlloc(flags uint32, length uint32) (ptr uintptr, err error)
 //sys	SetHandleInformation(handle Handle, mask uint32, flags uint32) (err error)
@@ -299,12 +300,15 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	RegNotifyChangeKeyValue(key Handle, watchSubtree bool, notifyFilter uint32, event Handle, asynchronous bool) (regerrno error) = advapi32.RegNotifyChangeKeyValue
 //sys	GetCurrentProcessId() (pid uint32) = kernel32.GetCurrentProcessId
 //sys	ProcessIdToSessionId(pid uint32, sessionid *uint32) (err error) = kernel32.ProcessIdToSessionId
+//sys	ClosePseudoConsole(console Handle) = kernel32.ClosePseudoConsole
+//sys	createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) = kernel32.CreatePseudoConsole
 //sys	GetConsoleMode(console Handle, mode *uint32) (err error) = kernel32.GetConsoleMode
 //sys	SetConsoleMode(console Handle, mode uint32) (err error) = kernel32.SetConsoleMode
 //sys	GetConsoleScreenBufferInfo(console Handle, info *ConsoleScreenBufferInfo) (err error) = kernel32.GetConsoleScreenBufferInfo
 //sys	setConsoleCursorPosition(console Handle, position uint32) (err error) = kernel32.SetConsoleCursorPosition
 //sys	WriteConsole(console Handle, buf *uint16, towrite uint32, written *uint32, reserved *byte) (err error) = kernel32.WriteConsoleW
 //sys	ReadConsole(console Handle, buf *uint16, toread uint32, read *uint32, inputControl *byte) (err error) = kernel32.ReadConsoleW
+//sys	resizePseudoConsole(pconsole Handle, size uint32) (hr error) = kernel32.ResizePseudoConsole
 //sys	CreateToolhelp32Snapshot(flags uint32, processId uint32) (handle Handle, err error) [failretval==InvalidHandle] = kernel32.CreateToolhelp32Snapshot
 //sys	Module32First(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32FirstW
 //sys	Module32Next(snapshot Handle, moduleEntry *ModuleEntry32) (err error) = kernel32.Module32NextW
@@ -405,7 +409,7 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW
 
 // Process Status API (PSAPI)
-//sys	EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses
+//sys	enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses
 //sys	EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules
 //sys	EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx
 //sys	GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation
@@ -437,6 +441,10 @@ func NewCallbackCDecl(fn interface{}) uintptr {
 //sys	DwmGetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmGetWindowAttribute
 //sys	DwmSetWindowAttribute(hwnd HWND, attribute uint32, value unsafe.Pointer, size uint32) (ret error) = dwmapi.DwmSetWindowAttribute
 
+// Windows Multimedia API
+//sys TimeBeginPeriod (period uint32) (err error) [failretval != 0] = winmm.timeBeginPeriod
+//sys TimeEndPeriod (period uint32) (err error) [failretval != 0] = winmm.timeEndPeriod
+
 // syscall interface implementation for other packages
 
 // GetCurrentProcess returns the handle for the current process.
@@ -824,6 +832,9 @@ const socket_error = uintptr(^uint32(0))
 //sys	WSAStartup(verreq uint32, data *WSAData) (sockerr error) = ws2_32.WSAStartup
 //sys	WSACleanup() (err error) [failretval==socket_error] = ws2_32.WSACleanup
 //sys	WSAIoctl(s Handle, iocc uint32, inbuf *byte, cbif uint32, outbuf *byte, cbob uint32, cbbr *uint32, overlapped *Overlapped, completionRoutine uintptr) (err error) [failretval==socket_error] = ws2_32.WSAIoctl
+//sys	WSALookupServiceBegin(querySet *WSAQUERYSET, flags uint32, handle *Handle) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceBeginW
+//sys	WSALookupServiceNext(handle Handle, flags uint32, size *int32, querySet *WSAQUERYSET) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceNextW
+//sys	WSALookupServiceEnd(handle Handle) (err error) [failretval==socket_error] = ws2_32.WSALookupServiceEnd
 //sys	socket(af int32, typ int32, protocol int32) (handle Handle, err error) [failretval==InvalidHandle] = ws2_32.socket
 //sys	sendto(s Handle, buf []byte, flags int32, to unsafe.Pointer, tolen int32) (err error) [failretval==socket_error] = ws2_32.sendto
 //sys	recvfrom(s Handle, buf []byte, flags int32, from *RawSockaddrAny, fromlen *int32) (n int32, err error) [failretval==-1] = ws2_32.recvfrom
@@ -961,7 +972,8 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, int32, error) {
 	if n > 0 {
 		sl += int32(n) + 1
 	}
-	if sa.raw.Path[0] == '@' {
+	if sa.raw.Path[0] == '@' || (sa.raw.Path[0] == 0 && sl > 3) {
+		// Check sl > 3 so we don't change unnamed socket behavior.
 		sa.raw.Path[0] = 0
 		// Don't count trailing NUL for abstract address.
 		sl--
@@ -1019,8 +1031,7 @@ func (rsa *RawSockaddrAny) Sockaddr() (Sockaddr, error) {
 		for n < len(pp.Path) && pp.Path[n] != 0 {
 			n++
 		}
-		bytes := (*[len(pp.Path)]byte)(unsafe.Pointer(&pp.Path[0]))[0:n]
-		sa.Name = string(bytes)
+		sa.Name = string(unsafe.Slice((*byte)(unsafe.Pointer(&pp.Path[0])), n))
 		return sa, nil
 
 	case AF_INET:
@@ -1352,6 +1363,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) {
 	return syscall.EWINDOWS
 }
 
+func EnumProcesses(processIds []uint32, bytesReturned *uint32) error {
+	// EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses
+	// the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy.
+	var p *uint32
+	if len(processIds) > 0 {
+		p = &processIds[0]
+	}
+	size := uint32(len(processIds) * 4)
+	return enumProcesses(p, size, bytesReturned)
+}
+
 func Getpid() (pid int) { return int(GetCurrentProcessId()) }
 
 func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) {
@@ -1611,6 +1633,11 @@ func SetConsoleCursorPosition(console Handle, position Coord) error {
 	return setConsoleCursorPosition(console, *((*uint32)(unsafe.Pointer(&position))))
 }
 
+func GetStartupInfo(startupInfo *StartupInfo) error {
+	getStartupInfo(startupInfo)
+	return nil
+}
+
 func (s NTStatus) Errno() syscall.Errno {
 	return rtlNtStatusToDosErrorNoTeb(s)
 }
@@ -1645,12 +1672,8 @@ func NewNTUnicodeString(s string) (*NTUnicodeString, error) {
 
 // Slice returns a uint16 slice that aliases the data in the NTUnicodeString.
 func (s *NTUnicodeString) Slice() []uint16 {
-	var slice []uint16
-	hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice))
-	hdr.Data = unsafe.Pointer(s.Buffer)
-	hdr.Len = int(s.Length)
-	hdr.Cap = int(s.MaximumLength)
-	return slice
+	slice := unsafe.Slice(s.Buffer, s.MaximumLength)
+	return slice[:s.Length]
 }
 
 func (s *NTUnicodeString) String() string {
@@ -1673,12 +1696,8 @@ func NewNTString(s string) (*NTString, error) {
 
 // Slice returns a byte slice that aliases the data in the NTString.
 func (s *NTString) Slice() []byte {
-	var slice []byte
-	hdr := (*unsafeheader.Slice)(unsafe.Pointer(&slice))
-	hdr.Data = unsafe.Pointer(s.Buffer)
-	hdr.Len = int(s.Length)
-	hdr.Cap = int(s.MaximumLength)
-	return slice
+	slice := unsafe.Slice(s.Buffer, s.MaximumLength)
+	return slice[:s.Length]
 }
 
 func (s *NTString) String() string {
@@ -1730,10 +1749,7 @@ func LoadResourceData(module, resInfo Handle) (data []byte, err error) {
 	if err != nil {
 		return
 	}
-	h := (*unsafeheader.Slice)(unsafe.Pointer(&data))
-	h.Data = unsafe.Pointer(ptr)
-	h.Len = int(size)
-	h.Cap = int(size)
+	data = unsafe.Slice((*byte)(unsafe.Pointer(ptr)), size)
 	return
 }
 
@@ -1804,3 +1820,17 @@ type PSAPI_WORKING_SET_EX_INFORMATION struct {
 	// A PSAPI_WORKING_SET_EX_BLOCK union that indicates the attributes of the page at VirtualAddress.
 	VirtualAttributes PSAPI_WORKING_SET_EX_BLOCK
 }
+
+// CreatePseudoConsole creates a windows pseudo console.
+func CreatePseudoConsole(size Coord, in Handle, out Handle, flags uint32, pconsole *Handle) error {
+	// We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only
+	// accept arguments that can be casted to uintptr, and Coord can't.
+	return createPseudoConsole(*((*uint32)(unsafe.Pointer(&size))), in, out, flags, pconsole)
+}
+
+// ResizePseudoConsole resizes the internal buffers of the pseudo console to the width and height specified in `size`.
+func ResizePseudoConsole(pconsole Handle, size Coord) error {
+	// We need this wrapper to manually cast Coord to uint32. The autogenerated wrappers only
+	// accept arguments that can be casted to uintptr, and Coord can't.
+	return resizePseudoConsole(pconsole, *((*uint32)(unsafe.Pointer(&size))))
+}
diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go
index 0c4add97410..359780f6ace 100644
--- a/vendor/golang.org/x/sys/windows/types_windows.go
+++ b/vendor/golang.org/x/sys/windows/types_windows.go
@@ -247,6 +247,7 @@ const (
 	PROC_THREAD_ATTRIBUTE_MITIGATION_POLICY = 0x00020007
 	PROC_THREAD_ATTRIBUTE_UMS_THREAD        = 0x00030006
 	PROC_THREAD_ATTRIBUTE_PROTECTION_LEVEL  = 0x0002000b
+	PROC_THREAD_ATTRIBUTE_PSEUDOCONSOLE     = 0x00020016
 )
 
 const (
@@ -1093,7 +1094,33 @@ const (
 
 	SOMAXCONN = 0x7fffffff
 
-	TCP_NODELAY = 1
+	TCP_NODELAY                    = 1
+	TCP_EXPEDITED_1122             = 2
+	TCP_KEEPALIVE                  = 3
+	TCP_MAXSEG                     = 4
+	TCP_MAXRT                      = 5
+	TCP_STDURG                     = 6
+	TCP_NOURG                      = 7
+	TCP_ATMARK                     = 8
+	TCP_NOSYNRETRIES               = 9
+	TCP_TIMESTAMPS                 = 10
+	TCP_OFFLOAD_PREFERENCE         = 11
+	TCP_CONGESTION_ALGORITHM       = 12
+	TCP_DELAY_FIN_ACK              = 13
+	TCP_MAXRTMS                    = 14
+	TCP_FASTOPEN                   = 15
+	TCP_KEEPCNT                    = 16
+	TCP_KEEPIDLE                   = TCP_KEEPALIVE
+	TCP_KEEPINTVL                  = 17
+	TCP_FAIL_CONNECT_ON_ICMP_ERROR = 18
+	TCP_ICMP_ERROR_INFO            = 19
+
+	UDP_NOCHECKSUM              = 1
+	UDP_SEND_MSG_SIZE           = 2
+	UDP_RECV_MAX_COALESCED_SIZE = 3
+	UDP_CHECKSUM_COVERAGE       = 20
+
+	UDP_COALESCED_INFO = 3
 
 	SHUT_RD   = 0
 	SHUT_WR   = 1
@@ -1243,6 +1270,51 @@ const (
 	DnsSectionAdditional = 0x0003
 )
 
+const (
+	// flags of WSALookupService
+	LUP_DEEP                = 0x0001
+	LUP_CONTAINERS          = 0x0002
+	LUP_NOCONTAINERS        = 0x0004
+	LUP_NEAREST             = 0x0008
+	LUP_RETURN_NAME         = 0x0010
+	LUP_RETURN_TYPE         = 0x0020
+	LUP_RETURN_VERSION      = 0x0040
+	LUP_RETURN_COMMENT      = 0x0080
+	LUP_RETURN_ADDR         = 0x0100
+	LUP_RETURN_BLOB         = 0x0200
+	LUP_RETURN_ALIASES      = 0x0400
+	LUP_RETURN_QUERY_STRING = 0x0800
+	LUP_RETURN_ALL          = 0x0FF0
+	LUP_RES_SERVICE         = 0x8000
+
+	LUP_FLUSHCACHE    = 0x1000
+	LUP_FLUSHPREVIOUS = 0x2000
+
+	LUP_NON_AUTHORITATIVE      = 0x4000
+	LUP_SECURE                 = 0x8000
+	LUP_RETURN_PREFERRED_NAMES = 0x10000
+	LUP_DNS_ONLY               = 0x20000
+
+	LUP_ADDRCONFIG           = 0x100000
+	LUP_DUAL_ADDR            = 0x200000
+	LUP_FILESERVER           = 0x400000
+	LUP_DISABLE_IDN_ENCODING = 0x00800000
+	LUP_API_ANSI             = 0x01000000
+
+	LUP_RESOLUTION_HANDLE = 0x80000000
+)
+
+const (
+	// values of WSAQUERYSET's namespace
+	NS_ALL       = 0
+	NS_DNS       = 12
+	NS_NLA       = 15
+	NS_BTH       = 16
+	NS_EMAIL     = 37
+	NS_PNRPNAME  = 38
+	NS_PNRPCLOUD = 39
+)
+
 type DNSSRVData struct {
 	Target   *uint16
 	Priority uint16
@@ -2094,6 +2166,12 @@ const (
 	ENABLE_LVB_GRID_WORLDWIDE          = 0x10
 )
 
+// Pseudo console related constants used for the flags parameter to
+// CreatePseudoConsole. See: https://learn.microsoft.com/en-us/windows/console/createpseudoconsole
+const (
+	PSEUDOCONSOLE_INHERIT_CURSOR = 0x1
+)
+
 type Coord struct {
 	X int16
 	Y int16
@@ -2175,19 +2253,23 @@ type JOBOBJECT_BASIC_UI_RESTRICTIONS struct {
 }
 
 const (
-	// JobObjectInformationClass
+	// JobObjectInformationClass for QueryInformationJobObject and SetInformationJobObject
 	JobObjectAssociateCompletionPortInformation = 7
+	JobObjectBasicAccountingInformation         = 1
+	JobObjectBasicAndIoAccountingInformation    = 8
 	JobObjectBasicLimitInformation              = 2
+	JobObjectBasicProcessIdList                 = 3
 	JobObjectBasicUIRestrictions                = 4
 	JobObjectCpuRateControlInformation          = 15
 	JobObjectEndOfJobTimeInformation            = 6
 	JobObjectExtendedLimitInformation           = 9
 	JobObjectGroupInformation                   = 11
 	JobObjectGroupInformationEx                 = 14
-	JobObjectLimitViolationInformation2         = 35
+	JobObjectLimitViolationInformation          = 13
+	JobObjectLimitViolationInformation2         = 34
 	JobObjectNetRateControlInformation          = 32
 	JobObjectNotificationLimitInformation       = 12
-	JobObjectNotificationLimitInformation2      = 34
+	JobObjectNotificationLimitInformation2      = 33
 	JobObjectSecurityLimitInformation           = 5
 )
 
@@ -3258,3 +3340,43 @@ const (
 	DWMWA_TEXT_COLOR                     = 36
 	DWMWA_VISIBLE_FRAME_BORDER_THICKNESS = 37
 )
+
+type WSAQUERYSET struct {
+	Size                uint32
+	ServiceInstanceName *uint16
+	ServiceClassId      *GUID
+	Version             *WSAVersion
+	Comment             *uint16
+	NameSpace           uint32
+	NSProviderId        *GUID
+	Context             *uint16
+	NumberOfProtocols   uint32
+	AfpProtocols        *AFProtocols
+	QueryString         *uint16
+	NumberOfCsAddrs     uint32
+	SaBuffer            *CSAddrInfo
+	OutputFlags         uint32
+	Blob                *BLOB
+}
+
+type WSAVersion struct {
+	Version                 uint32
+	EnumerationOfComparison int32
+}
+
+type AFProtocols struct {
+	AddressFamily int32
+	Protocol      int32
+}
+
+type CSAddrInfo struct {
+	LocalAddr  SocketAddress
+	RemoteAddr SocketAddress
+	SocketType int32
+	Protocol   int32
+}
+
+type BLOB struct {
+	Size     uint32
+	BlobData *byte
+}
diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go
index ac60052e44a..146a1f0196f 100644
--- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go
+++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go
@@ -55,6 +55,7 @@ var (
 	moduser32   = NewLazySystemDLL("user32.dll")
 	moduserenv  = NewLazySystemDLL("userenv.dll")
 	modversion  = NewLazySystemDLL("version.dll")
+	modwinmm    = NewLazySystemDLL("winmm.dll")
 	modwintrust = NewLazySystemDLL("wintrust.dll")
 	modws2_32   = NewLazySystemDLL("ws2_32.dll")
 	modwtsapi32 = NewLazySystemDLL("wtsapi32.dll")
@@ -86,6 +87,7 @@ var (
 	procDeleteService                                        = modadvapi32.NewProc("DeleteService")
 	procDeregisterEventSource                                = modadvapi32.NewProc("DeregisterEventSource")
 	procDuplicateTokenEx                                     = modadvapi32.NewProc("DuplicateTokenEx")
+	procEnumDependentServicesW                               = modadvapi32.NewProc("EnumDependentServicesW")
 	procEnumServicesStatusExW                                = modadvapi32.NewProc("EnumServicesStatusExW")
 	procEqualSid                                             = modadvapi32.NewProc("EqualSid")
 	procFreeSid                                              = modadvapi32.NewProc("FreeSid")
@@ -182,10 +184,12 @@ var (
 	procGetAdaptersInfo                                      = modiphlpapi.NewProc("GetAdaptersInfo")
 	procGetBestInterfaceEx                                   = modiphlpapi.NewProc("GetBestInterfaceEx")
 	procGetIfEntry                                           = modiphlpapi.NewProc("GetIfEntry")
+	procAddDllDirectory                                      = modkernel32.NewProc("AddDllDirectory")
 	procAssignProcessToJobObject                             = modkernel32.NewProc("AssignProcessToJobObject")
 	procCancelIo                                             = modkernel32.NewProc("CancelIo")
 	procCancelIoEx                                           = modkernel32.NewProc("CancelIoEx")
 	procCloseHandle                                          = modkernel32.NewProc("CloseHandle")
+	procClosePseudoConsole                                   = modkernel32.NewProc("ClosePseudoConsole")
 	procConnectNamedPipe                                     = modkernel32.NewProc("ConnectNamedPipe")
 	procCreateDirectoryW                                     = modkernel32.NewProc("CreateDirectoryW")
 	procCreateEventExW                                       = modkernel32.NewProc("CreateEventExW")
@@ -200,6 +204,7 @@ var (
 	procCreateNamedPipeW                                     = modkernel32.NewProc("CreateNamedPipeW")
 	procCreatePipe                                           = modkernel32.NewProc("CreatePipe")
 	procCreateProcessW                                       = modkernel32.NewProc("CreateProcessW")
+	procCreatePseudoConsole                                  = modkernel32.NewProc("CreatePseudoConsole")
 	procCreateSymbolicLinkW                                  = modkernel32.NewProc("CreateSymbolicLinkW")
 	procCreateToolhelp32Snapshot                             = modkernel32.NewProc("CreateToolhelp32Snapshot")
 	procDefineDosDeviceW                                     = modkernel32.NewProc("DefineDosDeviceW")
@@ -249,6 +254,7 @@ var (
 	procGetFileAttributesW                                   = modkernel32.NewProc("GetFileAttributesW")
 	procGetFileInformationByHandle                           = modkernel32.NewProc("GetFileInformationByHandle")
 	procGetFileInformationByHandleEx                         = modkernel32.NewProc("GetFileInformationByHandleEx")
+	procGetFileTime                                          = modkernel32.NewProc("GetFileTime")
 	procGetFileType                                          = modkernel32.NewProc("GetFileType")
 	procGetFinalPathNameByHandleW                            = modkernel32.NewProc("GetFinalPathNameByHandleW")
 	procGetFullPathNameW                                     = modkernel32.NewProc("GetFullPathNameW")
@@ -325,7 +331,9 @@ var (
 	procReadProcessMemory                                    = modkernel32.NewProc("ReadProcessMemory")
 	procReleaseMutex                                         = modkernel32.NewProc("ReleaseMutex")
 	procRemoveDirectoryW                                     = modkernel32.NewProc("RemoveDirectoryW")
+	procRemoveDllDirectory                                   = modkernel32.NewProc("RemoveDllDirectory")
 	procResetEvent                                           = modkernel32.NewProc("ResetEvent")
+	procResizePseudoConsole                                  = modkernel32.NewProc("ResizePseudoConsole")
 	procResumeThread                                         = modkernel32.NewProc("ResumeThread")
 	procSetCommTimeouts                                      = modkernel32.NewProc("SetCommTimeouts")
 	procSetConsoleCursorPosition                             = modkernel32.NewProc("SetConsoleCursorPosition")
@@ -467,6 +475,8 @@ var (
 	procGetFileVersionInfoSizeW                              = modversion.NewProc("GetFileVersionInfoSizeW")
 	procGetFileVersionInfoW                                  = modversion.NewProc("GetFileVersionInfoW")
 	procVerQueryValueW                                       = modversion.NewProc("VerQueryValueW")
+	proctimeBeginPeriod                                      = modwinmm.NewProc("timeBeginPeriod")
+	proctimeEndPeriod                                        = modwinmm.NewProc("timeEndPeriod")
 	procWinVerifyTrustEx                                     = modwintrust.NewProc("WinVerifyTrustEx")
 	procFreeAddrInfoW                                        = modws2_32.NewProc("FreeAddrInfoW")
 	procGetAddrInfoW                                         = modws2_32.NewProc("GetAddrInfoW")
@@ -474,6 +484,9 @@ var (
 	procWSAEnumProtocolsW                                    = modws2_32.NewProc("WSAEnumProtocolsW")
 	procWSAGetOverlappedResult                               = modws2_32.NewProc("WSAGetOverlappedResult")
 	procWSAIoctl                                             = modws2_32.NewProc("WSAIoctl")
+	procWSALookupServiceBeginW                               = modws2_32.NewProc("WSALookupServiceBeginW")
+	procWSALookupServiceEnd                                  = modws2_32.NewProc("WSALookupServiceEnd")
+	procWSALookupServiceNextW                                = modws2_32.NewProc("WSALookupServiceNextW")
 	procWSARecv                                              = modws2_32.NewProc("WSARecv")
 	procWSARecvFrom                                          = modws2_32.NewProc("WSARecvFrom")
 	procWSASend                                              = modws2_32.NewProc("WSASend")
@@ -731,6 +744,14 @@ func DuplicateTokenEx(existingToken Token, desiredAccess uint32, tokenAttributes
 	return
 }
 
+func EnumDependentServices(service Handle, activityState uint32, services *ENUM_SERVICE_STATUS, buffSize uint32, bytesNeeded *uint32, servicesReturned *uint32) (err error) {
+	r1, _, e1 := syscall.Syscall6(procEnumDependentServicesW.Addr(), 6, uintptr(service), uintptr(activityState), uintptr(unsafe.Pointer(services)), uintptr(buffSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)))
+	if r1 == 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func EnumServicesStatusEx(mgr Handle, infoLevel uint32, serviceType uint32, serviceState uint32, services *byte, bufSize uint32, bytesNeeded *uint32, servicesReturned *uint32, resumeHandle *uint32, groupName *uint16) (err error) {
 	r1, _, e1 := syscall.Syscall12(procEnumServicesStatusExW.Addr(), 10, uintptr(mgr), uintptr(infoLevel), uintptr(serviceType), uintptr(serviceState), uintptr(unsafe.Pointer(services)), uintptr(bufSize), uintptr(unsafe.Pointer(bytesNeeded)), uintptr(unsafe.Pointer(servicesReturned)), uintptr(unsafe.Pointer(resumeHandle)), uintptr(unsafe.Pointer(groupName)), 0, 0)
 	if r1 == 0 {
@@ -1586,6 +1607,15 @@ func GetIfEntry(pIfRow *MibIfRow) (errcode error) {
 	return
 }
 
+func AddDllDirectory(path *uint16) (cookie uintptr, err error) {
+	r0, _, e1 := syscall.Syscall(procAddDllDirectory.Addr(), 1, uintptr(unsafe.Pointer(path)), 0, 0)
+	cookie = uintptr(r0)
+	if cookie == 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func AssignProcessToJobObject(job Handle, process Handle) (err error) {
 	r1, _, e1 := syscall.Syscall(procAssignProcessToJobObject.Addr(), 2, uintptr(job), uintptr(process), 0)
 	if r1 == 0 {
@@ -1618,6 +1648,11 @@ func CloseHandle(handle Handle) (err error) {
 	return
 }
 
+func ClosePseudoConsole(console Handle) {
+	syscall.Syscall(procClosePseudoConsole.Addr(), 1, uintptr(console), 0, 0)
+	return
+}
+
 func ConnectNamedPipe(pipe Handle, overlapped *Overlapped) (err error) {
 	r1, _, e1 := syscall.Syscall(procConnectNamedPipe.Addr(), 2, uintptr(pipe), uintptr(unsafe.Pointer(overlapped)), 0)
 	if r1 == 0 {
@@ -1747,6 +1782,14 @@ func CreateProcess(appName *uint16, commandLine *uint16, procSecurity *SecurityA
 	return
 }
 
+func createPseudoConsole(size uint32, in Handle, out Handle, flags uint32, pconsole *Handle) (hr error) {
+	r0, _, _ := syscall.Syscall6(procCreatePseudoConsole.Addr(), 5, uintptr(size), uintptr(in), uintptr(out), uintptr(flags), uintptr(unsafe.Pointer(pconsole)), 0)
+	if r0 != 0 {
+		hr = syscall.Errno(r0)
+	}
+	return
+}
+
 func CreateSymbolicLink(symlinkfilename *uint16, targetfilename *uint16, flags uint32) (err error) {
 	r1, _, e1 := syscall.Syscall(procCreateSymbolicLinkW.Addr(), 3, uintptr(unsafe.Pointer(symlinkfilename)), uintptr(unsafe.Pointer(targetfilename)), uintptr(flags))
 	if r1&0xff == 0 {
@@ -2154,6 +2197,14 @@ func GetFileInformationByHandleEx(handle Handle, class uint32, outBuffer *byte,
 	return
 }
 
+func GetFileTime(handle Handle, ctime *Filetime, atime *Filetime, wtime *Filetime) (err error) {
+	r1, _, e1 := syscall.Syscall6(procGetFileTime.Addr(), 4, uintptr(handle), uintptr(unsafe.Pointer(ctime)), uintptr(unsafe.Pointer(atime)), uintptr(unsafe.Pointer(wtime)), 0, 0)
+	if r1 == 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func GetFileType(filehandle Handle) (n uint32, err error) {
 	r0, _, e1 := syscall.Syscall(procGetFileType.Addr(), 1, uintptr(filehandle), 0, 0)
 	n = uint32(r0)
@@ -2355,11 +2406,8 @@ func GetShortPathName(longpath *uint16, shortpath *uint16, buflen uint32) (n uin
 	return
 }
 
-func GetStartupInfo(startupInfo *StartupInfo) (err error) {
-	r1, _, e1 := syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0)
-	if r1 == 0 {
-		err = errnoErr(e1)
-	}
+func getStartupInfo(startupInfo *StartupInfo) {
+	syscall.Syscall(procGetStartupInfoW.Addr(), 1, uintptr(unsafe.Pointer(startupInfo)), 0, 0)
 	return
 }
 
@@ -2842,6 +2890,14 @@ func RemoveDirectory(path *uint16) (err error) {
 	return
 }
 
+func RemoveDllDirectory(cookie uintptr) (err error) {
+	r1, _, e1 := syscall.Syscall(procRemoveDllDirectory.Addr(), 1, uintptr(cookie), 0, 0)
+	if r1 == 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func ResetEvent(event Handle) (err error) {
 	r1, _, e1 := syscall.Syscall(procResetEvent.Addr(), 1, uintptr(event), 0, 0)
 	if r1 == 0 {
@@ -2850,6 +2906,14 @@ func ResetEvent(event Handle) (err error) {
 	return
 }
 
+func resizePseudoConsole(pconsole Handle, size uint32) (hr error) {
+	r0, _, _ := syscall.Syscall(procResizePseudoConsole.Addr(), 2, uintptr(pconsole), uintptr(size), 0)
+	if r0 != 0 {
+		hr = syscall.Errno(r0)
+	}
+	return
+}
+
 func ResumeThread(thread Handle) (ret uint32, err error) {
 	r0, _, e1 := syscall.Syscall(procResumeThread.Addr(), 1, uintptr(thread), 0, 0)
 	ret = uint32(r0)
@@ -3504,12 +3568,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u
 	return
 }
 
-func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) {
-	var _p0 *uint32
-	if len(processIds) > 0 {
-		_p0 = &processIds[0]
-	}
-	r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned)))
+func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) {
+	r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned)))
 	if r1 == 0 {
 		err = errnoErr(e1)
 	}
@@ -3812,9 +3872,9 @@ func setupUninstallOEMInf(infFileName *uint16, flags SUOI, reserved uintptr) (er
 	return
 }
 
-func CommandLineToArgv(cmd *uint16, argc *int32) (argv *[8192]*[8192]uint16, err error) {
+func commandLineToArgv(cmd *uint16, argc *int32) (argv **uint16, err error) {
 	r0, _, e1 := syscall.Syscall(procCommandLineToArgvW.Addr(), 2, uintptr(unsafe.Pointer(cmd)), uintptr(unsafe.Pointer(argc)), 0)
-	argv = (*[8192]*[8192]uint16)(unsafe.Pointer(r0))
+	argv = (**uint16)(unsafe.Pointer(r0))
 	if argv == nil {
 		err = errnoErr(e1)
 	}
@@ -4009,6 +4069,22 @@ func _VerQueryValue(block unsafe.Pointer, subBlock *uint16, pointerToBufferPoint
 	return
 }
 
+func TimeBeginPeriod(period uint32) (err error) {
+	r1, _, e1 := syscall.Syscall(proctimeBeginPeriod.Addr(), 1, uintptr(period), 0, 0)
+	if r1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+func TimeEndPeriod(period uint32) (err error) {
+	r1, _, e1 := syscall.Syscall(proctimeEndPeriod.Addr(), 1, uintptr(period), 0, 0)
+	if r1 != 0 {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func WinVerifyTrustEx(hwnd HWND, actionId *GUID, data *WinTrustData) (ret error) {
 	r0, _, _ := syscall.Syscall(procWinVerifyTrustEx.Addr(), 3, uintptr(hwnd), uintptr(unsafe.Pointer(actionId)), uintptr(unsafe.Pointer(data)))
 	if r0 != 0 {
@@ -4067,6 +4143,30 @@ func WSAIoctl(s Handle, iocc uint32, inbuf *byte, cbif uint32, outbuf *byte, cbo
 	return
 }
 
+func WSALookupServiceBegin(querySet *WSAQUERYSET, flags uint32, handle *Handle) (err error) {
+	r1, _, e1 := syscall.Syscall(procWSALookupServiceBeginW.Addr(), 3, uintptr(unsafe.Pointer(querySet)), uintptr(flags), uintptr(unsafe.Pointer(handle)))
+	if r1 == socket_error {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+func WSALookupServiceEnd(handle Handle) (err error) {
+	r1, _, e1 := syscall.Syscall(procWSALookupServiceEnd.Addr(), 1, uintptr(handle), 0, 0)
+	if r1 == socket_error {
+		err = errnoErr(e1)
+	}
+	return
+}
+
+func WSALookupServiceNext(handle Handle, flags uint32, size *int32, querySet *WSAQUERYSET) (err error) {
+	r1, _, e1 := syscall.Syscall6(procWSALookupServiceNextW.Addr(), 4, uintptr(handle), uintptr(flags), uintptr(unsafe.Pointer(size)), uintptr(unsafe.Pointer(querySet)), 0, 0)
+	if r1 == socket_error {
+		err = errnoErr(e1)
+	}
+	return
+}
+
 func WSARecv(s Handle, bufs *WSABuf, bufcnt uint32, recvd *uint32, flags *uint32, overlapped *Overlapped, croutine *byte) (err error) {
 	r1, _, e1 := syscall.Syscall9(procWSARecv.Addr(), 7, uintptr(s), uintptr(unsafe.Pointer(bufs)), uintptr(bufcnt), uintptr(unsafe.Pointer(recvd)), uintptr(unsafe.Pointer(flags)), uintptr(unsafe.Pointer(overlapped)), uintptr(unsafe.Pointer(croutine)), 0, 0)
 	if r1 == socket_error {
diff --git a/vendor/golang.org/x/text/encoding/internal/internal.go b/vendor/golang.org/x/text/encoding/internal/internal.go
index 75a5fd16582..413e6fc6d7e 100644
--- a/vendor/golang.org/x/text/encoding/internal/internal.go
+++ b/vendor/golang.org/x/text/encoding/internal/internal.go
@@ -64,7 +64,7 @@ func (e FuncEncoding) NewEncoder() *encoding.Encoder {
 // byte.
 type RepertoireError byte
 
-// Error implements the error interrface.
+// Error implements the error interface.
 func (r RepertoireError) Error() string {
 	return "encoding: rune not supported by encoding."
 }
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
index 32af9de5996..a09ed198a5d 100644
--- a/vendor/golang.org/x/text/internal/language/compact/tables.go
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -790,226 +790,226 @@ const (
 
 var coreTags = []language.CompactCoreInfo{ // 773 elements
 	// Entry 0 - 1F
-	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
-	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
-	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
-	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
-	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
-	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
-	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
-	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+	0x00000000, 0x01600000, 0x016000d3, 0x01600162,
+	0x01c00000, 0x01c00052, 0x02100000, 0x02100081,
+	0x02700000, 0x02700070, 0x03a00000, 0x03a00001,
+	0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068,
+	0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098,
+	0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad,
+	0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca,
+	0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109,
 	// Entry 20 - 3F
-	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
-	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
-	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
-	0x04800000, 0x0480006e, 0x05800000, 0x05820000,
-	0x05820032, 0x0585a000, 0x0585a032, 0x05e00000,
+	0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d,
+	0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000,
+	0x04300000, 0x0430009a, 0x04400000, 0x04400130,
+	0x04800000, 0x0480006f, 0x05800000, 0x05820000,
+	0x05820032, 0x0585b000, 0x0585b032, 0x05e00000,
 	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
-	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
-	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+	0x07500163, 0x07900000, 0x07900130, 0x07e00000,
+	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4,
 	// Entry 40 - 5F
-	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
-	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
-	0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000,
-	0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000,
-	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
-	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
-	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
-	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+	0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000,
+	0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079,
+	0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000,
+	0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000,
+	0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f,
+	0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000,
+	0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000,
+	0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d,
 	// Entry 60 - 7F
-	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
-	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
-	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
-	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
-	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
-	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
-	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
-	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+	0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107,
+	0x10000000, 0x1000007c, 0x10100000, 0x10100064,
+	0x10100083, 0x10800000, 0x108000a5, 0x10d00000,
+	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061,
+	0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000,
+	0x117000d5, 0x11f00000, 0x11f00061, 0x12400000,
+	0x12400052, 0x12800000, 0x12b00000, 0x12b00115,
+	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5,
 	// Entry 80 - 9F
-	0x13000000, 0x13000080, 0x13000122, 0x13600000,
-	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+	0x13000000, 0x13000081, 0x13000123, 0x13600000,
+	0x1360005e, 0x13600088, 0x13900000, 0x13900001,
 	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
 	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
 	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
 	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
-	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
-	0x13900060, 0x13900061, 0x13900063, 0x13900064,
+	0x13900050, 0x13900052, 0x1390005d, 0x1390005e,
+	0x13900061, 0x13900062, 0x13900064, 0x13900065,
 	// Entry A0 - BF
-	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
-	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
-	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
-	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
-	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
-	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
-	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
-	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+	0x1390006e, 0x13900073, 0x13900074, 0x13900075,
+	0x13900076, 0x1390007c, 0x1390007d, 0x13900080,
+	0x13900081, 0x13900082, 0x13900084, 0x1390008b,
+	0x1390008d, 0x1390008e, 0x13900097, 0x13900098,
+	0x13900099, 0x1390009a, 0x1390009b, 0x139000a0,
+	0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa,
+	0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6,
+	0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8,
 	// Entry C0 - DF
-	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
-	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
-	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
-	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
-	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
-	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
-	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
-	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+	0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf,
+	0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7,
+	0x139000da, 0x139000de, 0x139000e0, 0x139000e1,
+	0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec,
+	0x139000ed, 0x139000f1, 0x13900108, 0x1390010a,
+	0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e,
+	0x1390010f, 0x13900110, 0x13900113, 0x13900118,
+	0x1390011c, 0x1390011e, 0x13900120, 0x13900126,
 	// Entry E0 - FF
-	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
-	0x13900131, 0x13900133, 0x13900135, 0x13900139,
-	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
-	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+	0x1390012a, 0x1390012d, 0x1390012e, 0x13900130,
+	0x13900132, 0x13900134, 0x13900136, 0x1390013a,
+	0x1390013d, 0x1390013e, 0x13900140, 0x13900143,
+	0x13900162, 0x13900163, 0x13900165, 0x13c00000,
 	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
 	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
-	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
-	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+	0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066,
+	0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087,
 	// Entry 100 - 11F
-	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
-	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
-	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
-	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
-	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
-	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
-	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
-	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+	0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0,
+	0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8,
+	0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136,
+	0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b,
+	0x14500000, 0x1450006f, 0x14600000, 0x14600052,
+	0x14800000, 0x14800024, 0x1480009d, 0x14e00000,
+	0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115,
+	0x15100000, 0x15100073, 0x15300000, 0x153000e8,
 	// Entry 120 - 13F
-	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+	0x15800000, 0x15800064, 0x15800077, 0x15e00000,
 	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
 	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
 	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
-	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
-	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
-	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
-	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+	0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b,
+	0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087,
+	0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb,
+	0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4,
 	// Entry 140 - 15F
-	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
-	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
-	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
-	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
-	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
-	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
-	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
-	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+	0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4,
+	0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103,
+	0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d,
+	0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140,
+	0x15e00141, 0x15e00160, 0x16900000, 0x1690009f,
+	0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097,
+	0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f,
+	0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3,
 	// Entry 160 - 17F
-	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
-	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
-	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
-	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
-	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
-	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
-	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
-	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+	0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000,
+	0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000,
+	0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000,
+	0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000,
+	0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091,
+	0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093,
+	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096,
+	0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053,
 	// Entry 180 - 19F
-	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
-	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
-	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
-	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
-	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
-	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
-	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
-	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e,
+	0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114,
+	0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000,
+	0x200000a3, 0x20300000, 0x20700000, 0x20700052,
+	0x20800000, 0x20a00000, 0x20a00130, 0x20e00000,
+	0x20f00000, 0x21000000, 0x2100007e, 0x21200000,
+	0x21200068, 0x21600000, 0x21700000, 0x217000a5,
+	0x21f00000, 0x22300000, 0x22300130, 0x22700000,
 	// Entry 1A0 - 1BF
-	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
-	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
-	0x24400052, 0x24500000, 0x24500082, 0x24600000,
-	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
-	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
-	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
-	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
-	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+	0x2270005b, 0x23400000, 0x234000c4, 0x23900000,
+	0x239000a5, 0x24200000, 0x242000af, 0x24400000,
+	0x24400052, 0x24500000, 0x24500083, 0x24600000,
+	0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000,
+	0x2510009a, 0x25400000, 0x254000ab, 0x254000ac,
+	0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a,
+	0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052,
+	0x26e00000, 0x26e00061, 0x27400000, 0x28100000,
 	// Entry 1C0 - 1DF
-	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
-	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
-	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+	0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000,
+	0x29100130, 0x29500000, 0x295000b8, 0x2a300000,
+	0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000,
 	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
-	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
-	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
-	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
-	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+	0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c,
+	0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000,
+	0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000,
+	0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000,
 	// Entry 1E0 - 1FF
-	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
-	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
-	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
-	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
-	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
-	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
-	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
-	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+	0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5,
+	0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0,
+	0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052,
+	0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a,
+	0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000,
+	0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1,
+	0x31f0010e, 0x32000000, 0x320000cc, 0x32500000,
+	0x32500052, 0x33100000, 0x331000c5, 0x33a00000,
 	// Entry 200 - 21F
-	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
-	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
-	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
-	0x35100000, 0x35100099, 0x351000db, 0x36700000,
-	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
-	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
-	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+	0x33a0009d, 0x34100000, 0x34500000, 0x345000d3,
+	0x34700000, 0x347000db, 0x34700111, 0x34e00000,
+	0x34e00165, 0x35000000, 0x35000061, 0x350000da,
+	0x35100000, 0x3510009a, 0x351000dc, 0x36700000,
+	0x36700030, 0x36700036, 0x36700040, 0x3670005c,
+	0x367000da, 0x36700117, 0x3670011c, 0x36800000,
+	0x36800052, 0x36a00000, 0x36a000db, 0x36c00000,
 	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
 	// Entry 220 - 23F
-	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
-	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
-	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
-	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
-	0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000,
-	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+	0x37a00000, 0x38000000, 0x38000118, 0x38700000,
+	0x38900000, 0x38900132, 0x39000000, 0x39000070,
+	0x390000a5, 0x39500000, 0x3950009a, 0x39800000,
+	0x3980007e, 0x39800107, 0x39d00000, 0x39d05000,
+	0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000,
+	0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001,
 	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
-	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+	0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087,
 	// Entry 240 - 25F
-	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
-	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
-	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+	0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2,
+	0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000,
+	0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000,
 	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
-	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
-	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
-	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
-	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+	0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130,
+	0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af,
+	0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000,
+	0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000,
 	// Entry 260 - 27F
-	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
-	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
-	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
-	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+	0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000,
+	0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000,
+	0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d,
+	0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4,
 	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
-	0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba,
-	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
-	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+	0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb,
+	0x40c00000, 0x40c000b4, 0x41200000, 0x41200112,
+	0x41600000, 0x41600110, 0x41c00000, 0x41d00000,
 	// Entry 280 - 29F
-	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
-	0x42300000, 0x42300164, 0x42900000, 0x42900062,
-	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
-	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
-	0x43220000, 0x43220033, 0x432200bd, 0x43220105,
-	0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd,
-	0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000,
-	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+	0x41e00000, 0x41f00000, 0x41f00073, 0x42200000,
+	0x42300000, 0x42300165, 0x42900000, 0x42900063,
+	0x42900070, 0x429000a5, 0x42900116, 0x43100000,
+	0x43100027, 0x431000c3, 0x4310014e, 0x43200000,
+	0x43220000, 0x43220033, 0x432200be, 0x43220106,
+	0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be,
+	0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000,
+	0x43b00000, 0x44400000, 0x44400031, 0x44400073,
 	// Entry 2A0 - 2BF
-	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
-	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
-	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
-	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
-	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
-	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
-	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
-	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+	0x4440010d, 0x44500000, 0x4450004b, 0x445000a5,
+	0x44500130, 0x44500132, 0x44e00000, 0x45000000,
+	0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e,
+	0x46100000, 0x4610009a, 0x46400000, 0x464000a5,
+	0x46400132, 0x46700000, 0x46700125, 0x46b00000,
+	0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070,
+	0x47100000, 0x47600000, 0x47600128, 0x47a00000,
+	0x48000000, 0x48200000, 0x4820012a, 0x48a00000,
 	// Entry 2C0 - 2DF
-	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
-	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
-	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
-	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+	0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000,
+	0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000,
+	0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+	0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9,
 	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000,
-	0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000,
-	0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4,
-	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+	0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000,
+	0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5,
+	0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000,
 	// Entry 2E0 - 2FF
-	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
-	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
-	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+	0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000,
+	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115,
+	0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000,
 	0x50900052, 0x51200000, 0x51200001, 0x51800000,
-	0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000,
-	0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000,
-	0x528000ba, 0x52900000, 0x5293b000, 0x5293b053,
-	0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000,
+	0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000,
+	0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000,
+	0x528000bb, 0x52900000, 0x5293b000, 0x5293b053,
+	0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000,
 	// Entry 300 - 31F
-	0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000,
-	0x52f00161,
+	0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000,
+	0x52f00162,
 } // Size: 3116 bytes
 
 const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
 
-// Total table size 3147 bytes (3KiB); checksum: 6772C83C
+// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
index fb6b58378bd..14167e74e40 100644
--- a/vendor/golang.org/x/text/internal/language/tables.go
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag"
 // CLDRVersion is the CLDR version from which the tables in this package are derived.
 const CLDRVersion = "32"
 
-const NumLanguages = 8752
+const NumLanguages = 8798
 
-const NumScripts = 258
+const NumScripts = 261
 
-const NumRegions = 357
+const NumRegions = 358
 
 type FromTo struct {
 	From uint16
@@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{
 	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
 	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
 	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72,
 	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
 	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
 	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a,
@@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{
 	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
 	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
 	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff,
+	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff,
 	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
 	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
 	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
@@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{
 	// Entry C0 - FF
 	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
 	0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef,
+	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef,
 	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
 	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35,
 	0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+	0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03,
 	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
 	// Entry 100 - 13F
 	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
@@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{
 	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f,
 	0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
 	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+	0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb,
 	// Entry 140 - 17F
 	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16,
-	0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+	0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06,
 	0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09,
 	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05,
 	0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04,
 	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
 	0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03,
 	// Entry 180 - 1BF
 	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+	0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
 	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
@@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{
 	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf,
 	0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3,
 	0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+	0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01,
 	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
 	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
 	// Entry 240 - 27F
@@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{
 	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
 	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
 	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+	0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2,
+	0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9,
 	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
 	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
 	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
 	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08,
 	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00,
 	// Entry 300 - 33F
 	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
@@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{
 	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
 	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
 	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f,
 	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
 	// Entry 3C0 - 3FF
 	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
 	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01,
+	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20,
+	0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11,
+	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03,
 	0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10,
 	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
 	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
@@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{
 	// Entry 480 - 4BF
 	0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb,
 	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05,
+	0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41,
+	0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05,
 	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05,
 	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1,
+	0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1,
 	// Entry 4C0 - 4FF
 	0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed,
 	0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
@@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{
 	0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
 	// Entry 500 - 53F
 	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+	0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7,
 	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
 	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7,
 	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
@@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{
 	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
 	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
 	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+	0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00,
 	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
 	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
 	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
@@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{
 	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
 	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
 	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81,
 	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
 	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02,
 	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
 	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+	0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
 	0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20,
 	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
 	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
@@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{
 	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
 	0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4,
 	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+	0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9,
 	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
 	// Entry 680 - 6BF
 	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
+	0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda,
 	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0,
 	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
 	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06,
 	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
 	0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f,
 	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+	0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08,
+	0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
 	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41,
 	0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
 	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{
 	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
 	// Entry 700 - 73F
 	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+	0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01,
 	0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79,
 	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
@@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 740 - 77F
 	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46,
 	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
 	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
 	0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75,
@@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{
 	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
 	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+	0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
 	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+	0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0,
 	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+	0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41,
+	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40,
 	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
 	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
 	// Entry 7C0 - 7FF
@@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{
 	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
 	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
 	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+	0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01,
 	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
 	// Entry 800 - 83F
 	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+	0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1,
 	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
 	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
 	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
@@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{
 	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
 	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
 	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+	0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03,
 	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
 	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1,
+	0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1,
 	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
 	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
 	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
@@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{
 }
 
 // AliasMap maps langIDs to their suggested replacements.
-// Size: 716 bytes, 179 elements
-var AliasMap = [179]FromTo{
+// Size: 772 bytes, 193 elements
+var AliasMap = [193]FromTo{
 	0:   {From: 0x82, To: 0x88},
 	1:   {From: 0x187, To: 0x1ae},
 	2:   {From: 0x1f3, To: 0x1e1},
@@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{
 	11:  {From: 0x4a2, To: 0x21},
 	12:  {From: 0x53e, To: 0x544},
 	13:  {From: 0x58f, To: 0x12d},
-	14:  {From: 0x630, To: 0x1eb1},
-	15:  {From: 0x651, To: 0x431},
-	16:  {From: 0x662, To: 0x431},
-	17:  {From: 0x6ed, To: 0x3a},
-	18:  {From: 0x6f8, To: 0x1d7},
-	19:  {From: 0x709, To: 0x3625},
-	20:  {From: 0x73e, To: 0x21a1},
-	21:  {From: 0x7b3, To: 0x56},
-	22:  {From: 0x7b9, To: 0x299b},
-	23:  {From: 0x7c5, To: 0x58},
-	24:  {From: 0x7e6, To: 0x145},
-	25:  {From: 0x80c, To: 0x5a},
-	26:  {From: 0x815, To: 0x8d},
-	27:  {From: 0x87e, To: 0x810},
-	28:  {From: 0x8a8, To: 0x8b7},
-	29:  {From: 0x8c3, To: 0xee3},
-	30:  {From: 0x8fa, To: 0x1dc},
-	31:  {From: 0x9ef, To: 0x331},
-	32:  {From: 0xa36, To: 0x2c5},
-	33:  {From: 0xa3d, To: 0xbf},
-	34:  {From: 0xabe, To: 0x3322},
-	35:  {From: 0xb38, To: 0x529},
-	36:  {From: 0xb75, To: 0x265a},
-	37:  {From: 0xb7e, To: 0xbc3},
-	38:  {From: 0xb9b, To: 0x44e},
-	39:  {From: 0xbbc, To: 0x4229},
-	40:  {From: 0xbbf, To: 0x529},
-	41:  {From: 0xbfe, To: 0x2da7},
-	42:  {From: 0xc2e, To: 0x3181},
-	43:  {From: 0xcb9, To: 0xf3},
-	44:  {From: 0xd08, To: 0xfa},
-	45:  {From: 0xdc8, To: 0x11a},
-	46:  {From: 0xdd7, To: 0x32d},
-	47:  {From: 0xdf8, To: 0xdfb},
-	48:  {From: 0xdfe, To: 0x531},
-	49:  {From: 0xe01, To: 0xdf3},
-	50:  {From: 0xedf, To: 0x205a},
-	51:  {From: 0xee9, To: 0x222e},
-	52:  {From: 0xeee, To: 0x2e9a},
-	53:  {From: 0xf39, To: 0x367},
-	54:  {From: 0x10d0, To: 0x140},
-	55:  {From: 0x1104, To: 0x2d0},
-	56:  {From: 0x11a0, To: 0x1ec},
-	57:  {From: 0x1279, To: 0x21},
-	58:  {From: 0x1424, To: 0x15e},
-	59:  {From: 0x1470, To: 0x14e},
-	60:  {From: 0x151f, To: 0xd9b},
-	61:  {From: 0x1523, To: 0x390},
-	62:  {From: 0x1532, To: 0x19f},
-	63:  {From: 0x1580, To: 0x210},
-	64:  {From: 0x1583, To: 0x10d},
-	65:  {From: 0x15a3, To: 0x3caf},
-	66:  {From: 0x1630, To: 0x222e},
-	67:  {From: 0x166a, To: 0x19b},
-	68:  {From: 0x16c8, To: 0x136},
-	69:  {From: 0x1700, To: 0x29f8},
-	70:  {From: 0x1718, To: 0x194},
-	71:  {From: 0x1727, To: 0xf3f},
-	72:  {From: 0x177a, To: 0x178},
-	73:  {From: 0x1809, To: 0x17b6},
-	74:  {From: 0x1816, To: 0x18f3},
-	75:  {From: 0x188a, To: 0x436},
-	76:  {From: 0x1979, To: 0x1d01},
-	77:  {From: 0x1a74, To: 0x2bb0},
-	78:  {From: 0x1a8a, To: 0x1f8},
-	79:  {From: 0x1b5a, To: 0x1fa},
-	80:  {From: 0x1b86, To: 0x1515},
-	81:  {From: 0x1d64, To: 0x2c9b},
-	82:  {From: 0x2038, To: 0x37b1},
-	83:  {From: 0x203d, To: 0x20dd},
-	84:  {From: 0x205a, To: 0x30b},
-	85:  {From: 0x20e3, To: 0x274},
-	86:  {From: 0x20ee, To: 0x263},
-	87:  {From: 0x20f2, To: 0x22d},
-	88:  {From: 0x20f9, To: 0x256},
-	89:  {From: 0x210f, To: 0x21eb},
-	90:  {From: 0x2135, To: 0x27d},
-	91:  {From: 0x2160, To: 0x913},
-	92:  {From: 0x2199, To: 0x121},
-	93:  {From: 0x21ce, To: 0x1561},
-	94:  {From: 0x21e6, To: 0x504},
-	95:  {From: 0x21f4, To: 0x49f},
-	96:  {From: 0x21fb, To: 0x269},
-	97:  {From: 0x222d, To: 0x121},
-	98:  {From: 0x2237, To: 0x121},
-	99:  {From: 0x2262, To: 0x92a},
-	100: {From: 0x2316, To: 0x3226},
-	101: {From: 0x236a, To: 0x2835},
-	102: {From: 0x2382, To: 0x3365},
-	103: {From: 0x2472, To: 0x2c7},
-	104: {From: 0x24e4, To: 0x2ff},
-	105: {From: 0x24f0, To: 0x2fa},
-	106: {From: 0x24fa, To: 0x31f},
-	107: {From: 0x2550, To: 0xb5b},
-	108: {From: 0x25a9, To: 0xe2},
-	109: {From: 0x263e, To: 0x2d0},
-	110: {From: 0x26c9, To: 0x26b4},
-	111: {From: 0x26f9, To: 0x3c8},
-	112: {From: 0x2727, To: 0x3caf},
-	113: {From: 0x2755, To: 0x6a4},
-	114: {From: 0x2765, To: 0x26b4},
-	115: {From: 0x2789, To: 0x4358},
-	116: {From: 0x27c9, To: 0x2001},
-	117: {From: 0x28ea, To: 0x27b1},
-	118: {From: 0x28ef, To: 0x2837},
-	119: {From: 0x2914, To: 0x351},
-	120: {From: 0x2986, To: 0x2da7},
-	121: {From: 0x29f0, To: 0x96b},
-	122: {From: 0x2b1a, To: 0x38d},
-	123: {From: 0x2bfc, To: 0x395},
-	124: {From: 0x2c3f, To: 0x3caf},
-	125: {From: 0x2ce1, To: 0x2201},
-	126: {From: 0x2cfc, To: 0x3be},
-	127: {From: 0x2d13, To: 0x597},
-	128: {From: 0x2d47, To: 0x148},
-	129: {From: 0x2d48, To: 0x148},
-	130: {From: 0x2dff, To: 0x2f1},
-	131: {From: 0x2e08, To: 0x19cc},
-	132: {From: 0x2e1a, To: 0x2d95},
-	133: {From: 0x2e21, To: 0x292},
-	134: {From: 0x2e54, To: 0x7d},
-	135: {From: 0x2e65, To: 0x2282},
-	136: {From: 0x2ea0, To: 0x2e9b},
-	137: {From: 0x2eef, To: 0x2ed7},
-	138: {From: 0x3193, To: 0x3c4},
-	139: {From: 0x3366, To: 0x338e},
-	140: {From: 0x342a, To: 0x3dc},
-	141: {From: 0x34ee, To: 0x18d0},
-	142: {From: 0x35c8, To: 0x2c9b},
-	143: {From: 0x35e6, To: 0x412},
-	144: {From: 0x3658, To: 0x246},
-	145: {From: 0x3676, To: 0x3f4},
-	146: {From: 0x36fd, To: 0x445},
-	147: {From: 0x37c0, To: 0x121},
-	148: {From: 0x3816, To: 0x38f2},
-	149: {From: 0x382a, To: 0x2b48},
-	150: {From: 0x382b, To: 0x2c9b},
-	151: {From: 0x382f, To: 0xa9},
-	152: {From: 0x3832, To: 0x3228},
-	153: {From: 0x386c, To: 0x39a6},
-	154: {From: 0x3892, To: 0x3fc0},
-	155: {From: 0x38a5, To: 0x39d7},
-	156: {From: 0x38b4, To: 0x1fa4},
-	157: {From: 0x38b5, To: 0x2e9a},
-	158: {From: 0x395c, To: 0x47e},
-	159: {From: 0x3b4e, To: 0xd91},
-	160: {From: 0x3b78, To: 0x137},
-	161: {From: 0x3c99, To: 0x4bc},
-	162: {From: 0x3fbd, To: 0x100},
-	163: {From: 0x4208, To: 0xa91},
-	164: {From: 0x42be, To: 0x573},
-	165: {From: 0x42f9, To: 0x3f60},
-	166: {From: 0x4378, To: 0x25a},
-	167: {From: 0x43b8, To: 0xe6c},
-	168: {From: 0x43cd, To: 0x10f},
-	169: {From: 0x44af, To: 0x3322},
-	170: {From: 0x44e3, To: 0x512},
-	171: {From: 0x45ca, To: 0x2409},
-	172: {From: 0x45dd, To: 0x26dc},
-	173: {From: 0x4610, To: 0x48ae},
-	174: {From: 0x46ae, To: 0x46a0},
-	175: {From: 0x473e, To: 0x4745},
-	176: {From: 0x4817, To: 0x3503},
-	177: {From: 0x4916, To: 0x31f},
-	178: {From: 0x49a7, To: 0x523},
+	14:  {From: 0x62b, To: 0x34},
+	15:  {From: 0x62f, To: 0x14},
+	16:  {From: 0x630, To: 0x1eb1},
+	17:  {From: 0x651, To: 0x431},
+	18:  {From: 0x662, To: 0x431},
+	19:  {From: 0x6ed, To: 0x3a},
+	20:  {From: 0x6f8, To: 0x1d7},
+	21:  {From: 0x709, To: 0x3625},
+	22:  {From: 0x73e, To: 0x21a1},
+	23:  {From: 0x7b3, To: 0x56},
+	24:  {From: 0x7b9, To: 0x299b},
+	25:  {From: 0x7c5, To: 0x58},
+	26:  {From: 0x7e6, To: 0x145},
+	27:  {From: 0x80c, To: 0x5a},
+	28:  {From: 0x815, To: 0x8d},
+	29:  {From: 0x87e, To: 0x810},
+	30:  {From: 0x8a8, To: 0x8b7},
+	31:  {From: 0x8c3, To: 0xee3},
+	32:  {From: 0x8fa, To: 0x1dc},
+	33:  {From: 0x9ef, To: 0x331},
+	34:  {From: 0xa36, To: 0x2c5},
+	35:  {From: 0xa3d, To: 0xbf},
+	36:  {From: 0xabe, To: 0x3322},
+	37:  {From: 0xb38, To: 0x529},
+	38:  {From: 0xb75, To: 0x265a},
+	39:  {From: 0xb7e, To: 0xbc3},
+	40:  {From: 0xb9b, To: 0x44e},
+	41:  {From: 0xbbc, To: 0x4229},
+	42:  {From: 0xbbf, To: 0x529},
+	43:  {From: 0xbfe, To: 0x2da7},
+	44:  {From: 0xc2e, To: 0x3181},
+	45:  {From: 0xcb9, To: 0xf3},
+	46:  {From: 0xd08, To: 0xfa},
+	47:  {From: 0xdc8, To: 0x11a},
+	48:  {From: 0xdd7, To: 0x32d},
+	49:  {From: 0xdf8, To: 0xdfb},
+	50:  {From: 0xdfe, To: 0x531},
+	51:  {From: 0xe01, To: 0xdf3},
+	52:  {From: 0xedf, To: 0x205a},
+	53:  {From: 0xee9, To: 0x222e},
+	54:  {From: 0xeee, To: 0x2e9a},
+	55:  {From: 0xf39, To: 0x367},
+	56:  {From: 0x10d0, To: 0x140},
+	57:  {From: 0x1104, To: 0x2d0},
+	58:  {From: 0x11a0, To: 0x1ec},
+	59:  {From: 0x1279, To: 0x21},
+	60:  {From: 0x1424, To: 0x15e},
+	61:  {From: 0x1470, To: 0x14e},
+	62:  {From: 0x151f, To: 0xd9b},
+	63:  {From: 0x1523, To: 0x390},
+	64:  {From: 0x1532, To: 0x19f},
+	65:  {From: 0x1580, To: 0x210},
+	66:  {From: 0x1583, To: 0x10d},
+	67:  {From: 0x15a3, To: 0x3caf},
+	68:  {From: 0x1630, To: 0x222e},
+	69:  {From: 0x166a, To: 0x19b},
+	70:  {From: 0x16c8, To: 0x136},
+	71:  {From: 0x1700, To: 0x29f8},
+	72:  {From: 0x1718, To: 0x194},
+	73:  {From: 0x1727, To: 0xf3f},
+	74:  {From: 0x177a, To: 0x178},
+	75:  {From: 0x1809, To: 0x17b6},
+	76:  {From: 0x1816, To: 0x18f3},
+	77:  {From: 0x188a, To: 0x436},
+	78:  {From: 0x1979, To: 0x1d01},
+	79:  {From: 0x1a74, To: 0x2bb0},
+	80:  {From: 0x1a8a, To: 0x1f8},
+	81:  {From: 0x1b5a, To: 0x1fa},
+	82:  {From: 0x1b86, To: 0x1515},
+	83:  {From: 0x1d64, To: 0x2c9b},
+	84:  {From: 0x2038, To: 0x37b1},
+	85:  {From: 0x203d, To: 0x20dd},
+	86:  {From: 0x2042, To: 0x2e00},
+	87:  {From: 0x205a, To: 0x30b},
+	88:  {From: 0x20e3, To: 0x274},
+	89:  {From: 0x20ee, To: 0x263},
+	90:  {From: 0x20f2, To: 0x22d},
+	91:  {From: 0x20f9, To: 0x256},
+	92:  {From: 0x210f, To: 0x21eb},
+	93:  {From: 0x2135, To: 0x27d},
+	94:  {From: 0x2160, To: 0x913},
+	95:  {From: 0x2199, To: 0x121},
+	96:  {From: 0x21ce, To: 0x1561},
+	97:  {From: 0x21e6, To: 0x504},
+	98:  {From: 0x21f4, To: 0x49f},
+	99:  {From: 0x21fb, To: 0x269},
+	100: {From: 0x222d, To: 0x121},
+	101: {From: 0x2237, To: 0x121},
+	102: {From: 0x2248, To: 0x217d},
+	103: {From: 0x2262, To: 0x92a},
+	104: {From: 0x2316, To: 0x3226},
+	105: {From: 0x236a, To: 0x2835},
+	106: {From: 0x2382, To: 0x3365},
+	107: {From: 0x2472, To: 0x2c7},
+	108: {From: 0x24e4, To: 0x2ff},
+	109: {From: 0x24f0, To: 0x2fa},
+	110: {From: 0x24fa, To: 0x31f},
+	111: {From: 0x2550, To: 0xb5b},
+	112: {From: 0x25a9, To: 0xe2},
+	113: {From: 0x263e, To: 0x2d0},
+	114: {From: 0x26c9, To: 0x26b4},
+	115: {From: 0x26f9, To: 0x3c8},
+	116: {From: 0x2727, To: 0x3caf},
+	117: {From: 0x2755, To: 0x6a4},
+	118: {From: 0x2765, To: 0x26b4},
+	119: {From: 0x2789, To: 0x4358},
+	120: {From: 0x27c9, To: 0x2001},
+	121: {From: 0x28ea, To: 0x27b1},
+	122: {From: 0x28ef, To: 0x2837},
+	123: {From: 0x28fe, To: 0xaa5},
+	124: {From: 0x2914, To: 0x351},
+	125: {From: 0x2986, To: 0x2da7},
+	126: {From: 0x29f0, To: 0x96b},
+	127: {From: 0x2b1a, To: 0x38d},
+	128: {From: 0x2bfc, To: 0x395},
+	129: {From: 0x2c3f, To: 0x3caf},
+	130: {From: 0x2ce1, To: 0x2201},
+	131: {From: 0x2cfc, To: 0x3be},
+	132: {From: 0x2d13, To: 0x597},
+	133: {From: 0x2d47, To: 0x148},
+	134: {From: 0x2d48, To: 0x148},
+	135: {From: 0x2dff, To: 0x2f1},
+	136: {From: 0x2e08, To: 0x19cc},
+	137: {From: 0x2e10, To: 0xc45},
+	138: {From: 0x2e1a, To: 0x2d95},
+	139: {From: 0x2e21, To: 0x292},
+	140: {From: 0x2e54, To: 0x7d},
+	141: {From: 0x2e65, To: 0x2282},
+	142: {From: 0x2e97, To: 0x1a4},
+	143: {From: 0x2ea0, To: 0x2e9b},
+	144: {From: 0x2eef, To: 0x2ed7},
+	145: {From: 0x3193, To: 0x3c4},
+	146: {From: 0x3366, To: 0x338e},
+	147: {From: 0x342a, To: 0x3dc},
+	148: {From: 0x34ee, To: 0x18d0},
+	149: {From: 0x35c8, To: 0x2c9b},
+	150: {From: 0x35e6, To: 0x412},
+	151: {From: 0x35f5, To: 0x24b},
+	152: {From: 0x360d, To: 0x1dc},
+	153: {From: 0x3658, To: 0x246},
+	154: {From: 0x3676, To: 0x3f4},
+	155: {From: 0x36fd, To: 0x445},
+	156: {From: 0x3747, To: 0x3b42},
+	157: {From: 0x37c0, To: 0x121},
+	158: {From: 0x3816, To: 0x38f2},
+	159: {From: 0x382a, To: 0x2b48},
+	160: {From: 0x382b, To: 0x2c9b},
+	161: {From: 0x382f, To: 0xa9},
+	162: {From: 0x3832, To: 0x3228},
+	163: {From: 0x386c, To: 0x39a6},
+	164: {From: 0x3892, To: 0x3fc0},
+	165: {From: 0x38a0, To: 0x45f},
+	166: {From: 0x38a5, To: 0x39d7},
+	167: {From: 0x38b4, To: 0x1fa4},
+	168: {From: 0x38b5, To: 0x2e9a},
+	169: {From: 0x38fa, To: 0x38f1},
+	170: {From: 0x395c, To: 0x47e},
+	171: {From: 0x3b4e, To: 0xd91},
+	172: {From: 0x3b78, To: 0x137},
+	173: {From: 0x3c99, To: 0x4bc},
+	174: {From: 0x3fbd, To: 0x100},
+	175: {From: 0x4208, To: 0xa91},
+	176: {From: 0x42be, To: 0x573},
+	177: {From: 0x42f9, To: 0x3f60},
+	178: {From: 0x4378, To: 0x25a},
+	179: {From: 0x43b8, To: 0xe6c},
+	180: {From: 0x43cd, To: 0x10f},
+	181: {From: 0x43d4, To: 0x4848},
+	182: {From: 0x44af, To: 0x3322},
+	183: {From: 0x44e3, To: 0x512},
+	184: {From: 0x45ca, To: 0x2409},
+	185: {From: 0x45dd, To: 0x26dc},
+	186: {From: 0x4610, To: 0x48ae},
+	187: {From: 0x46ae, To: 0x46a0},
+	188: {From: 0x473e, To: 0x4745},
+	189: {From: 0x4817, To: 0x3503},
+	190: {From: 0x483b, To: 0x208b},
+	191: {From: 0x4916, To: 0x31f},
+	192: {From: 0x49a7, To: 0x523},
 }
 
-// Size: 179 bytes, 179 elements
-var AliasTypes = [179]AliasType{
+// Size: 193 bytes, 193 elements
+var AliasTypes = [193]AliasType{
 	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2,
-	1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1,
-	1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2,
+	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0,
+	1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0,
+	0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1,
+	1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1,
 	// Entry 40 - 7F
-	2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1,
-	0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0,
-	0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1,
-	0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0,
+	1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0,
+	2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0,
+	0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0,
+	1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
 	// Entry 80 - BF
-	2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2,
-	1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1,
-	0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1,
-	0, 1, 1,
+	1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0,
+	0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0,
+	0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0,
+	0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1,
+	// Entry C0 - FF
+	1,
 }
 
 const (
-	_Latn = 90
+	_Latn = 91
 	_Hani = 57
 	_Hans = 59
 	_Hant = 60
-	_Qaaa = 147
-	_Qaai = 155
-	_Qabx = 196
-	_Zinh = 252
-	_Zyyy = 257
-	_Zzzz = 258
+	_Qaaa = 149
+	_Qaai = 157
+	_Qabx = 198
+	_Zinh = 255
+	_Zyyy = 260
+	_Zzzz = 261
 )
 
 // script is an alphabetically sorted list of ISO 15924 codes. The index
 // of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 1040 bytes
+const script tag.Index = "" + // Size: 1052 bytes
 	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
 	"BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" +
 	"DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" +
 	"GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" +
-	"JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" +
-	"LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" +
-	"MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" +
-	"OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" +
-	"PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" +
-	"QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" +
-	"QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" +
-	"RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" +
-	"SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" +
-	"ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" +
-	"ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+	"JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" +
+	"LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" +
+	"MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" +
+	"NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" +
+	"PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" +
+	"QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" +
+	"QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" +
+	"QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" +
+	"SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" +
+	"TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" +
+	"YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
 
 // suppressScript is an index from langID to the dominant script for that language,
 // if it exists.  If a script is given, it should be suppressed from the language tag.
@@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{
 	// Entry 40 - 7F
 	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry C0 - FF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 100 - 13F
-	0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
+	0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00,
+	0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00,
 	// Entry 140 - 17F
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
 	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 180 - 1BF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00,
 	// Entry 1C0 - 1FF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08,
+	0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00,
 	// Entry 200 - 23F
 	0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 240 - 27F
-	0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00,
+	0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 280 - 2BF
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00,
+	0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 2C0 - 2FF
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20,
 	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
+	0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
 	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
 	// Entry 3C0 - 3FF
-	0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 400 - 43F
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
 	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
+	0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
 	// Entry 480 - 4BF
-	0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00,
+	0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 4C0 - 4FF
-	0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00,
+	0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 500 - 53F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{
 	0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b,
 	0x00, 0x00,
 }
 
@@ -1016,16 +1032,16 @@ const (
 	_419 = 31
 	_BR  = 65
 	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
+	_ES  = 111
+	_GB  = 124
+	_MD  = 189
+	_PT  = 239
+	_UK  = 307
+	_US  = 310
+	_ZZ  = 358
+	_XA  = 324
+	_XC  = 326
+	_XK  = 334
 )
 
 // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
@@ -1034,8 +1050,8 @@ const (
 const isoRegionOffset = 32
 
 // regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
+// Size: 359 bytes, 359 elements
+var regionTypes = [359]uint8{
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
@@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{
 	// Entry 40 - 7F
 	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06,
+	0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00,
 	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06,
 	// Entry 80 - BF
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04,
+	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05,
 	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
 	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+	0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
 	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06,
+	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
 	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
 	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
 	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06,
+	0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
 }
 
 // regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
@@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{
 //   - [A-Z}{2}: the first letter of the 2-letter code plus these two
 //     letters form the 3-letter ISO code.
 //   - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
+const regionISO tag.Index = "" + // Size: 1312 bytes
 	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
 	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
 	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+	"CQ  CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" +
+	"OMDYHYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSM" +
+	"FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" +
+	"NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERL" +
+	"ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" +
+	"\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" +
+	"LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" +
+	"MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" +
+	"NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" +
+	"\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" +
+	"QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" +
+	"SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" +
+	"SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" +
+	"TOTVUVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" +
+	"NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" +
+	"NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" +
+	"ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
 
 // altRegionISO3 holds a list of 3-letter region codes that cannot be
 // mapped to 2-letter codes using the default algorithm. This is a short list.
@@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
 // of the 3-letter ISO codes in altRegionISO3.
 // Size: 22 bytes, 11 elements
 var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
+	0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106,
+	0x0122, 0x0160, 0x00dd,
 }
 
 // Size: 80 bytes, 20 elements
 var regionOldMap = [20]FromTo{
-	0:  {From: 0x44, To: 0xc4},
-	1:  {From: 0x58, To: 0xa7},
-	2:  {From: 0x5f, To: 0x60},
-	3:  {From: 0x66, To: 0x3b},
-	4:  {From: 0x79, To: 0x78},
-	5:  {From: 0x93, To: 0x37},
-	6:  {From: 0xa3, To: 0x133},
-	7:  {From: 0xc1, To: 0x133},
-	8:  {From: 0xd7, To: 0x13f},
-	9:  {From: 0xdc, To: 0x2b},
-	10: {From: 0xef, To: 0x133},
-	11: {From: 0xf2, To: 0xe2},
-	12: {From: 0xfc, To: 0x70},
-	13: {From: 0x103, To: 0x164},
-	14: {From: 0x12a, To: 0x126},
-	15: {From: 0x132, To: 0x7b},
-	16: {From: 0x13a, To: 0x13e},
-	17: {From: 0x141, To: 0x133},
-	18: {From: 0x15d, To: 0x15e},
-	19: {From: 0x163, To: 0x4b},
+	0:  {From: 0x44, To: 0xc5},
+	1:  {From: 0x59, To: 0xa8},
+	2:  {From: 0x60, To: 0x61},
+	3:  {From: 0x67, To: 0x3b},
+	4:  {From: 0x7a, To: 0x79},
+	5:  {From: 0x94, To: 0x37},
+	6:  {From: 0xa4, To: 0x134},
+	7:  {From: 0xc2, To: 0x134},
+	8:  {From: 0xd8, To: 0x140},
+	9:  {From: 0xdd, To: 0x2b},
+	10: {From: 0xf0, To: 0x134},
+	11: {From: 0xf3, To: 0xe3},
+	12: {From: 0xfd, To: 0x71},
+	13: {From: 0x104, To: 0x165},
+	14: {From: 0x12b, To: 0x127},
+	15: {From: 0x133, To: 0x7c},
+	16: {From: 0x13b, To: 0x13f},
+	17: {From: 0x142, To: 0x134},
+	18: {From: 0x15e, To: 0x15f},
+	19: {From: 0x164, To: 0x4b},
 }
 
 // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
 // codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
+// Size: 718 bytes, 359 elements
+var m49 = [359]int16{
 	// Entry 0 - 3F
 	0, 1, 2, 3, 5, 9, 11, 13,
 	14, 15, 17, 18, 19, 21, 29, 30,
@@ -1168,45 +1184,45 @@ var m49 = [358]int16{
 	// Entry 40 - 7F
 	535, 76, 44, 64, 104, 74, 72, 112,
 	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
+	184, 152, 120, 156, 170, 0, 0, 188,
+	891, 296, 192, 132, 531, 162, 196, 203,
+	278, 276, 0, 262, 208, 212, 214, 204,
+	12, 0, 218, 233, 818, 732, 232, 724,
+	231, 967, 0, 246, 242, 238, 583, 234,
+	0, 250, 249, 266, 826, 308, 268, 254,
 	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
+	831, 288, 292, 304, 270, 324, 312, 226,
+	300, 239, 320, 316, 624, 328, 344, 334,
+	340, 191, 332, 348, 854, 0, 360, 372,
+	376, 833, 356, 86, 368, 364, 352, 380,
+	832, 388, 400, 392, 581, 404, 417, 116,
+	296, 174, 659, 408, 410, 414, 136, 398,
+	418, 422, 662, 438, 144, 430, 426, 440,
+	442, 428, 434, 504, 492, 498, 499, 663,
 	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
+	450, 584, 581, 807, 466, 104, 496, 446,
+	580, 474, 478, 500, 470, 480, 462, 454,
+	484, 458, 508, 516, 540, 562, 574, 566,
+	548, 558, 528, 578, 524, 10, 520, 536,
+	570, 554, 512, 591, 0, 604, 258, 598,
+	608, 586, 616, 666, 612, 630, 275, 620,
+	581, 585, 600, 591, 634, 959, 960, 961,
+	962, 963, 964, 965, 966, 967, 968, 969,
 	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
+	970, 971, 972, 638, 716, 642, 688, 643,
+	646, 682, 90, 690, 729, 752, 702, 654,
+	705, 744, 703, 694, 674, 686, 706, 740,
+	728, 678, 810, 222, 534, 760, 748, 0,
+	796, 148, 260, 768, 764, 762, 772, 626,
+	795, 788, 776, 626, 792, 780, 798, 158,
+	834, 804, 800, 826, 581, 0, 840, 858,
+	860, 336, 670, 704, 862, 92, 850, 704,
 	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
+	548, 876, 581, 882, 973, 974, 975, 976,
+	977, 978, 979, 980, 981, 982, 983, 984,
+	985, 986, 987, 988, 989, 990, 991, 992,
+	993, 994, 995, 996, 997, 998, 720, 887,
+	175, 891, 710, 894, 180, 716, 999,
 }
 
 // m49Index gives indexes into fromM49 based on the three most significant bits
@@ -1227,65 +1243,65 @@ var m49Index = [9]int16{
 var fromM49 = [333]uint16{
 	// Entry 0 - 3F
 	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+	0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
 	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
 	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
 	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
 	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+	0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047,
+	0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18,
 	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+	0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+	0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d,
+	0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f,
+	0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70,
+	0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73,
+	0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b,
+	0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882,
+	0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885,
 	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+	0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e,
+	0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f,
+	0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad,
+	0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba,
+	0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce,
+	0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6,
+	0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de,
+	0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df,
 	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+	0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6,
+	0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3,
+	0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c,
+	0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c,
+	0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514,
+	0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12,
+	0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118,
+	0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e,
 	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+	0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023,
+	0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3,
+	0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136,
+	0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f,
+	0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8,
+	0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500,
+	0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549,
+	0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551,
 	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+	0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559,
+	0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66,
 }
 
-// Size: 2014 bytes
+// Size: 2128 bytes
 var variantIndex = map[string]uint8{
 	"1606nict": 0x0,
 	"1694acad": 0x1,
 	"1901":     0x2,
 	"1959acad": 0x3,
-	"1994":     0x61,
+	"1994":     0x67,
 	"1996":     0x4,
 	"abl1943":  0x5,
 	"akuapem":  0x6,
-	"alalc97":  0x63,
+	"alalc97":  0x69,
 	"aluku":    0x7,
 	"ao1990":   0x8,
 	"aranes":   0x9,
@@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{
 	"barla":    0x11,
 	"basiceng": 0x12,
 	"bauddha":  0x13,
-	"biscayan": 0x14,
-	"biske":    0x5c,
-	"bohoric":  0x15,
-	"boont":    0x16,
-	"bornholm": 0x17,
-	"cisaup":   0x18,
-	"colb1945": 0x19,
-	"cornu":    0x1a,
-	"creiss":   0x1b,
-	"dajnko":   0x1c,
-	"ekavsk":   0x1d,
-	"emodeng":  0x1e,
-	"fonipa":   0x64,
-	"fonkirsh": 0x65,
-	"fonnapa":  0x66,
-	"fonupa":   0x67,
-	"fonxsamp": 0x68,
-	"gascon":   0x1f,
-	"grclass":  0x20,
-	"grital":   0x21,
-	"grmistr":  0x22,
-	"hepburn":  0x23,
-	"heploc":   0x62,
-	"hognorsk": 0x24,
-	"hsistemo": 0x25,
-	"ijekavsk": 0x26,
-	"itihasa":  0x27,
-	"ivanchov": 0x28,
-	"jauer":    0x29,
-	"jyutping": 0x2a,
-	"kkcor":    0x2b,
-	"kociewie": 0x2c,
-	"kscor":    0x2d,
-	"laukika":  0x2e,
-	"lemosin":  0x2f,
-	"lengadoc": 0x30,
-	"lipaw":    0x5d,
-	"luna1918": 0x31,
-	"metelko":  0x32,
-	"monoton":  0x33,
-	"ndyuka":   0x34,
-	"nedis":    0x35,
-	"newfound": 0x36,
-	"nicard":   0x37,
-	"njiva":    0x5e,
-	"nulik":    0x38,
-	"osojs":    0x5f,
-	"oxendict": 0x39,
-	"pahawh2":  0x3a,
-	"pahawh3":  0x3b,
-	"pahawh4":  0x3c,
-	"pamaka":   0x3d,
-	"peano":    0x3e,
-	"petr1708": 0x3f,
-	"pinyin":   0x40,
-	"polyton":  0x41,
-	"provenc":  0x42,
-	"puter":    0x43,
-	"rigik":    0x44,
-	"rozaj":    0x45,
-	"rumgr":    0x46,
-	"scotland": 0x47,
-	"scouse":   0x48,
-	"simple":   0x69,
-	"solba":    0x60,
-	"sotav":    0x49,
-	"spanglis": 0x4a,
-	"surmiran": 0x4b,
-	"sursilv":  0x4c,
-	"sutsilv":  0x4d,
-	"tarask":   0x4e,
-	"tongyong": 0x4f,
-	"tunumiit": 0x50,
-	"uccor":    0x51,
-	"ucrcor":   0x52,
-	"ulster":   0x53,
-	"unifon":   0x54,
-	"vaidika":  0x55,
-	"valencia": 0x56,
-	"vallader": 0x57,
-	"vecdruka": 0x58,
-	"vivaraup": 0x59,
-	"wadegile": 0x5a,
-	"xsistemo": 0x5b,
+	"bciav":    0x14,
+	"bcizbl":   0x15,
+	"biscayan": 0x16,
+	"biske":    0x62,
+	"bohoric":  0x17,
+	"boont":    0x18,
+	"bornholm": 0x19,
+	"cisaup":   0x1a,
+	"colb1945": 0x1b,
+	"cornu":    0x1c,
+	"creiss":   0x1d,
+	"dajnko":   0x1e,
+	"ekavsk":   0x1f,
+	"emodeng":  0x20,
+	"fonipa":   0x6a,
+	"fonkirsh": 0x6b,
+	"fonnapa":  0x6c,
+	"fonupa":   0x6d,
+	"fonxsamp": 0x6e,
+	"gallo":    0x21,
+	"gascon":   0x22,
+	"grclass":  0x23,
+	"grital":   0x24,
+	"grmistr":  0x25,
+	"hepburn":  0x26,
+	"heploc":   0x68,
+	"hognorsk": 0x27,
+	"hsistemo": 0x28,
+	"ijekavsk": 0x29,
+	"itihasa":  0x2a,
+	"ivanchov": 0x2b,
+	"jauer":    0x2c,
+	"jyutping": 0x2d,
+	"kkcor":    0x2e,
+	"kociewie": 0x2f,
+	"kscor":    0x30,
+	"laukika":  0x31,
+	"lemosin":  0x32,
+	"lengadoc": 0x33,
+	"lipaw":    0x63,
+	"ltg1929":  0x34,
+	"ltg2007":  0x35,
+	"luna1918": 0x36,
+	"metelko":  0x37,
+	"monoton":  0x38,
+	"ndyuka":   0x39,
+	"nedis":    0x3a,
+	"newfound": 0x3b,
+	"nicard":   0x3c,
+	"njiva":    0x64,
+	"nulik":    0x3d,
+	"osojs":    0x65,
+	"oxendict": 0x3e,
+	"pahawh2":  0x3f,
+	"pahawh3":  0x40,
+	"pahawh4":  0x41,
+	"pamaka":   0x42,
+	"peano":    0x43,
+	"petr1708": 0x44,
+	"pinyin":   0x45,
+	"polyton":  0x46,
+	"provenc":  0x47,
+	"puter":    0x48,
+	"rigik":    0x49,
+	"rozaj":    0x4a,
+	"rumgr":    0x4b,
+	"scotland": 0x4c,
+	"scouse":   0x4d,
+	"simple":   0x6f,
+	"solba":    0x66,
+	"sotav":    0x4e,
+	"spanglis": 0x4f,
+	"surmiran": 0x50,
+	"sursilv":  0x51,
+	"sutsilv":  0x52,
+	"synnejyl": 0x53,
+	"tarask":   0x54,
+	"tongyong": 0x55,
+	"tunumiit": 0x56,
+	"uccor":    0x57,
+	"ucrcor":   0x58,
+	"ulster":   0x59,
+	"unifon":   0x5a,
+	"vaidika":  0x5b,
+	"valencia": 0x5c,
+	"vallader": 0x5d,
+	"vecdruka": 0x5e,
+	"vivaraup": 0x5f,
+	"wadegile": 0x60,
+	"xsistemo": 0x61,
 }
 
 // variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 99
+const variantNumSpecialized = 105
 
 // nRegionGroups is the number of region groups.
 const nRegionGroups = 33
@@ -1398,151 +1420,151 @@ type likelyLangRegion struct {
 
 // likelyScript is a lookup table, indexed by scriptID, for the most likely
 // languages and regions given a script.
-// Size: 1040 bytes, 260 elements
-var likelyScript = [260]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
+// Size: 1052 bytes, 263 elements
+var likelyScript = [263]likelyLangRegion{
+	1:   {lang: 0x14e, region: 0x85},
+	3:   {lang: 0x2a2, region: 0x107},
+	4:   {lang: 0x1f, region: 0x9a},
+	5:   {lang: 0x3a, region: 0x6c},
+	7:   {lang: 0x3b, region: 0x9d},
 	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
+	9:   {lang: 0x13, region: 0x9d},
+	10:  {lang: 0x5b, region: 0x96},
 	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
+	12:  {lang: 0xb9, region: 0xb5},
+	13:  {lang: 0x63, region: 0x96},
 	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
+	15:  {lang: 0x3e9, region: 0x9a},
+	17:  {lang: 0x529, region: 0x12f},
+	18:  {lang: 0x3b1, region: 0x9a},
+	19:  {lang: 0x15e, region: 0x79},
+	20:  {lang: 0xc2, region: 0x96},
+	21:  {lang: 0x9d, region: 0xe8},
 	22:  {lang: 0xdb, region: 0x35},
 	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	29:  {lang: 0xf1, region: 0x6b},
-	31:  {lang: 0x1a0, region: 0x5d},
-	32:  {lang: 0x3e2, region: 0x106},
-	34:  {lang: 0x1be, region: 0x99},
-	38:  {lang: 0x15e, region: 0x78},
-	41:  {lang: 0x133, region: 0x6b},
+	24:  {lang: 0x4f0, region: 0x12c},
+	25:  {lang: 0xe7, region: 0x13f},
+	26:  {lang: 0xe5, region: 0x136},
+	29:  {lang: 0xf1, region: 0x6c},
+	31:  {lang: 0x1a0, region: 0x5e},
+	32:  {lang: 0x3e2, region: 0x107},
+	34:  {lang: 0x1be, region: 0x9a},
+	38:  {lang: 0x15e, region: 0x79},
+	41:  {lang: 0x133, region: 0x6c},
 	42:  {lang: 0x431, region: 0x27},
-	44:  {lang: 0x27, region: 0x6f},
-	46:  {lang: 0x210, region: 0x7d},
+	44:  {lang: 0x27, region: 0x70},
+	46:  {lang: 0x210, region: 0x7e},
 	47:  {lang: 0xfe, region: 0x38},
-	49:  {lang: 0x19b, region: 0x99},
-	50:  {lang: 0x19e, region: 0x130},
-	51:  {lang: 0x3e9, region: 0x99},
-	52:  {lang: 0x136, region: 0x87},
-	53:  {lang: 0x1a4, region: 0x99},
-	54:  {lang: 0x39d, region: 0x99},
-	55:  {lang: 0x529, region: 0x12e},
-	56:  {lang: 0x254, region: 0xab},
+	49:  {lang: 0x19b, region: 0x9a},
+	50:  {lang: 0x19e, region: 0x131},
+	51:  {lang: 0x3e9, region: 0x9a},
+	52:  {lang: 0x136, region: 0x88},
+	53:  {lang: 0x1a4, region: 0x9a},
+	54:  {lang: 0x39d, region: 0x9a},
+	55:  {lang: 0x529, region: 0x12f},
+	56:  {lang: 0x254, region: 0xac},
 	57:  {lang: 0x529, region: 0x53},
-	58:  {lang: 0x1cb, region: 0xe7},
+	58:  {lang: 0x1cb, region: 0xe8},
 	59:  {lang: 0x529, region: 0x53},
-	60:  {lang: 0x529, region: 0x12e},
-	61:  {lang: 0x2fd, region: 0x9b},
-	62:  {lang: 0x1bc, region: 0x97},
-	63:  {lang: 0x200, region: 0xa2},
-	64:  {lang: 0x1c5, region: 0x12b},
-	65:  {lang: 0x1ca, region: 0xaf},
-	68:  {lang: 0x1d5, region: 0x92},
-	70:  {lang: 0x142, region: 0x9e},
-	71:  {lang: 0x254, region: 0xab},
-	72:  {lang: 0x20e, region: 0x95},
-	73:  {lang: 0x200, region: 0xa2},
-	75:  {lang: 0x135, region: 0xc4},
-	76:  {lang: 0x200, region: 0xa2},
-	77:  {lang: 0x3bb, region: 0xe8},
-	78:  {lang: 0x24a, region: 0xa6},
-	79:  {lang: 0x3fa, region: 0x99},
-	82:  {lang: 0x251, region: 0x99},
-	83:  {lang: 0x254, region: 0xab},
-	85:  {lang: 0x88, region: 0x99},
-	86:  {lang: 0x370, region: 0x123},
-	87:  {lang: 0x2b8, region: 0xaf},
-	92:  {lang: 0x29f, region: 0x99},
-	93:  {lang: 0x2a8, region: 0x99},
-	94:  {lang: 0x28f, region: 0x87},
-	95:  {lang: 0x1a0, region: 0x87},
-	96:  {lang: 0x2ac, region: 0x53},
-	98:  {lang: 0x4f4, region: 0x12b},
-	99:  {lang: 0x4f5, region: 0x12b},
-	100: {lang: 0x1be, region: 0x99},
-	102: {lang: 0x337, region: 0x9c},
-	103: {lang: 0x4f7, region: 0x53},
-	104: {lang: 0xa9, region: 0x53},
-	107: {lang: 0x2e8, region: 0x112},
-	108: {lang: 0x4f8, region: 0x10b},
-	109: {lang: 0x4f8, region: 0x10b},
-	110: {lang: 0x304, region: 0x99},
-	111: {lang: 0x31b, region: 0x99},
-	112: {lang: 0x30b, region: 0x53},
-	114: {lang: 0x31e, region: 0x35},
-	115: {lang: 0x30e, region: 0x99},
-	116: {lang: 0x414, region: 0xe8},
-	117: {lang: 0x331, region: 0xc4},
-	119: {lang: 0x4f9, region: 0x108},
-	120: {lang: 0x3b, region: 0xa1},
-	121: {lang: 0x353, region: 0xdb},
-	124: {lang: 0x2d0, region: 0x84},
-	125: {lang: 0x52a, region: 0x53},
-	126: {lang: 0x403, region: 0x96},
-	127: {lang: 0x3ee, region: 0x99},
-	128: {lang: 0x39b, region: 0xc5},
-	129: {lang: 0x395, region: 0x99},
-	130: {lang: 0x399, region: 0x135},
-	131: {lang: 0x429, region: 0x115},
-	133: {lang: 0x3b, region: 0x11c},
-	134: {lang: 0xfd, region: 0xc4},
-	137: {lang: 0x27d, region: 0x106},
-	138: {lang: 0x2c9, region: 0x53},
-	139: {lang: 0x39f, region: 0x9c},
-	140: {lang: 0x39f, region: 0x53},
-	142: {lang: 0x3ad, region: 0xb0},
-	144: {lang: 0x1c6, region: 0x53},
-	145: {lang: 0x4fd, region: 0x9c},
-	198: {lang: 0x3cb, region: 0x95},
-	201: {lang: 0x372, region: 0x10c},
-	202: {lang: 0x420, region: 0x97},
-	204: {lang: 0x4ff, region: 0x15e},
-	205: {lang: 0x3f0, region: 0x99},
-	206: {lang: 0x45, region: 0x135},
-	207: {lang: 0x139, region: 0x7b},
-	208: {lang: 0x3e9, region: 0x99},
-	210: {lang: 0x3e9, region: 0x99},
-	211: {lang: 0x3fa, region: 0x99},
-	212: {lang: 0x40c, region: 0xb3},
-	215: {lang: 0x433, region: 0x99},
-	216: {lang: 0xef, region: 0xc5},
-	217: {lang: 0x43e, region: 0x95},
-	218: {lang: 0x44d, region: 0x35},
-	219: {lang: 0x44e, region: 0x9b},
-	223: {lang: 0x45a, region: 0xe7},
-	224: {lang: 0x11a, region: 0x99},
-	225: {lang: 0x45e, region: 0x53},
-	226: {lang: 0x232, region: 0x53},
-	227: {lang: 0x450, region: 0x99},
-	228: {lang: 0x4a5, region: 0x53},
-	229: {lang: 0x9f, region: 0x13e},
-	230: {lang: 0x461, region: 0x99},
-	232: {lang: 0x528, region: 0xba},
-	233: {lang: 0x153, region: 0xe7},
-	234: {lang: 0x128, region: 0xcd},
-	235: {lang: 0x46b, region: 0x123},
-	236: {lang: 0xa9, region: 0x53},
-	237: {lang: 0x2ce, region: 0x99},
-	240: {lang: 0x4ad, region: 0x11c},
-	241: {lang: 0x4be, region: 0xb4},
-	244: {lang: 0x1ce, region: 0x99},
-	247: {lang: 0x3a9, region: 0x9c},
-	248: {lang: 0x22, region: 0x9b},
-	250: {lang: 0x1ea, region: 0x53},
-	251: {lang: 0xef, region: 0xc5},
+	60:  {lang: 0x529, region: 0x12f},
+	61:  {lang: 0x2fd, region: 0x9c},
+	62:  {lang: 0x1bc, region: 0x98},
+	63:  {lang: 0x200, region: 0xa3},
+	64:  {lang: 0x1c5, region: 0x12c},
+	65:  {lang: 0x1ca, region: 0xb0},
+	68:  {lang: 0x1d5, region: 0x93},
+	70:  {lang: 0x142, region: 0x9f},
+	71:  {lang: 0x254, region: 0xac},
+	72:  {lang: 0x20e, region: 0x96},
+	73:  {lang: 0x200, region: 0xa3},
+	75:  {lang: 0x135, region: 0xc5},
+	76:  {lang: 0x200, region: 0xa3},
+	78:  {lang: 0x3bb, region: 0xe9},
+	79:  {lang: 0x24a, region: 0xa7},
+	80:  {lang: 0x3fa, region: 0x9a},
+	83:  {lang: 0x251, region: 0x9a},
+	84:  {lang: 0x254, region: 0xac},
+	86:  {lang: 0x88, region: 0x9a},
+	87:  {lang: 0x370, region: 0x124},
+	88:  {lang: 0x2b8, region: 0xb0},
+	93:  {lang: 0x29f, region: 0x9a},
+	94:  {lang: 0x2a8, region: 0x9a},
+	95:  {lang: 0x28f, region: 0x88},
+	96:  {lang: 0x1a0, region: 0x88},
+	97:  {lang: 0x2ac, region: 0x53},
+	99:  {lang: 0x4f4, region: 0x12c},
+	100: {lang: 0x4f5, region: 0x12c},
+	101: {lang: 0x1be, region: 0x9a},
+	103: {lang: 0x337, region: 0x9d},
+	104: {lang: 0x4f7, region: 0x53},
+	105: {lang: 0xa9, region: 0x53},
+	108: {lang: 0x2e8, region: 0x113},
+	109: {lang: 0x4f8, region: 0x10c},
+	110: {lang: 0x4f8, region: 0x10c},
+	111: {lang: 0x304, region: 0x9a},
+	112: {lang: 0x31b, region: 0x9a},
+	113: {lang: 0x30b, region: 0x53},
+	115: {lang: 0x31e, region: 0x35},
+	116: {lang: 0x30e, region: 0x9a},
+	117: {lang: 0x414, region: 0xe9},
+	118: {lang: 0x331, region: 0xc5},
+	121: {lang: 0x4f9, region: 0x109},
+	122: {lang: 0x3b, region: 0xa2},
+	123: {lang: 0x353, region: 0xdc},
+	126: {lang: 0x2d0, region: 0x85},
+	127: {lang: 0x52a, region: 0x53},
+	128: {lang: 0x403, region: 0x97},
+	129: {lang: 0x3ee, region: 0x9a},
+	130: {lang: 0x39b, region: 0xc6},
+	131: {lang: 0x395, region: 0x9a},
+	132: {lang: 0x399, region: 0x136},
+	133: {lang: 0x429, region: 0x116},
+	135: {lang: 0x3b, region: 0x11d},
+	136: {lang: 0xfd, region: 0xc5},
+	139: {lang: 0x27d, region: 0x107},
+	140: {lang: 0x2c9, region: 0x53},
+	141: {lang: 0x39f, region: 0x9d},
+	142: {lang: 0x39f, region: 0x53},
+	144: {lang: 0x3ad, region: 0xb1},
+	146: {lang: 0x1c6, region: 0x53},
+	147: {lang: 0x4fd, region: 0x9d},
+	200: {lang: 0x3cb, region: 0x96},
+	203: {lang: 0x372, region: 0x10d},
+	204: {lang: 0x420, region: 0x98},
+	206: {lang: 0x4ff, region: 0x15f},
+	207: {lang: 0x3f0, region: 0x9a},
+	208: {lang: 0x45, region: 0x136},
+	209: {lang: 0x139, region: 0x7c},
+	210: {lang: 0x3e9, region: 0x9a},
+	212: {lang: 0x3e9, region: 0x9a},
+	213: {lang: 0x3fa, region: 0x9a},
+	214: {lang: 0x40c, region: 0xb4},
+	217: {lang: 0x433, region: 0x9a},
+	218: {lang: 0xef, region: 0xc6},
+	219: {lang: 0x43e, region: 0x96},
+	221: {lang: 0x44d, region: 0x35},
+	222: {lang: 0x44e, region: 0x9c},
+	226: {lang: 0x45a, region: 0xe8},
+	227: {lang: 0x11a, region: 0x9a},
+	228: {lang: 0x45e, region: 0x53},
+	229: {lang: 0x232, region: 0x53},
+	230: {lang: 0x450, region: 0x9a},
+	231: {lang: 0x4a5, region: 0x53},
+	232: {lang: 0x9f, region: 0x13f},
+	233: {lang: 0x461, region: 0x9a},
+	235: {lang: 0x528, region: 0xbb},
+	236: {lang: 0x153, region: 0xe8},
+	237: {lang: 0x128, region: 0xce},
+	238: {lang: 0x46b, region: 0x124},
+	239: {lang: 0xa9, region: 0x53},
+	240: {lang: 0x2ce, region: 0x9a},
+	243: {lang: 0x4ad, region: 0x11d},
+	244: {lang: 0x4be, region: 0xb5},
+	247: {lang: 0x1ce, region: 0x9a},
+	250: {lang: 0x3a9, region: 0x9d},
+	251: {lang: 0x22, region: 0x9c},
+	253: {lang: 0x1ea, region: 0x53},
+	254: {lang: 0xef, region: 0xc6},
 }
 
 type likelyScriptRegion struct {
@@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct {
 // of the list in likelyLangList.
 // Size: 7980 bytes, 1330 elements
 var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x5a, flags: 0x0},
-	1:    {region: 0x6f, script: 0x5a, flags: 0x0},
-	2:    {region: 0x165, script: 0x5a, flags: 0x0},
-	3:    {region: 0x165, script: 0x5a, flags: 0x0},
-	4:    {region: 0x165, script: 0x5a, flags: 0x0},
-	5:    {region: 0x7d, script: 0x20, flags: 0x0},
-	6:    {region: 0x165, script: 0x5a, flags: 0x0},
-	7:    {region: 0x165, script: 0x20, flags: 0x0},
-	8:    {region: 0x80, script: 0x5a, flags: 0x0},
-	9:    {region: 0x165, script: 0x5a, flags: 0x0},
-	10:   {region: 0x165, script: 0x5a, flags: 0x0},
-	11:   {region: 0x165, script: 0x5a, flags: 0x0},
-	12:   {region: 0x95, script: 0x5a, flags: 0x0},
-	13:   {region: 0x131, script: 0x5a, flags: 0x0},
-	14:   {region: 0x80, script: 0x5a, flags: 0x0},
-	15:   {region: 0x165, script: 0x5a, flags: 0x0},
-	16:   {region: 0x165, script: 0x5a, flags: 0x0},
-	17:   {region: 0x106, script: 0x20, flags: 0x0},
-	18:   {region: 0x165, script: 0x5a, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x5a, flags: 0x0},
-	22:   {region: 0x161, script: 0x5a, flags: 0x0},
-	23:   {region: 0x165, script: 0x5a, flags: 0x0},
-	24:   {region: 0x165, script: 0x5a, flags: 0x0},
-	25:   {region: 0x165, script: 0x5a, flags: 0x0},
-	26:   {region: 0x165, script: 0x5a, flags: 0x0},
-	27:   {region: 0x165, script: 0x5a, flags: 0x0},
-	28:   {region: 0x52, script: 0x5a, flags: 0x0},
-	29:   {region: 0x165, script: 0x5a, flags: 0x0},
-	30:   {region: 0x165, script: 0x5a, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x5a, flags: 0x0},
-	33:   {region: 0x80, script: 0x5a, flags: 0x0},
-	34:   {region: 0x9b, script: 0xf8, flags: 0x0},
-	35:   {region: 0x165, script: 0x5a, flags: 0x0},
-	36:   {region: 0x165, script: 0x5a, flags: 0x0},
-	37:   {region: 0x14d, script: 0x5a, flags: 0x0},
-	38:   {region: 0x106, script: 0x20, flags: 0x0},
-	39:   {region: 0x6f, script: 0x2c, flags: 0x0},
-	40:   {region: 0x165, script: 0x5a, flags: 0x0},
-	41:   {region: 0x165, script: 0x5a, flags: 0x0},
-	42:   {region: 0xd6, script: 0x5a, flags: 0x0},
-	43:   {region: 0x165, script: 0x5a, flags: 0x0},
-	45:   {region: 0x165, script: 0x5a, flags: 0x0},
-	46:   {region: 0x165, script: 0x5a, flags: 0x0},
-	47:   {region: 0x165, script: 0x5a, flags: 0x0},
-	48:   {region: 0x165, script: 0x5a, flags: 0x0},
-	49:   {region: 0x165, script: 0x5a, flags: 0x0},
-	50:   {region: 0x165, script: 0x5a, flags: 0x0},
-	51:   {region: 0x95, script: 0x5a, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x5a, flags: 0x0},
-	55:   {region: 0x165, script: 0x5a, flags: 0x0},
-	56:   {region: 0x165, script: 0x5a, flags: 0x0},
-	57:   {region: 0x165, script: 0x5a, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
+	0:    {region: 0x136, script: 0x5b, flags: 0x0},
+	1:    {region: 0x70, script: 0x5b, flags: 0x0},
+	2:    {region: 0x166, script: 0x5b, flags: 0x0},
+	3:    {region: 0x166, script: 0x5b, flags: 0x0},
+	4:    {region: 0x166, script: 0x5b, flags: 0x0},
+	5:    {region: 0x7e, script: 0x20, flags: 0x0},
+	6:    {region: 0x166, script: 0x5b, flags: 0x0},
+	7:    {region: 0x166, script: 0x20, flags: 0x0},
+	8:    {region: 0x81, script: 0x5b, flags: 0x0},
+	9:    {region: 0x166, script: 0x5b, flags: 0x0},
+	10:   {region: 0x166, script: 0x5b, flags: 0x0},
+	11:   {region: 0x166, script: 0x5b, flags: 0x0},
+	12:   {region: 0x96, script: 0x5b, flags: 0x0},
+	13:   {region: 0x132, script: 0x5b, flags: 0x0},
+	14:   {region: 0x81, script: 0x5b, flags: 0x0},
+	15:   {region: 0x166, script: 0x5b, flags: 0x0},
+	16:   {region: 0x166, script: 0x5b, flags: 0x0},
+	17:   {region: 0x107, script: 0x20, flags: 0x0},
+	18:   {region: 0x166, script: 0x5b, flags: 0x0},
+	19:   {region: 0x9d, script: 0x9, flags: 0x0},
+	20:   {region: 0x129, script: 0x5, flags: 0x0},
+	21:   {region: 0x166, script: 0x5b, flags: 0x0},
+	22:   {region: 0x162, script: 0x5b, flags: 0x0},
+	23:   {region: 0x166, script: 0x5b, flags: 0x0},
+	24:   {region: 0x166, script: 0x5b, flags: 0x0},
+	25:   {region: 0x166, script: 0x5b, flags: 0x0},
+	26:   {region: 0x166, script: 0x5b, flags: 0x0},
+	27:   {region: 0x166, script: 0x5b, flags: 0x0},
+	28:   {region: 0x52, script: 0x5b, flags: 0x0},
+	29:   {region: 0x166, script: 0x5b, flags: 0x0},
+	30:   {region: 0x166, script: 0x5b, flags: 0x0},
+	31:   {region: 0x9a, script: 0x4, flags: 0x0},
+	32:   {region: 0x166, script: 0x5b, flags: 0x0},
+	33:   {region: 0x81, script: 0x5b, flags: 0x0},
+	34:   {region: 0x9c, script: 0xfb, flags: 0x0},
+	35:   {region: 0x166, script: 0x5b, flags: 0x0},
+	36:   {region: 0x166, script: 0x5b, flags: 0x0},
+	37:   {region: 0x14e, script: 0x5b, flags: 0x0},
+	38:   {region: 0x107, script: 0x20, flags: 0x0},
+	39:   {region: 0x70, script: 0x2c, flags: 0x0},
+	40:   {region: 0x166, script: 0x5b, flags: 0x0},
+	41:   {region: 0x166, script: 0x5b, flags: 0x0},
+	42:   {region: 0xd7, script: 0x5b, flags: 0x0},
+	43:   {region: 0x166, script: 0x5b, flags: 0x0},
+	45:   {region: 0x166, script: 0x5b, flags: 0x0},
+	46:   {region: 0x166, script: 0x5b, flags: 0x0},
+	47:   {region: 0x166, script: 0x5b, flags: 0x0},
+	48:   {region: 0x166, script: 0x5b, flags: 0x0},
+	49:   {region: 0x166, script: 0x5b, flags: 0x0},
+	50:   {region: 0x166, script: 0x5b, flags: 0x0},
+	51:   {region: 0x96, script: 0x5b, flags: 0x0},
+	52:   {region: 0x166, script: 0x5, flags: 0x0},
+	53:   {region: 0x123, script: 0x5, flags: 0x0},
+	54:   {region: 0x166, script: 0x5b, flags: 0x0},
+	55:   {region: 0x166, script: 0x5b, flags: 0x0},
+	56:   {region: 0x166, script: 0x5b, flags: 0x0},
+	57:   {region: 0x166, script: 0x5b, flags: 0x0},
+	58:   {region: 0x6c, script: 0x5, flags: 0x0},
 	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x5a, flags: 0x0},
-	61:   {region: 0x51, script: 0x5a, flags: 0x0},
-	62:   {region: 0x3f, script: 0x5a, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x5a, flags: 0x0},
-	69:   {region: 0x135, script: 0xce, flags: 0x0},
-	70:   {region: 0x165, script: 0x5a, flags: 0x0},
-	71:   {region: 0x165, script: 0x5a, flags: 0x0},
-	72:   {region: 0x6e, script: 0x5a, flags: 0x0},
-	73:   {region: 0x165, script: 0x5a, flags: 0x0},
-	74:   {region: 0x165, script: 0x5a, flags: 0x0},
-	75:   {region: 0x49, script: 0x5a, flags: 0x0},
-	76:   {region: 0x165, script: 0x5a, flags: 0x0},
-	77:   {region: 0x106, script: 0x20, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x5a, flags: 0x0},
-	80:   {region: 0x165, script: 0x5a, flags: 0x0},
-	81:   {region: 0x165, script: 0x5a, flags: 0x0},
-	82:   {region: 0x99, script: 0x22, flags: 0x0},
-	83:   {region: 0x165, script: 0x5a, flags: 0x0},
-	84:   {region: 0x165, script: 0x5a, flags: 0x0},
-	85:   {region: 0x165, script: 0x5a, flags: 0x0},
-	86:   {region: 0x3f, script: 0x5a, flags: 0x0},
-	87:   {region: 0x165, script: 0x5a, flags: 0x0},
+	60:   {region: 0x166, script: 0x5b, flags: 0x0},
+	61:   {region: 0x51, script: 0x5b, flags: 0x0},
+	62:   {region: 0x3f, script: 0x5b, flags: 0x0},
+	63:   {region: 0x68, script: 0x5, flags: 0x0},
+	65:   {region: 0xbb, script: 0x5, flags: 0x0},
+	66:   {region: 0x6c, script: 0x5, flags: 0x0},
+	67:   {region: 0x9a, script: 0xe, flags: 0x0},
+	68:   {region: 0x130, script: 0x5b, flags: 0x0},
+	69:   {region: 0x136, script: 0xd0, flags: 0x0},
+	70:   {region: 0x166, script: 0x5b, flags: 0x0},
+	71:   {region: 0x166, script: 0x5b, flags: 0x0},
+	72:   {region: 0x6f, script: 0x5b, flags: 0x0},
+	73:   {region: 0x166, script: 0x5b, flags: 0x0},
+	74:   {region: 0x166, script: 0x5b, flags: 0x0},
+	75:   {region: 0x49, script: 0x5b, flags: 0x0},
+	76:   {region: 0x166, script: 0x5b, flags: 0x0},
+	77:   {region: 0x107, script: 0x20, flags: 0x0},
+	78:   {region: 0x166, script: 0x5, flags: 0x0},
+	79:   {region: 0x166, script: 0x5b, flags: 0x0},
+	80:   {region: 0x166, script: 0x5b, flags: 0x0},
+	81:   {region: 0x166, script: 0x5b, flags: 0x0},
+	82:   {region: 0x9a, script: 0x22, flags: 0x0},
+	83:   {region: 0x166, script: 0x5b, flags: 0x0},
+	84:   {region: 0x166, script: 0x5b, flags: 0x0},
+	85:   {region: 0x166, script: 0x5b, flags: 0x0},
+	86:   {region: 0x3f, script: 0x5b, flags: 0x0},
+	87:   {region: 0x166, script: 0x5b, flags: 0x0},
 	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x20, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x5a, flags: 0x0},
-	92:   {region: 0xdb, script: 0x22, flags: 0x0},
-	93:   {region: 0x2e, script: 0x5a, flags: 0x0},
-	94:   {region: 0x52, script: 0x5a, flags: 0x0},
-	95:   {region: 0x165, script: 0x5a, flags: 0x0},
+	89:   {region: 0x107, script: 0x20, flags: 0x0},
+	90:   {region: 0xe9, script: 0x5, flags: 0x0},
+	91:   {region: 0x96, script: 0x5b, flags: 0x0},
+	92:   {region: 0xdc, script: 0x22, flags: 0x0},
+	93:   {region: 0x2e, script: 0x5b, flags: 0x0},
+	94:   {region: 0x52, script: 0x5b, flags: 0x0},
+	95:   {region: 0x166, script: 0x5b, flags: 0x0},
 	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x5a, flags: 0x0},
-	98:   {region: 0x165, script: 0x5a, flags: 0x0},
-	99:   {region: 0x95, script: 0x5a, flags: 0x0},
-	100:  {region: 0x165, script: 0x5a, flags: 0x0},
-	101:  {region: 0x52, script: 0x5a, flags: 0x0},
-	102:  {region: 0x165, script: 0x5a, flags: 0x0},
-	103:  {region: 0x165, script: 0x5a, flags: 0x0},
-	104:  {region: 0x165, script: 0x5a, flags: 0x0},
-	105:  {region: 0x165, script: 0x5a, flags: 0x0},
-	106:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	107:  {region: 0x165, script: 0x5a, flags: 0x0},
-	108:  {region: 0x165, script: 0x5a, flags: 0x0},
-	109:  {region: 0x165, script: 0x5a, flags: 0x0},
-	110:  {region: 0x165, script: 0x2c, flags: 0x0},
-	111:  {region: 0x165, script: 0x5a, flags: 0x0},
-	112:  {region: 0x165, script: 0x5a, flags: 0x0},
+	97:   {region: 0x166, script: 0x5b, flags: 0x0},
+	98:   {region: 0x166, script: 0x5b, flags: 0x0},
+	99:   {region: 0x96, script: 0x5b, flags: 0x0},
+	100:  {region: 0x166, script: 0x5b, flags: 0x0},
+	101:  {region: 0x52, script: 0x5b, flags: 0x0},
+	102:  {region: 0x166, script: 0x5b, flags: 0x0},
+	103:  {region: 0x166, script: 0x5b, flags: 0x0},
+	104:  {region: 0x166, script: 0x5b, flags: 0x0},
+	105:  {region: 0x166, script: 0x5b, flags: 0x0},
+	106:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	107:  {region: 0x166, script: 0x5b, flags: 0x0},
+	108:  {region: 0x166, script: 0x5b, flags: 0x0},
+	109:  {region: 0x166, script: 0x5b, flags: 0x0},
+	110:  {region: 0x166, script: 0x2c, flags: 0x0},
+	111:  {region: 0x166, script: 0x5b, flags: 0x0},
+	112:  {region: 0x166, script: 0x5b, flags: 0x0},
 	113:  {region: 0x47, script: 0x20, flags: 0x0},
-	114:  {region: 0x165, script: 0x5a, flags: 0x0},
-	115:  {region: 0x165, script: 0x5a, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x5a, flags: 0x0},
-	118:  {region: 0x165, script: 0x5a, flags: 0x0},
-	119:  {region: 0x95, script: 0x5a, flags: 0x0},
-	120:  {region: 0x165, script: 0x5a, flags: 0x0},
-	121:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	122:  {region: 0x52, script: 0x5a, flags: 0x0},
-	123:  {region: 0x99, script: 0xe3, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x22, flags: 0x0},
+	114:  {region: 0x166, script: 0x5b, flags: 0x0},
+	115:  {region: 0x166, script: 0x5b, flags: 0x0},
+	116:  {region: 0x10c, script: 0x5, flags: 0x0},
+	117:  {region: 0x163, script: 0x5b, flags: 0x0},
+	118:  {region: 0x166, script: 0x5b, flags: 0x0},
+	119:  {region: 0x96, script: 0x5b, flags: 0x0},
+	120:  {region: 0x166, script: 0x5b, flags: 0x0},
+	121:  {region: 0x130, script: 0x5b, flags: 0x0},
+	122:  {region: 0x52, script: 0x5b, flags: 0x0},
+	123:  {region: 0x9a, script: 0xe6, flags: 0x0},
+	124:  {region: 0xe9, script: 0x5, flags: 0x0},
+	125:  {region: 0x9a, script: 0x22, flags: 0x0},
 	126:  {region: 0x38, script: 0x20, flags: 0x0},
-	127:  {region: 0x99, script: 0x22, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x34, flags: 0x0},
-	131:  {region: 0x99, script: 0x22, flags: 0x0},
-	132:  {region: 0x165, script: 0x5a, flags: 0x0},
-	133:  {region: 0x99, script: 0x22, flags: 0x0},
-	134:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	135:  {region: 0x165, script: 0x5a, flags: 0x0},
-	136:  {region: 0x99, script: 0x22, flags: 0x0},
-	137:  {region: 0x165, script: 0x5a, flags: 0x0},
-	138:  {region: 0x13f, script: 0x5a, flags: 0x0},
-	139:  {region: 0x165, script: 0x5a, flags: 0x0},
-	140:  {region: 0x165, script: 0x5a, flags: 0x0},
-	141:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	142:  {region: 0x165, script: 0x5a, flags: 0x0},
-	143:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	144:  {region: 0x165, script: 0x5a, flags: 0x0},
-	145:  {region: 0x165, script: 0x5a, flags: 0x0},
-	146:  {region: 0x165, script: 0x5a, flags: 0x0},
-	147:  {region: 0x165, script: 0x2c, flags: 0x0},
-	148:  {region: 0x99, script: 0x22, flags: 0x0},
-	149:  {region: 0x95, script: 0x5a, flags: 0x0},
-	150:  {region: 0x165, script: 0x5a, flags: 0x0},
-	151:  {region: 0x165, script: 0x5a, flags: 0x0},
-	152:  {region: 0x114, script: 0x5a, flags: 0x0},
-	153:  {region: 0x165, script: 0x5a, flags: 0x0},
-	154:  {region: 0x165, script: 0x5a, flags: 0x0},
-	155:  {region: 0x52, script: 0x5a, flags: 0x0},
-	156:  {region: 0x165, script: 0x5a, flags: 0x0},
-	157:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	158:  {region: 0x165, script: 0x5a, flags: 0x0},
-	159:  {region: 0x13e, script: 0xe5, flags: 0x0},
-	160:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	161:  {region: 0x165, script: 0x5a, flags: 0x0},
-	162:  {region: 0x165, script: 0x5a, flags: 0x0},
-	163:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	164:  {region: 0x165, script: 0x5a, flags: 0x0},
+	127:  {region: 0x9a, script: 0x22, flags: 0x0},
+	128:  {region: 0xe9, script: 0x5, flags: 0x0},
+	129:  {region: 0x12c, script: 0x34, flags: 0x0},
+	131:  {region: 0x9a, script: 0x22, flags: 0x0},
+	132:  {region: 0x166, script: 0x5b, flags: 0x0},
+	133:  {region: 0x9a, script: 0x22, flags: 0x0},
+	134:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	135:  {region: 0x166, script: 0x5b, flags: 0x0},
+	136:  {region: 0x9a, script: 0x22, flags: 0x0},
+	137:  {region: 0x166, script: 0x5b, flags: 0x0},
+	138:  {region: 0x140, script: 0x5b, flags: 0x0},
+	139:  {region: 0x166, script: 0x5b, flags: 0x0},
+	140:  {region: 0x166, script: 0x5b, flags: 0x0},
+	141:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	142:  {region: 0x166, script: 0x5b, flags: 0x0},
+	143:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	144:  {region: 0x166, script: 0x5b, flags: 0x0},
+	145:  {region: 0x166, script: 0x5b, flags: 0x0},
+	146:  {region: 0x166, script: 0x5b, flags: 0x0},
+	147:  {region: 0x166, script: 0x2c, flags: 0x0},
+	148:  {region: 0x9a, script: 0x22, flags: 0x0},
+	149:  {region: 0x96, script: 0x5b, flags: 0x0},
+	150:  {region: 0x166, script: 0x5b, flags: 0x0},
+	151:  {region: 0x166, script: 0x5b, flags: 0x0},
+	152:  {region: 0x115, script: 0x5b, flags: 0x0},
+	153:  {region: 0x166, script: 0x5b, flags: 0x0},
+	154:  {region: 0x166, script: 0x5b, flags: 0x0},
+	155:  {region: 0x52, script: 0x5b, flags: 0x0},
+	156:  {region: 0x166, script: 0x5b, flags: 0x0},
+	157:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	158:  {region: 0x166, script: 0x5b, flags: 0x0},
+	159:  {region: 0x13f, script: 0xe8, flags: 0x0},
+	160:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	161:  {region: 0x166, script: 0x5b, flags: 0x0},
+	162:  {region: 0x166, script: 0x5b, flags: 0x0},
+	163:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	164:  {region: 0x166, script: 0x5b, flags: 0x0},
 	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x5a, flags: 0x0},
-	167:  {region: 0x165, script: 0x5a, flags: 0x0},
-	168:  {region: 0x165, script: 0x5a, flags: 0x0},
-	169:  {region: 0x53, script: 0xec, flags: 0x0},
-	170:  {region: 0x165, script: 0x5a, flags: 0x0},
-	171:  {region: 0x165, script: 0x5a, flags: 0x0},
-	172:  {region: 0x165, script: 0x5a, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x5a, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x5a, flags: 0x0},
-	177:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	178:  {region: 0x78, script: 0x5a, flags: 0x0},
-	179:  {region: 0x99, script: 0x22, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x22, flags: 0x0},
-	182:  {region: 0x165, script: 0x5a, flags: 0x0},
-	183:  {region: 0x33, script: 0x5a, flags: 0x0},
-	184:  {region: 0x165, script: 0x5a, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x5a, flags: 0x0},
-	187:  {region: 0x165, script: 0x2c, flags: 0x0},
-	188:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	189:  {region: 0x165, script: 0x5a, flags: 0x0},
-	190:  {region: 0xe8, script: 0x22, flags: 0x0},
-	191:  {region: 0x106, script: 0x20, flags: 0x0},
-	192:  {region: 0x15f, script: 0x5a, flags: 0x0},
-	193:  {region: 0x165, script: 0x5a, flags: 0x0},
-	194:  {region: 0x95, script: 0x5a, flags: 0x0},
-	195:  {region: 0x165, script: 0x5a, flags: 0x0},
-	196:  {region: 0x52, script: 0x5a, flags: 0x0},
-	197:  {region: 0x165, script: 0x5a, flags: 0x0},
-	198:  {region: 0x165, script: 0x5a, flags: 0x0},
-	199:  {region: 0x165, script: 0x5a, flags: 0x0},
-	200:  {region: 0x86, script: 0x5a, flags: 0x0},
-	201:  {region: 0x165, script: 0x5a, flags: 0x0},
-	202:  {region: 0x165, script: 0x5a, flags: 0x0},
-	203:  {region: 0x165, script: 0x5a, flags: 0x0},
-	204:  {region: 0x165, script: 0x5a, flags: 0x0},
-	205:  {region: 0x6d, script: 0x2c, flags: 0x0},
-	206:  {region: 0x165, script: 0x5a, flags: 0x0},
-	207:  {region: 0x165, script: 0x5a, flags: 0x0},
-	208:  {region: 0x52, script: 0x5a, flags: 0x0},
-	209:  {region: 0x165, script: 0x5a, flags: 0x0},
-	210:  {region: 0x165, script: 0x5a, flags: 0x0},
-	211:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	212:  {region: 0x165, script: 0x5a, flags: 0x0},
-	213:  {region: 0x165, script: 0x5a, flags: 0x0},
-	214:  {region: 0x165, script: 0x5a, flags: 0x0},
-	215:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	216:  {region: 0x165, script: 0x5a, flags: 0x0},
-	217:  {region: 0x165, script: 0x5a, flags: 0x0},
-	218:  {region: 0xd6, script: 0x5a, flags: 0x0},
+	166:  {region: 0x166, script: 0x5b, flags: 0x0},
+	167:  {region: 0x166, script: 0x5b, flags: 0x0},
+	168:  {region: 0x166, script: 0x5b, flags: 0x0},
+	169:  {region: 0x53, script: 0xef, flags: 0x0},
+	170:  {region: 0x166, script: 0x5b, flags: 0x0},
+	171:  {region: 0x166, script: 0x5b, flags: 0x0},
+	172:  {region: 0x166, script: 0x5b, flags: 0x0},
+	173:  {region: 0x9a, script: 0xe, flags: 0x0},
+	174:  {region: 0x166, script: 0x5b, flags: 0x0},
+	175:  {region: 0x9d, script: 0x5, flags: 0x0},
+	176:  {region: 0x166, script: 0x5b, flags: 0x0},
+	177:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	178:  {region: 0x79, script: 0x5b, flags: 0x0},
+	179:  {region: 0x9a, script: 0x22, flags: 0x0},
+	180:  {region: 0xe9, script: 0x5, flags: 0x0},
+	181:  {region: 0x9a, script: 0x22, flags: 0x0},
+	182:  {region: 0x166, script: 0x5b, flags: 0x0},
+	183:  {region: 0x33, script: 0x5b, flags: 0x0},
+	184:  {region: 0x166, script: 0x5b, flags: 0x0},
+	185:  {region: 0xb5, script: 0xc, flags: 0x0},
+	186:  {region: 0x52, script: 0x5b, flags: 0x0},
+	187:  {region: 0x166, script: 0x2c, flags: 0x0},
+	188:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	189:  {region: 0x166, script: 0x5b, flags: 0x0},
+	190:  {region: 0xe9, script: 0x22, flags: 0x0},
+	191:  {region: 0x107, script: 0x20, flags: 0x0},
+	192:  {region: 0x160, script: 0x5b, flags: 0x0},
+	193:  {region: 0x166, script: 0x5b, flags: 0x0},
+	194:  {region: 0x96, script: 0x5b, flags: 0x0},
+	195:  {region: 0x166, script: 0x5b, flags: 0x0},
+	196:  {region: 0x52, script: 0x5b, flags: 0x0},
+	197:  {region: 0x166, script: 0x5b, flags: 0x0},
+	198:  {region: 0x166, script: 0x5b, flags: 0x0},
+	199:  {region: 0x166, script: 0x5b, flags: 0x0},
+	200:  {region: 0x87, script: 0x5b, flags: 0x0},
+	201:  {region: 0x166, script: 0x5b, flags: 0x0},
+	202:  {region: 0x166, script: 0x5b, flags: 0x0},
+	203:  {region: 0x166, script: 0x5b, flags: 0x0},
+	204:  {region: 0x166, script: 0x5b, flags: 0x0},
+	205:  {region: 0x6e, script: 0x2c, flags: 0x0},
+	206:  {region: 0x166, script: 0x5b, flags: 0x0},
+	207:  {region: 0x166, script: 0x5b, flags: 0x0},
+	208:  {region: 0x52, script: 0x5b, flags: 0x0},
+	209:  {region: 0x166, script: 0x5b, flags: 0x0},
+	210:  {region: 0x166, script: 0x5b, flags: 0x0},
+	211:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	212:  {region: 0x166, script: 0x5b, flags: 0x0},
+	213:  {region: 0x166, script: 0x5b, flags: 0x0},
+	214:  {region: 0x166, script: 0x5b, flags: 0x0},
+	215:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	216:  {region: 0x166, script: 0x5b, flags: 0x0},
+	217:  {region: 0x166, script: 0x5b, flags: 0x0},
+	218:  {region: 0xd7, script: 0x5b, flags: 0x0},
 	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x20, flags: 0x0},
-	221:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	222:  {region: 0x165, script: 0x5a, flags: 0x0},
-	223:  {region: 0x131, script: 0x5a, flags: 0x0},
-	224:  {region: 0x8a, script: 0x5a, flags: 0x0},
-	225:  {region: 0x75, script: 0x5a, flags: 0x0},
-	226:  {region: 0x106, script: 0x20, flags: 0x0},
-	227:  {region: 0x135, script: 0x5a, flags: 0x0},
-	228:  {region: 0x49, script: 0x5a, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x5a, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x5a, flags: 0x0},
-	235:  {region: 0x165, script: 0x5a, flags: 0x0},
-	236:  {region: 0x165, script: 0x5a, flags: 0x0},
-	237:  {region: 0x165, script: 0x5a, flags: 0x0},
-	238:  {region: 0x165, script: 0x5a, flags: 0x0},
-	239:  {region: 0xc5, script: 0xd8, flags: 0x0},
-	240:  {region: 0x78, script: 0x5a, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1d, flags: 0x0},
-	242:  {region: 0xe7, script: 0x5a, flags: 0x0},
+	220:  {region: 0x107, script: 0x20, flags: 0x0},
+	221:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	222:  {region: 0x166, script: 0x5b, flags: 0x0},
+	223:  {region: 0x132, script: 0x5b, flags: 0x0},
+	224:  {region: 0x8b, script: 0x5b, flags: 0x0},
+	225:  {region: 0x76, script: 0x5b, flags: 0x0},
+	226:  {region: 0x107, script: 0x20, flags: 0x0},
+	227:  {region: 0x136, script: 0x5b, flags: 0x0},
+	228:  {region: 0x49, script: 0x5b, flags: 0x0},
+	229:  {region: 0x136, script: 0x1a, flags: 0x0},
+	230:  {region: 0xa7, script: 0x5, flags: 0x0},
+	231:  {region: 0x13f, script: 0x19, flags: 0x0},
+	232:  {region: 0x166, script: 0x5b, flags: 0x0},
+	233:  {region: 0x9c, script: 0x5, flags: 0x0},
+	234:  {region: 0x166, script: 0x5b, flags: 0x0},
+	235:  {region: 0x166, script: 0x5b, flags: 0x0},
+	236:  {region: 0x166, script: 0x5b, flags: 0x0},
+	237:  {region: 0x166, script: 0x5b, flags: 0x0},
+	238:  {region: 0x166, script: 0x5b, flags: 0x0},
+	239:  {region: 0xc6, script: 0xda, flags: 0x0},
+	240:  {region: 0x79, script: 0x5b, flags: 0x0},
+	241:  {region: 0x6c, script: 0x1d, flags: 0x0},
+	242:  {region: 0xe8, script: 0x5b, flags: 0x0},
 	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x20, flags: 0x0},
+	244:  {region: 0x131, script: 0x20, flags: 0x0},
 	245:  {region: 0x49, script: 0x17, flags: 0x0},
 	246:  {region: 0x49, script: 0x17, flags: 0x0},
 	247:  {region: 0x49, script: 0x17, flags: 0x0},
 	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x5a, flags: 0x0},
-	250:  {region: 0x5e, script: 0x5a, flags: 0x0},
-	251:  {region: 0xe9, script: 0x5a, flags: 0x0},
+	249:  {region: 0x10b, script: 0x5b, flags: 0x0},
+	250:  {region: 0x5f, script: 0x5b, flags: 0x0},
+	251:  {region: 0xea, script: 0x5b, flags: 0x0},
 	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x86, flags: 0x0},
+	253:  {region: 0xc5, script: 0x88, flags: 0x0},
 	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x20, flags: 0x0},
-	256:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	257:  {region: 0x63, script: 0x5a, flags: 0x0},
-	258:  {region: 0x165, script: 0x5a, flags: 0x0},
-	259:  {region: 0x165, script: 0x5a, flags: 0x0},
-	260:  {region: 0x165, script: 0x5a, flags: 0x0},
-	261:  {region: 0x165, script: 0x5a, flags: 0x0},
-	262:  {region: 0x135, script: 0x5a, flags: 0x0},
-	263:  {region: 0x106, script: 0x20, flags: 0x0},
-	264:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	265:  {region: 0x165, script: 0x5a, flags: 0x0},
-	266:  {region: 0x165, script: 0x5a, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x5a, flags: 0x0},
-	269:  {region: 0x60, script: 0x5a, flags: 0x0},
-	270:  {region: 0x165, script: 0x5a, flags: 0x0},
-	271:  {region: 0x49, script: 0x5a, flags: 0x0},
-	272:  {region: 0x165, script: 0x5a, flags: 0x0},
-	273:  {region: 0x165, script: 0x5a, flags: 0x0},
-	274:  {region: 0x165, script: 0x5a, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x5a, flags: 0x0},
-	277:  {region: 0x165, script: 0x5a, flags: 0x0},
-	278:  {region: 0x165, script: 0x5a, flags: 0x0},
-	279:  {region: 0xd4, script: 0x5a, flags: 0x0},
-	280:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	281:  {region: 0x165, script: 0x5a, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x5a, flags: 0x0},
-	284:  {region: 0x165, script: 0x5a, flags: 0x0},
-	285:  {region: 0x165, script: 0x5a, flags: 0x0},
-	286:  {region: 0x165, script: 0x2c, flags: 0x0},
-	287:  {region: 0x60, script: 0x5a, flags: 0x0},
-	288:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	289:  {region: 0xd0, script: 0x5a, flags: 0x0},
-	290:  {region: 0x165, script: 0x5a, flags: 0x0},
-	291:  {region: 0xdb, script: 0x22, flags: 0x0},
-	292:  {region: 0x52, script: 0x5a, flags: 0x0},
-	293:  {region: 0x165, script: 0x5a, flags: 0x0},
-	294:  {region: 0x165, script: 0x5a, flags: 0x0},
-	295:  {region: 0x165, script: 0x5a, flags: 0x0},
-	296:  {region: 0xcd, script: 0xea, flags: 0x0},
-	297:  {region: 0x165, script: 0x5a, flags: 0x0},
-	298:  {region: 0x165, script: 0x5a, flags: 0x0},
-	299:  {region: 0x114, script: 0x5a, flags: 0x0},
-	300:  {region: 0x37, script: 0x5a, flags: 0x0},
-	301:  {region: 0x43, script: 0xec, flags: 0x0},
-	302:  {region: 0x165, script: 0x5a, flags: 0x0},
-	303:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	304:  {region: 0x80, script: 0x5a, flags: 0x0},
-	305:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	306:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	307:  {region: 0x6b, script: 0x29, flags: 0x0},
-	308:  {region: 0x165, script: 0x5a, flags: 0x0},
-	309:  {region: 0xc4, script: 0x4b, flags: 0x0},
-	310:  {region: 0x87, script: 0x34, flags: 0x0},
-	311:  {region: 0x165, script: 0x5a, flags: 0x0},
-	312:  {region: 0x165, script: 0x5a, flags: 0x0},
+	255:  {region: 0x107, script: 0x20, flags: 0x0},
+	256:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	257:  {region: 0x64, script: 0x5b, flags: 0x0},
+	258:  {region: 0x166, script: 0x5b, flags: 0x0},
+	259:  {region: 0x166, script: 0x5b, flags: 0x0},
+	260:  {region: 0x166, script: 0x5b, flags: 0x0},
+	261:  {region: 0x166, script: 0x5b, flags: 0x0},
+	262:  {region: 0x136, script: 0x5b, flags: 0x0},
+	263:  {region: 0x107, script: 0x20, flags: 0x0},
+	264:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	265:  {region: 0x166, script: 0x5b, flags: 0x0},
+	266:  {region: 0x166, script: 0x5b, flags: 0x0},
+	267:  {region: 0x9a, script: 0x5, flags: 0x0},
+	268:  {region: 0x166, script: 0x5b, flags: 0x0},
+	269:  {region: 0x61, script: 0x5b, flags: 0x0},
+	270:  {region: 0x166, script: 0x5b, flags: 0x0},
+	271:  {region: 0x49, script: 0x5b, flags: 0x0},
+	272:  {region: 0x166, script: 0x5b, flags: 0x0},
+	273:  {region: 0x166, script: 0x5b, flags: 0x0},
+	274:  {region: 0x166, script: 0x5b, flags: 0x0},
+	275:  {region: 0x166, script: 0x5, flags: 0x0},
+	276:  {region: 0x49, script: 0x5b, flags: 0x0},
+	277:  {region: 0x166, script: 0x5b, flags: 0x0},
+	278:  {region: 0x166, script: 0x5b, flags: 0x0},
+	279:  {region: 0xd5, script: 0x5b, flags: 0x0},
+	280:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	281:  {region: 0x166, script: 0x5b, flags: 0x0},
+	282:  {region: 0x9a, script: 0x5, flags: 0x0},
+	283:  {region: 0x166, script: 0x5b, flags: 0x0},
+	284:  {region: 0x166, script: 0x5b, flags: 0x0},
+	285:  {region: 0x166, script: 0x5b, flags: 0x0},
+	286:  {region: 0x166, script: 0x2c, flags: 0x0},
+	287:  {region: 0x61, script: 0x5b, flags: 0x0},
+	288:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	289:  {region: 0xd1, script: 0x5b, flags: 0x0},
+	290:  {region: 0x166, script: 0x5b, flags: 0x0},
+	291:  {region: 0xdc, script: 0x22, flags: 0x0},
+	292:  {region: 0x52, script: 0x5b, flags: 0x0},
+	293:  {region: 0x166, script: 0x5b, flags: 0x0},
+	294:  {region: 0x166, script: 0x5b, flags: 0x0},
+	295:  {region: 0x166, script: 0x5b, flags: 0x0},
+	296:  {region: 0xce, script: 0xed, flags: 0x0},
+	297:  {region: 0x166, script: 0x5b, flags: 0x0},
+	298:  {region: 0x166, script: 0x5b, flags: 0x0},
+	299:  {region: 0x115, script: 0x5b, flags: 0x0},
+	300:  {region: 0x37, script: 0x5b, flags: 0x0},
+	301:  {region: 0x43, script: 0xef, flags: 0x0},
+	302:  {region: 0x166, script: 0x5b, flags: 0x0},
+	303:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	304:  {region: 0x81, script: 0x5b, flags: 0x0},
+	305:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	306:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	307:  {region: 0x6c, script: 0x29, flags: 0x0},
+	308:  {region: 0x166, script: 0x5b, flags: 0x0},
+	309:  {region: 0xc5, script: 0x4b, flags: 0x0},
+	310:  {region: 0x88, script: 0x34, flags: 0x0},
+	311:  {region: 0x166, script: 0x5b, flags: 0x0},
+	312:  {region: 0x166, script: 0x5b, flags: 0x0},
 	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x5a, flags: 0x0},
-	315:  {region: 0x165, script: 0x5a, flags: 0x0},
-	316:  {region: 0x1, script: 0x5a, flags: 0x0},
-	317:  {region: 0x165, script: 0x5a, flags: 0x0},
-	318:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	319:  {region: 0x135, script: 0x5a, flags: 0x0},
-	320:  {region: 0x6a, script: 0x5a, flags: 0x0},
-	321:  {region: 0x165, script: 0x5a, flags: 0x0},
-	322:  {region: 0x9e, script: 0x46, flags: 0x0},
-	323:  {region: 0x165, script: 0x5a, flags: 0x0},
-	324:  {region: 0x165, script: 0x5a, flags: 0x0},
-	325:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	326:  {region: 0x52, script: 0x5a, flags: 0x0},
-	327:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x5a, flags: 0x0},
-	330:  {region: 0x165, script: 0x5a, flags: 0x0},
-	331:  {region: 0x165, script: 0x5a, flags: 0x0},
-	332:  {region: 0x165, script: 0x5a, flags: 0x0},
-	333:  {region: 0x86, script: 0x5a, flags: 0x0},
+	314:  {region: 0x166, script: 0x5b, flags: 0x0},
+	315:  {region: 0x166, script: 0x5b, flags: 0x0},
+	316:  {region: 0x1, script: 0x5b, flags: 0x0},
+	317:  {region: 0x166, script: 0x5b, flags: 0x0},
+	318:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	319:  {region: 0x136, script: 0x5b, flags: 0x0},
+	320:  {region: 0x6b, script: 0x5b, flags: 0x0},
+	321:  {region: 0x166, script: 0x5b, flags: 0x0},
+	322:  {region: 0x9f, script: 0x46, flags: 0x0},
+	323:  {region: 0x166, script: 0x5b, flags: 0x0},
+	324:  {region: 0x166, script: 0x5b, flags: 0x0},
+	325:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	326:  {region: 0x52, script: 0x5b, flags: 0x0},
+	327:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	328:  {region: 0x9d, script: 0x5, flags: 0x0},
+	329:  {region: 0x166, script: 0x5b, flags: 0x0},
+	330:  {region: 0x166, script: 0x5b, flags: 0x0},
+	331:  {region: 0x166, script: 0x5b, flags: 0x0},
+	332:  {region: 0x166, script: 0x5b, flags: 0x0},
+	333:  {region: 0x87, script: 0x5b, flags: 0x0},
 	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x5a, flags: 0x0},
-	336:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	337:  {region: 0x72, script: 0x5a, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	340:  {region: 0x10c, script: 0x5a, flags: 0x0},
-	341:  {region: 0x73, script: 0x5a, flags: 0x0},
-	342:  {region: 0x165, script: 0x5a, flags: 0x0},
-	343:  {region: 0x165, script: 0x5a, flags: 0x0},
-	344:  {region: 0x76, script: 0x5a, flags: 0x0},
-	345:  {region: 0x165, script: 0x5a, flags: 0x0},
-	346:  {region: 0x3b, script: 0x5a, flags: 0x0},
-	347:  {region: 0x165, script: 0x5a, flags: 0x0},
-	348:  {region: 0x165, script: 0x5a, flags: 0x0},
-	349:  {region: 0x165, script: 0x5a, flags: 0x0},
-	350:  {region: 0x78, script: 0x5a, flags: 0x0},
-	351:  {region: 0x135, script: 0x5a, flags: 0x0},
-	352:  {region: 0x78, script: 0x5a, flags: 0x0},
-	353:  {region: 0x60, script: 0x5a, flags: 0x0},
-	354:  {region: 0x60, script: 0x5a, flags: 0x0},
+	335:  {region: 0x166, script: 0x5b, flags: 0x0},
+	336:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	337:  {region: 0x73, script: 0x5b, flags: 0x0},
+	338:  {region: 0x10c, script: 0x5, flags: 0x0},
+	339:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	340:  {region: 0x10d, script: 0x5b, flags: 0x0},
+	341:  {region: 0x74, script: 0x5b, flags: 0x0},
+	342:  {region: 0x166, script: 0x5b, flags: 0x0},
+	343:  {region: 0x166, script: 0x5b, flags: 0x0},
+	344:  {region: 0x77, script: 0x5b, flags: 0x0},
+	345:  {region: 0x166, script: 0x5b, flags: 0x0},
+	346:  {region: 0x3b, script: 0x5b, flags: 0x0},
+	347:  {region: 0x166, script: 0x5b, flags: 0x0},
+	348:  {region: 0x166, script: 0x5b, flags: 0x0},
+	349:  {region: 0x166, script: 0x5b, flags: 0x0},
+	350:  {region: 0x79, script: 0x5b, flags: 0x0},
+	351:  {region: 0x136, script: 0x5b, flags: 0x0},
+	352:  {region: 0x79, script: 0x5b, flags: 0x0},
+	353:  {region: 0x61, script: 0x5b, flags: 0x0},
+	354:  {region: 0x61, script: 0x5b, flags: 0x0},
 	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x5a, flags: 0x0},
-	357:  {region: 0x165, script: 0x5a, flags: 0x0},
-	358:  {region: 0x84, script: 0x5a, flags: 0x0},
-	359:  {region: 0x165, script: 0x5a, flags: 0x0},
-	360:  {region: 0xd4, script: 0x5a, flags: 0x0},
-	361:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	362:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	363:  {region: 0x165, script: 0x5a, flags: 0x0},
-	364:  {region: 0x10b, script: 0x5a, flags: 0x0},
-	365:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	366:  {region: 0x96, script: 0x5a, flags: 0x0},
-	367:  {region: 0x80, script: 0x5a, flags: 0x0},
-	368:  {region: 0x165, script: 0x5a, flags: 0x0},
-	369:  {region: 0xbc, script: 0x5a, flags: 0x0},
-	370:  {region: 0x165, script: 0x5a, flags: 0x0},
-	371:  {region: 0x165, script: 0x5a, flags: 0x0},
-	372:  {region: 0x165, script: 0x5a, flags: 0x0},
+	356:  {region: 0x141, script: 0x5b, flags: 0x0},
+	357:  {region: 0x166, script: 0x5b, flags: 0x0},
+	358:  {region: 0x85, script: 0x5b, flags: 0x0},
+	359:  {region: 0x166, script: 0x5b, flags: 0x0},
+	360:  {region: 0xd5, script: 0x5b, flags: 0x0},
+	361:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	362:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	363:  {region: 0x166, script: 0x5b, flags: 0x0},
+	364:  {region: 0x10c, script: 0x5b, flags: 0x0},
+	365:  {region: 0xda, script: 0x5b, flags: 0x0},
+	366:  {region: 0x97, script: 0x5b, flags: 0x0},
+	367:  {region: 0x81, script: 0x5b, flags: 0x0},
+	368:  {region: 0x166, script: 0x5b, flags: 0x0},
+	369:  {region: 0xbd, script: 0x5b, flags: 0x0},
+	370:  {region: 0x166, script: 0x5b, flags: 0x0},
+	371:  {region: 0x166, script: 0x5b, flags: 0x0},
+	372:  {region: 0x166, script: 0x5b, flags: 0x0},
 	373:  {region: 0x53, script: 0x3b, flags: 0x0},
-	374:  {region: 0x165, script: 0x5a, flags: 0x0},
-	375:  {region: 0x95, script: 0x5a, flags: 0x0},
-	376:  {region: 0x165, script: 0x5a, flags: 0x0},
-	377:  {region: 0x165, script: 0x5a, flags: 0x0},
-	378:  {region: 0x99, script: 0x22, flags: 0x0},
-	379:  {region: 0x165, script: 0x5a, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x5a, flags: 0x0},
-	382:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	383:  {region: 0x165, script: 0x5a, flags: 0x0},
-	384:  {region: 0x165, script: 0x5a, flags: 0x0},
-	385:  {region: 0x165, script: 0x5a, flags: 0x0},
-	386:  {region: 0x165, script: 0x5a, flags: 0x0},
-	387:  {region: 0x165, script: 0x5a, flags: 0x0},
-	388:  {region: 0x165, script: 0x5a, flags: 0x0},
-	389:  {region: 0x6f, script: 0x2c, flags: 0x0},
-	390:  {region: 0x165, script: 0x5a, flags: 0x0},
-	391:  {region: 0xdb, script: 0x22, flags: 0x0},
-	392:  {region: 0x165, script: 0x5a, flags: 0x0},
-	393:  {region: 0xa7, script: 0x5a, flags: 0x0},
-	394:  {region: 0x165, script: 0x5a, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x5a, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x5a, flags: 0x0},
-	399:  {region: 0x165, script: 0x5a, flags: 0x0},
-	400:  {region: 0x6e, script: 0x5a, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x5a, flags: 0x0},
-	403:  {region: 0x165, script: 0x2c, flags: 0x0},
-	404:  {region: 0xf1, script: 0x5a, flags: 0x0},
-	405:  {region: 0x165, script: 0x5a, flags: 0x0},
-	406:  {region: 0x165, script: 0x5a, flags: 0x0},
-	407:  {region: 0x165, script: 0x5a, flags: 0x0},
-	408:  {region: 0x165, script: 0x2c, flags: 0x0},
-	409:  {region: 0x165, script: 0x5a, flags: 0x0},
-	410:  {region: 0x99, script: 0x22, flags: 0x0},
-	411:  {region: 0x99, script: 0xe6, flags: 0x0},
-	412:  {region: 0x95, script: 0x5a, flags: 0x0},
-	413:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	414:  {region: 0x130, script: 0x32, flags: 0x0},
-	415:  {region: 0x165, script: 0x5a, flags: 0x0},
+	374:  {region: 0x166, script: 0x5b, flags: 0x0},
+	375:  {region: 0x96, script: 0x5b, flags: 0x0},
+	376:  {region: 0x166, script: 0x5b, flags: 0x0},
+	377:  {region: 0x166, script: 0x5b, flags: 0x0},
+	378:  {region: 0x9a, script: 0x22, flags: 0x0},
+	379:  {region: 0x166, script: 0x5b, flags: 0x0},
+	380:  {region: 0x9d, script: 0x5, flags: 0x0},
+	381:  {region: 0x7f, script: 0x5b, flags: 0x0},
+	382:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	383:  {region: 0x166, script: 0x5b, flags: 0x0},
+	384:  {region: 0x166, script: 0x5b, flags: 0x0},
+	385:  {region: 0x166, script: 0x5b, flags: 0x0},
+	386:  {region: 0x166, script: 0x5b, flags: 0x0},
+	387:  {region: 0x166, script: 0x5b, flags: 0x0},
+	388:  {region: 0x166, script: 0x5b, flags: 0x0},
+	389:  {region: 0x70, script: 0x2c, flags: 0x0},
+	390:  {region: 0x166, script: 0x5b, flags: 0x0},
+	391:  {region: 0xdc, script: 0x22, flags: 0x0},
+	392:  {region: 0x166, script: 0x5b, flags: 0x0},
+	393:  {region: 0xa8, script: 0x5b, flags: 0x0},
+	394:  {region: 0x166, script: 0x5b, flags: 0x0},
+	395:  {region: 0xe9, script: 0x5, flags: 0x0},
+	396:  {region: 0x166, script: 0x5b, flags: 0x0},
+	397:  {region: 0xe9, script: 0x5, flags: 0x0},
+	398:  {region: 0x166, script: 0x5b, flags: 0x0},
+	399:  {region: 0x166, script: 0x5b, flags: 0x0},
+	400:  {region: 0x6f, script: 0x5b, flags: 0x0},
+	401:  {region: 0x9d, script: 0x5, flags: 0x0},
+	402:  {region: 0x166, script: 0x5b, flags: 0x0},
+	403:  {region: 0x166, script: 0x2c, flags: 0x0},
+	404:  {region: 0xf2, script: 0x5b, flags: 0x0},
+	405:  {region: 0x166, script: 0x5b, flags: 0x0},
+	406:  {region: 0x166, script: 0x5b, flags: 0x0},
+	407:  {region: 0x166, script: 0x5b, flags: 0x0},
+	408:  {region: 0x166, script: 0x2c, flags: 0x0},
+	409:  {region: 0x166, script: 0x5b, flags: 0x0},
+	410:  {region: 0x9a, script: 0x22, flags: 0x0},
+	411:  {region: 0x9a, script: 0xe9, flags: 0x0},
+	412:  {region: 0x96, script: 0x5b, flags: 0x0},
+	413:  {region: 0xda, script: 0x5b, flags: 0x0},
+	414:  {region: 0x131, script: 0x32, flags: 0x0},
+	415:  {region: 0x166, script: 0x5b, flags: 0x0},
 	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x5a, flags: 0x0},
-	419:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	420:  {region: 0x99, script: 0x35, flags: 0x0},
-	421:  {region: 0x41, script: 0x5a, flags: 0x0},
-	422:  {region: 0x54, script: 0x5a, flags: 0x0},
-	423:  {region: 0x165, script: 0x5a, flags: 0x0},
-	424:  {region: 0x80, script: 0x5a, flags: 0x0},
-	425:  {region: 0x165, script: 0x5a, flags: 0x0},
-	426:  {region: 0x165, script: 0x5a, flags: 0x0},
-	427:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	428:  {region: 0x98, script: 0x5a, flags: 0x0},
-	429:  {region: 0x165, script: 0x5a, flags: 0x0},
-	430:  {region: 0xdb, script: 0x22, flags: 0x0},
-	431:  {region: 0x165, script: 0x5a, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x5a, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x5a, flags: 0x0},
+	417:  {region: 0x9a, script: 0xe, flags: 0x0},
+	418:  {region: 0x166, script: 0x5b, flags: 0x0},
+	419:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	420:  {region: 0x9a, script: 0x35, flags: 0x0},
+	421:  {region: 0x41, script: 0x5b, flags: 0x0},
+	422:  {region: 0x54, script: 0x5b, flags: 0x0},
+	423:  {region: 0x166, script: 0x5b, flags: 0x0},
+	424:  {region: 0x81, script: 0x5b, flags: 0x0},
+	425:  {region: 0x166, script: 0x5b, flags: 0x0},
+	426:  {region: 0x166, script: 0x5b, flags: 0x0},
+	427:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	428:  {region: 0x99, script: 0x5b, flags: 0x0},
+	429:  {region: 0x166, script: 0x5b, flags: 0x0},
+	430:  {region: 0xdc, script: 0x22, flags: 0x0},
+	431:  {region: 0x166, script: 0x5b, flags: 0x0},
+	432:  {region: 0x166, script: 0x5, flags: 0x0},
+	433:  {region: 0x49, script: 0x5b, flags: 0x0},
+	434:  {region: 0x166, script: 0x5, flags: 0x0},
+	435:  {region: 0x166, script: 0x5b, flags: 0x0},
 	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x5a, flags: 0x0},
+	437:  {region: 0x166, script: 0x5b, flags: 0x0},
 	438:  {region: 0x53, script: 0x3b, flags: 0x0},
-	439:  {region: 0x165, script: 0x5a, flags: 0x0},
-	440:  {region: 0x135, script: 0x5a, flags: 0x0},
+	439:  {region: 0x166, script: 0x5b, flags: 0x0},
+	440:  {region: 0x136, script: 0x5b, flags: 0x0},
 	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x5a, flags: 0x0},
-	443:  {region: 0x165, script: 0x2c, flags: 0x0},
-	444:  {region: 0x97, script: 0x3e, flags: 0x0},
-	445:  {region: 0x165, script: 0x5a, flags: 0x0},
-	446:  {region: 0x99, script: 0x22, flags: 0x0},
-	447:  {region: 0x165, script: 0x5a, flags: 0x0},
-	448:  {region: 0x73, script: 0x5a, flags: 0x0},
-	449:  {region: 0x165, script: 0x5a, flags: 0x0},
-	450:  {region: 0x165, script: 0x5a, flags: 0x0},
-	451:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	452:  {region: 0x165, script: 0x5a, flags: 0x0},
-	453:  {region: 0x12b, script: 0x40, flags: 0x0},
-	454:  {region: 0x53, script: 0x90, flags: 0x0},
-	455:  {region: 0x165, script: 0x5a, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x22, flags: 0x0},
-	458:  {region: 0xaf, script: 0x41, flags: 0x0},
-	459:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x5a, flags: 0x0},
-	462:  {region: 0x99, script: 0x22, flags: 0x0},
-	463:  {region: 0x99, script: 0x22, flags: 0x0},
-	464:  {region: 0x165, script: 0x5a, flags: 0x0},
-	465:  {region: 0x90, script: 0x5a, flags: 0x0},
-	466:  {region: 0x60, script: 0x5a, flags: 0x0},
+	442:  {region: 0x166, script: 0x5b, flags: 0x0},
+	443:  {region: 0x166, script: 0x2c, flags: 0x0},
+	444:  {region: 0x98, script: 0x3e, flags: 0x0},
+	445:  {region: 0x166, script: 0x5b, flags: 0x0},
+	446:  {region: 0x9a, script: 0x22, flags: 0x0},
+	447:  {region: 0x166, script: 0x5b, flags: 0x0},
+	448:  {region: 0x74, script: 0x5b, flags: 0x0},
+	449:  {region: 0x166, script: 0x5b, flags: 0x0},
+	450:  {region: 0x166, script: 0x5b, flags: 0x0},
+	451:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	452:  {region: 0x166, script: 0x5b, flags: 0x0},
+	453:  {region: 0x12c, script: 0x40, flags: 0x0},
+	454:  {region: 0x53, script: 0x92, flags: 0x0},
+	455:  {region: 0x166, script: 0x5b, flags: 0x0},
+	456:  {region: 0xe9, script: 0x5, flags: 0x0},
+	457:  {region: 0x9a, script: 0x22, flags: 0x0},
+	458:  {region: 0xb0, script: 0x41, flags: 0x0},
+	459:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	460:  {region: 0xe9, script: 0x5, flags: 0x0},
+	461:  {region: 0xe7, script: 0x5b, flags: 0x0},
+	462:  {region: 0x9a, script: 0x22, flags: 0x0},
+	463:  {region: 0x9a, script: 0x22, flags: 0x0},
+	464:  {region: 0x166, script: 0x5b, flags: 0x0},
+	465:  {region: 0x91, script: 0x5b, flags: 0x0},
+	466:  {region: 0x61, script: 0x5b, flags: 0x0},
 	467:  {region: 0x53, script: 0x3b, flags: 0x0},
-	468:  {region: 0x91, script: 0x5a, flags: 0x0},
-	469:  {region: 0x92, script: 0x5a, flags: 0x0},
-	470:  {region: 0x165, script: 0x5a, flags: 0x0},
+	468:  {region: 0x92, script: 0x5b, flags: 0x0},
+	469:  {region: 0x93, script: 0x5b, flags: 0x0},
+	470:  {region: 0x166, script: 0x5b, flags: 0x0},
 	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	473:  {region: 0x78, script: 0x5a, flags: 0x0},
-	474:  {region: 0x165, script: 0x5a, flags: 0x0},
-	475:  {region: 0x165, script: 0x5a, flags: 0x0},
-	476:  {region: 0xd0, script: 0x5a, flags: 0x0},
-	477:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	478:  {region: 0x165, script: 0x5a, flags: 0x0},
-	479:  {region: 0x165, script: 0x5a, flags: 0x0},
-	480:  {region: 0x165, script: 0x5a, flags: 0x0},
-	481:  {region: 0x95, script: 0x5a, flags: 0x0},
-	482:  {region: 0x165, script: 0x5a, flags: 0x0},
-	483:  {region: 0x165, script: 0x5a, flags: 0x0},
-	484:  {region: 0x165, script: 0x5a, flags: 0x0},
-	486:  {region: 0x122, script: 0x5a, flags: 0x0},
-	487:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	488:  {region: 0x165, script: 0x5a, flags: 0x0},
-	489:  {region: 0x165, script: 0x5a, flags: 0x0},
-	490:  {region: 0x53, script: 0xfa, flags: 0x0},
-	491:  {region: 0x165, script: 0x5a, flags: 0x0},
-	492:  {region: 0x135, script: 0x5a, flags: 0x0},
-	493:  {region: 0x165, script: 0x5a, flags: 0x0},
-	494:  {region: 0x49, script: 0x5a, flags: 0x0},
-	495:  {region: 0x165, script: 0x5a, flags: 0x0},
-	496:  {region: 0x165, script: 0x5a, flags: 0x0},
-	497:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	498:  {region: 0x165, script: 0x5a, flags: 0x0},
-	499:  {region: 0x95, script: 0x5a, flags: 0x0},
-	500:  {region: 0x106, script: 0x20, flags: 0x0},
-	501:  {region: 0x1, script: 0x5a, flags: 0x0},
-	502:  {region: 0x165, script: 0x5a, flags: 0x0},
-	503:  {region: 0x165, script: 0x5a, flags: 0x0},
-	504:  {region: 0x9d, script: 0x5a, flags: 0x0},
-	505:  {region: 0x9e, script: 0x5a, flags: 0x0},
+	472:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	473:  {region: 0x79, script: 0x5b, flags: 0x0},
+	474:  {region: 0x166, script: 0x5b, flags: 0x0},
+	475:  {region: 0x166, script: 0x5b, flags: 0x0},
+	476:  {region: 0xd1, script: 0x5b, flags: 0x0},
+	477:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	478:  {region: 0x166, script: 0x5b, flags: 0x0},
+	479:  {region: 0x166, script: 0x5b, flags: 0x0},
+	480:  {region: 0x166, script: 0x5b, flags: 0x0},
+	481:  {region: 0x96, script: 0x5b, flags: 0x0},
+	482:  {region: 0x166, script: 0x5b, flags: 0x0},
+	483:  {region: 0x166, script: 0x5b, flags: 0x0},
+	484:  {region: 0x166, script: 0x5b, flags: 0x0},
+	486:  {region: 0x123, script: 0x5b, flags: 0x0},
+	487:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	488:  {region: 0x166, script: 0x5b, flags: 0x0},
+	489:  {region: 0x166, script: 0x5b, flags: 0x0},
+	490:  {region: 0x53, script: 0xfd, flags: 0x0},
+	491:  {region: 0x166, script: 0x5b, flags: 0x0},
+	492:  {region: 0x136, script: 0x5b, flags: 0x0},
+	493:  {region: 0x166, script: 0x5b, flags: 0x0},
+	494:  {region: 0x49, script: 0x5b, flags: 0x0},
+	495:  {region: 0x166, script: 0x5b, flags: 0x0},
+	496:  {region: 0x166, script: 0x5b, flags: 0x0},
+	497:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	498:  {region: 0x166, script: 0x5b, flags: 0x0},
+	499:  {region: 0x96, script: 0x5b, flags: 0x0},
+	500:  {region: 0x107, script: 0x20, flags: 0x0},
+	501:  {region: 0x1, script: 0x5b, flags: 0x0},
+	502:  {region: 0x166, script: 0x5b, flags: 0x0},
+	503:  {region: 0x166, script: 0x5b, flags: 0x0},
+	504:  {region: 0x9e, script: 0x5b, flags: 0x0},
+	505:  {region: 0x9f, script: 0x5b, flags: 0x0},
 	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3e, flags: 0x0},
-	508:  {region: 0x165, script: 0x5a, flags: 0x0},
-	509:  {region: 0x165, script: 0x5a, flags: 0x0},
-	510:  {region: 0x106, script: 0x5a, flags: 0x0},
-	511:  {region: 0x165, script: 0x5a, flags: 0x0},
-	512:  {region: 0xa2, script: 0x49, flags: 0x0},
-	513:  {region: 0x165, script: 0x5a, flags: 0x0},
-	514:  {region: 0xa0, script: 0x5a, flags: 0x0},
-	515:  {region: 0x1, script: 0x5a, flags: 0x0},
-	516:  {region: 0x165, script: 0x5a, flags: 0x0},
-	517:  {region: 0x165, script: 0x5a, flags: 0x0},
-	518:  {region: 0x165, script: 0x5a, flags: 0x0},
-	519:  {region: 0x52, script: 0x5a, flags: 0x0},
-	520:  {region: 0x130, script: 0x3e, flags: 0x0},
-	521:  {region: 0x165, script: 0x5a, flags: 0x0},
-	522:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	523:  {region: 0xdb, script: 0x22, flags: 0x0},
-	524:  {region: 0x165, script: 0x5a, flags: 0x0},
-	525:  {region: 0x63, script: 0x5a, flags: 0x0},
-	526:  {region: 0x95, script: 0x5a, flags: 0x0},
-	527:  {region: 0x95, script: 0x5a, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2e, flags: 0x0},
-	529:  {region: 0x137, script: 0x20, flags: 0x0},
-	530:  {region: 0x67, script: 0x5a, flags: 0x0},
-	531:  {region: 0xc4, script: 0x5a, flags: 0x0},
-	532:  {region: 0x165, script: 0x5a, flags: 0x0},
-	533:  {region: 0x165, script: 0x5a, flags: 0x0},
-	534:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	535:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	536:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	537:  {region: 0x106, script: 0x20, flags: 0x0},
-	538:  {region: 0x165, script: 0x5a, flags: 0x0},
-	539:  {region: 0x165, script: 0x5a, flags: 0x0},
-	540:  {region: 0x165, script: 0x5a, flags: 0x0},
-	541:  {region: 0x165, script: 0x5a, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	544:  {region: 0x164, script: 0x5a, flags: 0x0},
-	545:  {region: 0x165, script: 0x5a, flags: 0x0},
-	546:  {region: 0x165, script: 0x5a, flags: 0x0},
-	547:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x5a, flags: 0x0},
-	550:  {region: 0x123, script: 0xeb, flags: 0x0},
-	551:  {region: 0x5a, script: 0x5a, flags: 0x0},
-	552:  {region: 0x52, script: 0x5a, flags: 0x0},
-	553:  {region: 0x165, script: 0x5a, flags: 0x0},
-	554:  {region: 0x4f, script: 0x5a, flags: 0x0},
-	555:  {region: 0x99, script: 0x22, flags: 0x0},
-	556:  {region: 0x99, script: 0x22, flags: 0x0},
-	557:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	558:  {region: 0x95, script: 0x5a, flags: 0x0},
-	559:  {region: 0x165, script: 0x5a, flags: 0x0},
-	560:  {region: 0x41, script: 0x5a, flags: 0x0},
-	561:  {region: 0x99, script: 0x5a, flags: 0x0},
-	562:  {region: 0x53, script: 0xe2, flags: 0x0},
-	563:  {region: 0x99, script: 0x22, flags: 0x0},
-	564:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	565:  {region: 0x165, script: 0x5a, flags: 0x0},
-	566:  {region: 0x99, script: 0x75, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x5a, flags: 0x0},
-	569:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	570:  {region: 0x165, script: 0x5a, flags: 0x0},
-	571:  {region: 0x12b, script: 0x5a, flags: 0x0},
-	572:  {region: 0x165, script: 0x5a, flags: 0x0},
-	573:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	574:  {region: 0x165, script: 0x5a, flags: 0x0},
-	575:  {region: 0xaf, script: 0x57, flags: 0x0},
-	576:  {region: 0x165, script: 0x5a, flags: 0x0},
-	577:  {region: 0x165, script: 0x5a, flags: 0x0},
+	507:  {region: 0x98, script: 0x3e, flags: 0x0},
+	508:  {region: 0x166, script: 0x5b, flags: 0x0},
+	509:  {region: 0x166, script: 0x5b, flags: 0x0},
+	510:  {region: 0x107, script: 0x5b, flags: 0x0},
+	511:  {region: 0x166, script: 0x5b, flags: 0x0},
+	512:  {region: 0xa3, script: 0x49, flags: 0x0},
+	513:  {region: 0x166, script: 0x5b, flags: 0x0},
+	514:  {region: 0xa1, script: 0x5b, flags: 0x0},
+	515:  {region: 0x1, script: 0x5b, flags: 0x0},
+	516:  {region: 0x166, script: 0x5b, flags: 0x0},
+	517:  {region: 0x166, script: 0x5b, flags: 0x0},
+	518:  {region: 0x166, script: 0x5b, flags: 0x0},
+	519:  {region: 0x52, script: 0x5b, flags: 0x0},
+	520:  {region: 0x131, script: 0x3e, flags: 0x0},
+	521:  {region: 0x166, script: 0x5b, flags: 0x0},
+	522:  {region: 0x130, script: 0x5b, flags: 0x0},
+	523:  {region: 0xdc, script: 0x22, flags: 0x0},
+	524:  {region: 0x166, script: 0x5b, flags: 0x0},
+	525:  {region: 0x64, script: 0x5b, flags: 0x0},
+	526:  {region: 0x96, script: 0x5b, flags: 0x0},
+	527:  {region: 0x96, script: 0x5b, flags: 0x0},
+	528:  {region: 0x7e, script: 0x2e, flags: 0x0},
+	529:  {region: 0x138, script: 0x20, flags: 0x0},
+	530:  {region: 0x68, script: 0x5b, flags: 0x0},
+	531:  {region: 0xc5, script: 0x5b, flags: 0x0},
+	532:  {region: 0x166, script: 0x5b, flags: 0x0},
+	533:  {region: 0x166, script: 0x5b, flags: 0x0},
+	534:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	535:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	536:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	537:  {region: 0x107, script: 0x20, flags: 0x0},
+	538:  {region: 0x166, script: 0x5b, flags: 0x0},
+	539:  {region: 0x166, script: 0x5b, flags: 0x0},
+	540:  {region: 0x166, script: 0x5b, flags: 0x0},
+	541:  {region: 0x166, script: 0x5b, flags: 0x0},
+	542:  {region: 0xd5, script: 0x5, flags: 0x0},
+	543:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	544:  {region: 0x165, script: 0x5b, flags: 0x0},
+	545:  {region: 0x166, script: 0x5b, flags: 0x0},
+	546:  {region: 0x166, script: 0x5b, flags: 0x0},
+	547:  {region: 0x130, script: 0x5b, flags: 0x0},
+	548:  {region: 0x123, script: 0x5, flags: 0x0},
+	549:  {region: 0x166, script: 0x5b, flags: 0x0},
+	550:  {region: 0x124, script: 0xee, flags: 0x0},
+	551:  {region: 0x5b, script: 0x5b, flags: 0x0},
+	552:  {region: 0x52, script: 0x5b, flags: 0x0},
+	553:  {region: 0x166, script: 0x5b, flags: 0x0},
+	554:  {region: 0x4f, script: 0x5b, flags: 0x0},
+	555:  {region: 0x9a, script: 0x22, flags: 0x0},
+	556:  {region: 0x9a, script: 0x22, flags: 0x0},
+	557:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	558:  {region: 0x96, script: 0x5b, flags: 0x0},
+	559:  {region: 0x166, script: 0x5b, flags: 0x0},
+	560:  {region: 0x41, script: 0x5b, flags: 0x0},
+	561:  {region: 0x9a, script: 0x5b, flags: 0x0},
+	562:  {region: 0x53, script: 0xe5, flags: 0x0},
+	563:  {region: 0x9a, script: 0x22, flags: 0x0},
+	564:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	565:  {region: 0x166, script: 0x5b, flags: 0x0},
+	566:  {region: 0x9a, script: 0x76, flags: 0x0},
+	567:  {region: 0xe9, script: 0x5, flags: 0x0},
+	568:  {region: 0x166, script: 0x5b, flags: 0x0},
+	569:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	570:  {region: 0x166, script: 0x5b, flags: 0x0},
+	571:  {region: 0x12c, script: 0x5b, flags: 0x0},
+	572:  {region: 0x166, script: 0x5b, flags: 0x0},
+	573:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	574:  {region: 0x166, script: 0x5b, flags: 0x0},
+	575:  {region: 0xb0, script: 0x58, flags: 0x0},
+	576:  {region: 0x166, script: 0x5b, flags: 0x0},
+	577:  {region: 0x166, script: 0x5b, flags: 0x0},
 	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x5a, flags: 0x0},
-	580:  {region: 0x52, script: 0x5a, flags: 0x0},
-	581:  {region: 0x82, script: 0x5a, flags: 0x0},
-	582:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	583:  {region: 0x165, script: 0x5a, flags: 0x0},
-	584:  {region: 0x165, script: 0x5a, flags: 0x0},
-	585:  {region: 0x165, script: 0x5a, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4e, flags: 0x0},
-	587:  {region: 0x2a, script: 0x5a, flags: 0x0},
-	588:  {region: 0x165, script: 0x5a, flags: 0x0},
-	589:  {region: 0x165, script: 0x5a, flags: 0x0},
-	590:  {region: 0x165, script: 0x5a, flags: 0x0},
-	591:  {region: 0x165, script: 0x5a, flags: 0x0},
-	592:  {region: 0x165, script: 0x5a, flags: 0x0},
-	593:  {region: 0x99, script: 0x52, flags: 0x0},
-	594:  {region: 0x8b, script: 0x5a, flags: 0x0},
-	595:  {region: 0x165, script: 0x5a, flags: 0x0},
-	596:  {region: 0xab, script: 0x53, flags: 0x0},
-	597:  {region: 0x106, script: 0x20, flags: 0x0},
-	598:  {region: 0x99, script: 0x22, flags: 0x0},
-	599:  {region: 0x165, script: 0x5a, flags: 0x0},
-	600:  {region: 0x75, script: 0x5a, flags: 0x0},
-	601:  {region: 0x165, script: 0x5a, flags: 0x0},
-	602:  {region: 0xb4, script: 0x5a, flags: 0x0},
-	603:  {region: 0x165, script: 0x5a, flags: 0x0},
-	604:  {region: 0x165, script: 0x5a, flags: 0x0},
-	605:  {region: 0x165, script: 0x5a, flags: 0x0},
-	606:  {region: 0x165, script: 0x5a, flags: 0x0},
-	607:  {region: 0x165, script: 0x5a, flags: 0x0},
-	608:  {region: 0x165, script: 0x5a, flags: 0x0},
-	609:  {region: 0x165, script: 0x5a, flags: 0x0},
-	610:  {region: 0x165, script: 0x2c, flags: 0x0},
-	611:  {region: 0x165, script: 0x5a, flags: 0x0},
-	612:  {region: 0x106, script: 0x20, flags: 0x0},
-	613:  {region: 0x112, script: 0x5a, flags: 0x0},
-	614:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	615:  {region: 0x106, script: 0x5a, flags: 0x0},
-	616:  {region: 0x165, script: 0x5a, flags: 0x0},
-	617:  {region: 0x99, script: 0x22, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	620:  {region: 0x165, script: 0x5a, flags: 0x0},
-	621:  {region: 0x52, script: 0x5a, flags: 0x0},
-	622:  {region: 0x60, script: 0x5a, flags: 0x0},
-	623:  {region: 0x165, script: 0x5a, flags: 0x0},
-	624:  {region: 0x165, script: 0x5a, flags: 0x0},
-	625:  {region: 0x165, script: 0x2c, flags: 0x0},
-	626:  {region: 0x165, script: 0x5a, flags: 0x0},
-	627:  {region: 0x165, script: 0x5a, flags: 0x0},
+	579:  {region: 0x166, script: 0x5b, flags: 0x0},
+	580:  {region: 0x52, script: 0x5b, flags: 0x0},
+	581:  {region: 0x83, script: 0x5b, flags: 0x0},
+	582:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	583:  {region: 0x166, script: 0x5b, flags: 0x0},
+	584:  {region: 0x166, script: 0x5b, flags: 0x0},
+	585:  {region: 0x166, script: 0x5b, flags: 0x0},
+	586:  {region: 0xa7, script: 0x4f, flags: 0x0},
+	587:  {region: 0x2a, script: 0x5b, flags: 0x0},
+	588:  {region: 0x166, script: 0x5b, flags: 0x0},
+	589:  {region: 0x166, script: 0x5b, flags: 0x0},
+	590:  {region: 0x166, script: 0x5b, flags: 0x0},
+	591:  {region: 0x166, script: 0x5b, flags: 0x0},
+	592:  {region: 0x166, script: 0x5b, flags: 0x0},
+	593:  {region: 0x9a, script: 0x53, flags: 0x0},
+	594:  {region: 0x8c, script: 0x5b, flags: 0x0},
+	595:  {region: 0x166, script: 0x5b, flags: 0x0},
+	596:  {region: 0xac, script: 0x54, flags: 0x0},
+	597:  {region: 0x107, script: 0x20, flags: 0x0},
+	598:  {region: 0x9a, script: 0x22, flags: 0x0},
+	599:  {region: 0x166, script: 0x5b, flags: 0x0},
+	600:  {region: 0x76, script: 0x5b, flags: 0x0},
+	601:  {region: 0x166, script: 0x5b, flags: 0x0},
+	602:  {region: 0xb5, script: 0x5b, flags: 0x0},
+	603:  {region: 0x166, script: 0x5b, flags: 0x0},
+	604:  {region: 0x166, script: 0x5b, flags: 0x0},
+	605:  {region: 0x166, script: 0x5b, flags: 0x0},
+	606:  {region: 0x166, script: 0x5b, flags: 0x0},
+	607:  {region: 0x166, script: 0x5b, flags: 0x0},
+	608:  {region: 0x166, script: 0x5b, flags: 0x0},
+	609:  {region: 0x166, script: 0x5b, flags: 0x0},
+	610:  {region: 0x166, script: 0x2c, flags: 0x0},
+	611:  {region: 0x166, script: 0x5b, flags: 0x0},
+	612:  {region: 0x107, script: 0x20, flags: 0x0},
+	613:  {region: 0x113, script: 0x5b, flags: 0x0},
+	614:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	615:  {region: 0x107, script: 0x5b, flags: 0x0},
+	616:  {region: 0x166, script: 0x5b, flags: 0x0},
+	617:  {region: 0x9a, script: 0x22, flags: 0x0},
+	618:  {region: 0x9a, script: 0x5, flags: 0x0},
+	619:  {region: 0x130, script: 0x5b, flags: 0x0},
+	620:  {region: 0x166, script: 0x5b, flags: 0x0},
+	621:  {region: 0x52, script: 0x5b, flags: 0x0},
+	622:  {region: 0x61, script: 0x5b, flags: 0x0},
+	623:  {region: 0x166, script: 0x5b, flags: 0x0},
+	624:  {region: 0x166, script: 0x5b, flags: 0x0},
+	625:  {region: 0x166, script: 0x2c, flags: 0x0},
+	626:  {region: 0x166, script: 0x5b, flags: 0x0},
+	627:  {region: 0x166, script: 0x5b, flags: 0x0},
 	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x5a, flags: 0x0},
-	630:  {region: 0x165, script: 0x5a, flags: 0x0},
-	631:  {region: 0x165, script: 0x5a, flags: 0x0},
-	632:  {region: 0x165, script: 0x5a, flags: 0x0},
-	633:  {region: 0x106, script: 0x20, flags: 0x0},
-	634:  {region: 0x165, script: 0x5a, flags: 0x0},
-	635:  {region: 0x165, script: 0x5a, flags: 0x0},
-	636:  {region: 0x165, script: 0x5a, flags: 0x0},
-	637:  {region: 0x106, script: 0x20, flags: 0x0},
-	638:  {region: 0x165, script: 0x5a, flags: 0x0},
-	639:  {region: 0x95, script: 0x5a, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x5a, flags: 0x0},
-	642:  {region: 0x165, script: 0x5a, flags: 0x0},
-	643:  {region: 0x165, script: 0x5a, flags: 0x0},
-	644:  {region: 0x165, script: 0x5a, flags: 0x0},
-	645:  {region: 0x165, script: 0x2c, flags: 0x0},
-	646:  {region: 0x123, script: 0xeb, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x5a, flags: 0x0},
-	649:  {region: 0x165, script: 0x5a, flags: 0x0},
+	629:  {region: 0x166, script: 0x5b, flags: 0x0},
+	630:  {region: 0x166, script: 0x5b, flags: 0x0},
+	631:  {region: 0x166, script: 0x5b, flags: 0x0},
+	632:  {region: 0x166, script: 0x5b, flags: 0x0},
+	633:  {region: 0x107, script: 0x20, flags: 0x0},
+	634:  {region: 0x166, script: 0x5b, flags: 0x0},
+	635:  {region: 0x166, script: 0x5b, flags: 0x0},
+	636:  {region: 0x166, script: 0x5b, flags: 0x0},
+	637:  {region: 0x107, script: 0x20, flags: 0x0},
+	638:  {region: 0x166, script: 0x5b, flags: 0x0},
+	639:  {region: 0x96, script: 0x5b, flags: 0x0},
+	640:  {region: 0xe9, script: 0x5, flags: 0x0},
+	641:  {region: 0x7c, script: 0x5b, flags: 0x0},
+	642:  {region: 0x166, script: 0x5b, flags: 0x0},
+	643:  {region: 0x166, script: 0x5b, flags: 0x0},
+	644:  {region: 0x166, script: 0x5b, flags: 0x0},
+	645:  {region: 0x166, script: 0x2c, flags: 0x0},
+	646:  {region: 0x124, script: 0xee, flags: 0x0},
+	647:  {region: 0xe9, script: 0x5, flags: 0x0},
+	648:  {region: 0x166, script: 0x5b, flags: 0x0},
+	649:  {region: 0x166, script: 0x5b, flags: 0x0},
 	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x5a, flags: 0x0},
-	652:  {region: 0x165, script: 0x5a, flags: 0x0},
-	653:  {region: 0x165, script: 0x5a, flags: 0x0},
-	654:  {region: 0x138, script: 0x5a, flags: 0x0},
-	655:  {region: 0x87, script: 0x5e, flags: 0x0},
-	656:  {region: 0x97, script: 0x3e, flags: 0x0},
-	657:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x5a, flags: 0x0},
-	660:  {region: 0x165, script: 0x5a, flags: 0x0},
-	661:  {region: 0xb7, script: 0x5a, flags: 0x0},
-	662:  {region: 0x106, script: 0x20, flags: 0x0},
-	663:  {region: 0x165, script: 0x5a, flags: 0x0},
-	664:  {region: 0x95, script: 0x5a, flags: 0x0},
-	665:  {region: 0x165, script: 0x5a, flags: 0x0},
-	666:  {region: 0x53, script: 0xeb, flags: 0x0},
-	667:  {region: 0x165, script: 0x5a, flags: 0x0},
-	668:  {region: 0x165, script: 0x5a, flags: 0x0},
-	669:  {region: 0x165, script: 0x5a, flags: 0x0},
-	670:  {region: 0x165, script: 0x5a, flags: 0x0},
-	671:  {region: 0x99, script: 0x5c, flags: 0x0},
-	672:  {region: 0x165, script: 0x5a, flags: 0x0},
-	673:  {region: 0x165, script: 0x5a, flags: 0x0},
-	674:  {region: 0x106, script: 0x20, flags: 0x0},
-	675:  {region: 0x131, script: 0x5a, flags: 0x0},
-	676:  {region: 0x165, script: 0x5a, flags: 0x0},
-	677:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	678:  {region: 0x165, script: 0x5a, flags: 0x0},
-	679:  {region: 0x165, script: 0x5a, flags: 0x0},
+	651:  {region: 0x166, script: 0x5b, flags: 0x0},
+	652:  {region: 0x166, script: 0x5b, flags: 0x0},
+	653:  {region: 0x166, script: 0x5b, flags: 0x0},
+	654:  {region: 0x139, script: 0x5b, flags: 0x0},
+	655:  {region: 0x88, script: 0x5f, flags: 0x0},
+	656:  {region: 0x98, script: 0x3e, flags: 0x0},
+	657:  {region: 0x130, script: 0x5b, flags: 0x0},
+	658:  {region: 0xe9, script: 0x5, flags: 0x0},
+	659:  {region: 0x132, script: 0x5b, flags: 0x0},
+	660:  {region: 0x166, script: 0x5b, flags: 0x0},
+	661:  {region: 0xb8, script: 0x5b, flags: 0x0},
+	662:  {region: 0x107, script: 0x20, flags: 0x0},
+	663:  {region: 0x166, script: 0x5b, flags: 0x0},
+	664:  {region: 0x96, script: 0x5b, flags: 0x0},
+	665:  {region: 0x166, script: 0x5b, flags: 0x0},
+	666:  {region: 0x53, script: 0xee, flags: 0x0},
+	667:  {region: 0x166, script: 0x5b, flags: 0x0},
+	668:  {region: 0x166, script: 0x5b, flags: 0x0},
+	669:  {region: 0x166, script: 0x5b, flags: 0x0},
+	670:  {region: 0x166, script: 0x5b, flags: 0x0},
+	671:  {region: 0x9a, script: 0x5d, flags: 0x0},
+	672:  {region: 0x166, script: 0x5b, flags: 0x0},
+	673:  {region: 0x166, script: 0x5b, flags: 0x0},
+	674:  {region: 0x107, script: 0x20, flags: 0x0},
+	675:  {region: 0x132, script: 0x5b, flags: 0x0},
+	676:  {region: 0x166, script: 0x5b, flags: 0x0},
+	677:  {region: 0xda, script: 0x5b, flags: 0x0},
+	678:  {region: 0x166, script: 0x5b, flags: 0x0},
+	679:  {region: 0x166, script: 0x5b, flags: 0x0},
 	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x5a, flags: 0x0},
-	682:  {region: 0x165, script: 0x5a, flags: 0x0},
-	683:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	684:  {region: 0x53, script: 0x60, flags: 0x0},
-	685:  {region: 0x95, script: 0x5a, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x5a, flags: 0x0},
-	688:  {region: 0x165, script: 0x5a, flags: 0x0},
-	689:  {region: 0x165, script: 0x5a, flags: 0x0},
-	690:  {region: 0x99, script: 0xe6, flags: 0x0},
-	691:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	692:  {region: 0x165, script: 0x5a, flags: 0x0},
-	693:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	694:  {region: 0x165, script: 0x5a, flags: 0x0},
-	695:  {region: 0x165, script: 0x5a, flags: 0x0},
-	696:  {region: 0xaf, script: 0x57, flags: 0x0},
-	697:  {region: 0x165, script: 0x5a, flags: 0x0},
-	698:  {region: 0x165, script: 0x5a, flags: 0x0},
-	699:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	700:  {region: 0x165, script: 0x5a, flags: 0x0},
-	701:  {region: 0x165, script: 0x5a, flags: 0x0},
-	702:  {region: 0x162, script: 0x5a, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x5a, flags: 0x0},
-	705:  {region: 0xb8, script: 0x5a, flags: 0x0},
-	706:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	707:  {region: 0x4b, script: 0x5a, flags: 0x0},
-	708:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	709:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x5a, flags: 0x0},
-	712:  {region: 0x123, script: 0xeb, flags: 0x0},
+	681:  {region: 0x166, script: 0x5b, flags: 0x0},
+	682:  {region: 0x166, script: 0x5b, flags: 0x0},
+	683:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	684:  {region: 0x53, script: 0x61, flags: 0x0},
+	685:  {region: 0x96, script: 0x5b, flags: 0x0},
+	686:  {region: 0x9d, script: 0x5, flags: 0x0},
+	687:  {region: 0x136, script: 0x5b, flags: 0x0},
+	688:  {region: 0x166, script: 0x5b, flags: 0x0},
+	689:  {region: 0x166, script: 0x5b, flags: 0x0},
+	690:  {region: 0x9a, script: 0xe9, flags: 0x0},
+	691:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	692:  {region: 0x166, script: 0x5b, flags: 0x0},
+	693:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	694:  {region: 0x166, script: 0x5b, flags: 0x0},
+	695:  {region: 0x166, script: 0x5b, flags: 0x0},
+	696:  {region: 0xb0, script: 0x58, flags: 0x0},
+	697:  {region: 0x166, script: 0x5b, flags: 0x0},
+	698:  {region: 0x166, script: 0x5b, flags: 0x0},
+	699:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	700:  {region: 0x166, script: 0x5b, flags: 0x0},
+	701:  {region: 0x166, script: 0x5b, flags: 0x0},
+	702:  {region: 0x163, script: 0x5b, flags: 0x0},
+	703:  {region: 0x9d, script: 0x5, flags: 0x0},
+	704:  {region: 0xb7, script: 0x5b, flags: 0x0},
+	705:  {region: 0xb9, script: 0x5b, flags: 0x0},
+	706:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	707:  {region: 0x4b, script: 0x5b, flags: 0x0},
+	708:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	709:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	710:  {region: 0x9d, script: 0x5, flags: 0x0},
+	711:  {region: 0xb9, script: 0x5b, flags: 0x0},
+	712:  {region: 0x124, script: 0xee, flags: 0x0},
 	713:  {region: 0x53, script: 0x3b, flags: 0x0},
-	714:  {region: 0x12b, script: 0x5a, flags: 0x0},
-	715:  {region: 0x95, script: 0x5a, flags: 0x0},
-	716:  {region: 0x52, script: 0x5a, flags: 0x0},
-	717:  {region: 0x99, script: 0x22, flags: 0x0},
-	718:  {region: 0x99, script: 0x22, flags: 0x0},
-	719:  {region: 0x95, script: 0x5a, flags: 0x0},
+	714:  {region: 0x12c, script: 0x5b, flags: 0x0},
+	715:  {region: 0x96, script: 0x5b, flags: 0x0},
+	716:  {region: 0x52, script: 0x5b, flags: 0x0},
+	717:  {region: 0x9a, script: 0x22, flags: 0x0},
+	718:  {region: 0x9a, script: 0x22, flags: 0x0},
+	719:  {region: 0x96, script: 0x5b, flags: 0x0},
 	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	722:  {region: 0x165, script: 0x5a, flags: 0x0},
-	723:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	724:  {region: 0x165, script: 0x5a, flags: 0x0},
-	725:  {region: 0x165, script: 0x5a, flags: 0x0},
-	726:  {region: 0x165, script: 0x5a, flags: 0x0},
-	727:  {region: 0x165, script: 0x5a, flags: 0x0},
-	728:  {region: 0x165, script: 0x5a, flags: 0x0},
-	729:  {region: 0x165, script: 0x5a, flags: 0x0},
-	730:  {region: 0x165, script: 0x5a, flags: 0x0},
-	731:  {region: 0x165, script: 0x5a, flags: 0x0},
-	732:  {region: 0x165, script: 0x5a, flags: 0x0},
-	733:  {region: 0x165, script: 0x5a, flags: 0x0},
-	734:  {region: 0x165, script: 0x5a, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x20, flags: 0x0},
-	737:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	738:  {region: 0x165, script: 0x5a, flags: 0x0},
-	739:  {region: 0x95, script: 0x5a, flags: 0x0},
-	740:  {region: 0x165, script: 0x2c, flags: 0x0},
-	741:  {region: 0x165, script: 0x5a, flags: 0x0},
-	742:  {region: 0x165, script: 0x5a, flags: 0x0},
-	743:  {region: 0x165, script: 0x5a, flags: 0x0},
-	744:  {region: 0x112, script: 0x5a, flags: 0x0},
-	745:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	746:  {region: 0x165, script: 0x5a, flags: 0x0},
-	747:  {region: 0x165, script: 0x5a, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x5a, flags: 0x0},
-	750:  {region: 0x165, script: 0x5a, flags: 0x0},
-	751:  {region: 0x165, script: 0x5a, flags: 0x0},
-	752:  {region: 0x165, script: 0x5a, flags: 0x0},
-	753:  {region: 0xbf, script: 0x5a, flags: 0x0},
-	754:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	755:  {region: 0x165, script: 0x5a, flags: 0x0},
-	756:  {region: 0x52, script: 0x5a, flags: 0x0},
-	757:  {region: 0xdb, script: 0x22, flags: 0x0},
-	758:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	759:  {region: 0xc0, script: 0x5a, flags: 0x0},
-	760:  {region: 0x165, script: 0x5a, flags: 0x0},
-	761:  {region: 0x165, script: 0x5a, flags: 0x0},
-	762:  {region: 0xe0, script: 0x5a, flags: 0x0},
-	763:  {region: 0x165, script: 0x5a, flags: 0x0},
-	764:  {region: 0x95, script: 0x5a, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3d, flags: 0x0},
-	766:  {region: 0x165, script: 0x5a, flags: 0x0},
-	767:  {region: 0xc2, script: 0x20, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x5a, flags: 0x0},
-	770:  {region: 0x165, script: 0x5a, flags: 0x0},
-	771:  {region: 0x165, script: 0x5a, flags: 0x0},
-	772:  {region: 0x99, script: 0x6e, flags: 0x0},
-	773:  {region: 0x165, script: 0x5a, flags: 0x0},
-	774:  {region: 0x165, script: 0x5a, flags: 0x0},
-	775:  {region: 0x10b, script: 0x5a, flags: 0x0},
-	776:  {region: 0x165, script: 0x5a, flags: 0x0},
-	777:  {region: 0x165, script: 0x5a, flags: 0x0},
-	778:  {region: 0x165, script: 0x5a, flags: 0x0},
+	721:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	722:  {region: 0x166, script: 0x5b, flags: 0x0},
+	723:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	724:  {region: 0x166, script: 0x5b, flags: 0x0},
+	725:  {region: 0x166, script: 0x5b, flags: 0x0},
+	726:  {region: 0x166, script: 0x5b, flags: 0x0},
+	727:  {region: 0x166, script: 0x5b, flags: 0x0},
+	728:  {region: 0x166, script: 0x5b, flags: 0x0},
+	729:  {region: 0x166, script: 0x5b, flags: 0x0},
+	730:  {region: 0x166, script: 0x5b, flags: 0x0},
+	731:  {region: 0x166, script: 0x5b, flags: 0x0},
+	732:  {region: 0x166, script: 0x5b, flags: 0x0},
+	733:  {region: 0x166, script: 0x5b, flags: 0x0},
+	734:  {region: 0x166, script: 0x5b, flags: 0x0},
+	735:  {region: 0x166, script: 0x5, flags: 0x0},
+	736:  {region: 0x107, script: 0x20, flags: 0x0},
+	737:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	738:  {region: 0x166, script: 0x5b, flags: 0x0},
+	739:  {region: 0x96, script: 0x5b, flags: 0x0},
+	740:  {region: 0x166, script: 0x2c, flags: 0x0},
+	741:  {region: 0x166, script: 0x5b, flags: 0x0},
+	742:  {region: 0x166, script: 0x5b, flags: 0x0},
+	743:  {region: 0x166, script: 0x5b, flags: 0x0},
+	744:  {region: 0x113, script: 0x5b, flags: 0x0},
+	745:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	746:  {region: 0x166, script: 0x5b, flags: 0x0},
+	747:  {region: 0x166, script: 0x5b, flags: 0x0},
+	748:  {region: 0x124, script: 0x5, flags: 0x0},
+	749:  {region: 0xcd, script: 0x5b, flags: 0x0},
+	750:  {region: 0x166, script: 0x5b, flags: 0x0},
+	751:  {region: 0x166, script: 0x5b, flags: 0x0},
+	752:  {region: 0x166, script: 0x5b, flags: 0x0},
+	753:  {region: 0xc0, script: 0x5b, flags: 0x0},
+	754:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	755:  {region: 0x166, script: 0x5b, flags: 0x0},
+	756:  {region: 0x52, script: 0x5b, flags: 0x0},
+	757:  {region: 0xdc, script: 0x22, flags: 0x0},
+	758:  {region: 0x130, script: 0x5b, flags: 0x0},
+	759:  {region: 0xc1, script: 0x5b, flags: 0x0},
+	760:  {region: 0x166, script: 0x5b, flags: 0x0},
+	761:  {region: 0x166, script: 0x5b, flags: 0x0},
+	762:  {region: 0xe1, script: 0x5b, flags: 0x0},
+	763:  {region: 0x166, script: 0x5b, flags: 0x0},
+	764:  {region: 0x96, script: 0x5b, flags: 0x0},
+	765:  {region: 0x9c, script: 0x3d, flags: 0x0},
+	766:  {region: 0x166, script: 0x5b, flags: 0x0},
+	767:  {region: 0xc3, script: 0x20, flags: 0x0},
+	768:  {region: 0x166, script: 0x5, flags: 0x0},
+	769:  {region: 0x166, script: 0x5b, flags: 0x0},
+	770:  {region: 0x166, script: 0x5b, flags: 0x0},
+	771:  {region: 0x166, script: 0x5b, flags: 0x0},
+	772:  {region: 0x9a, script: 0x6f, flags: 0x0},
+	773:  {region: 0x166, script: 0x5b, flags: 0x0},
+	774:  {region: 0x166, script: 0x5b, flags: 0x0},
+	775:  {region: 0x10c, script: 0x5b, flags: 0x0},
+	776:  {region: 0x166, script: 0x5b, flags: 0x0},
+	777:  {region: 0x166, script: 0x5b, flags: 0x0},
+	778:  {region: 0x166, script: 0x5b, flags: 0x0},
 	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x5a, flags: 0x0},
-	781:  {region: 0x165, script: 0x5a, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x75, flags: 0x0},
-	785:  {region: 0x165, script: 0x5a, flags: 0x0},
-	786:  {region: 0x49, script: 0x5a, flags: 0x0},
-	787:  {region: 0x49, script: 0x5a, flags: 0x0},
-	788:  {region: 0x37, script: 0x5a, flags: 0x0},
-	789:  {region: 0x165, script: 0x5a, flags: 0x0},
-	790:  {region: 0x165, script: 0x5a, flags: 0x0},
-	791:  {region: 0x165, script: 0x5a, flags: 0x0},
-	792:  {region: 0x165, script: 0x5a, flags: 0x0},
-	793:  {region: 0x165, script: 0x5a, flags: 0x0},
-	794:  {region: 0x165, script: 0x5a, flags: 0x0},
-	795:  {region: 0x99, script: 0x22, flags: 0x0},
-	796:  {region: 0xdb, script: 0x22, flags: 0x0},
-	797:  {region: 0x106, script: 0x20, flags: 0x0},
-	798:  {region: 0x35, script: 0x72, flags: 0x0},
+	780:  {region: 0x166, script: 0x5b, flags: 0x0},
+	781:  {region: 0x166, script: 0x5b, flags: 0x0},
+	782:  {region: 0x9a, script: 0xe, flags: 0x0},
+	783:  {region: 0xc5, script: 0x76, flags: 0x0},
+	785:  {region: 0x166, script: 0x5b, flags: 0x0},
+	786:  {region: 0x49, script: 0x5b, flags: 0x0},
+	787:  {region: 0x49, script: 0x5b, flags: 0x0},
+	788:  {region: 0x37, script: 0x5b, flags: 0x0},
+	789:  {region: 0x166, script: 0x5b, flags: 0x0},
+	790:  {region: 0x166, script: 0x5b, flags: 0x0},
+	791:  {region: 0x166, script: 0x5b, flags: 0x0},
+	792:  {region: 0x166, script: 0x5b, flags: 0x0},
+	793:  {region: 0x166, script: 0x5b, flags: 0x0},
+	794:  {region: 0x166, script: 0x5b, flags: 0x0},
+	795:  {region: 0x9a, script: 0x22, flags: 0x0},
+	796:  {region: 0xdc, script: 0x22, flags: 0x0},
+	797:  {region: 0x107, script: 0x20, flags: 0x0},
+	798:  {region: 0x35, script: 0x73, flags: 0x0},
 	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x5a, flags: 0x0},
-	801:  {region: 0x165, script: 0x5a, flags: 0x0},
-	802:  {region: 0x165, script: 0x5a, flags: 0x0},
-	803:  {region: 0x165, script: 0x5a, flags: 0x0},
-	804:  {region: 0x99, script: 0x22, flags: 0x0},
-	805:  {region: 0x52, script: 0x5a, flags: 0x0},
-	807:  {region: 0x165, script: 0x5a, flags: 0x0},
-	808:  {region: 0x135, script: 0x5a, flags: 0x0},
-	809:  {region: 0x165, script: 0x5a, flags: 0x0},
-	810:  {region: 0x165, script: 0x5a, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x5a, flags: 0x0},
-	813:  {region: 0x99, script: 0x22, flags: 0x0},
-	814:  {region: 0x95, script: 0x5a, flags: 0x0},
-	815:  {region: 0x164, script: 0x5a, flags: 0x0},
-	816:  {region: 0x165, script: 0x5a, flags: 0x0},
-	817:  {region: 0xc4, script: 0x75, flags: 0x0},
-	818:  {region: 0x165, script: 0x5a, flags: 0x0},
-	819:  {region: 0x165, script: 0x2c, flags: 0x0},
-	820:  {region: 0x106, script: 0x20, flags: 0x0},
-	821:  {region: 0x165, script: 0x5a, flags: 0x0},
-	822:  {region: 0x131, script: 0x5a, flags: 0x0},
-	823:  {region: 0x9c, script: 0x66, flags: 0x0},
-	824:  {region: 0x165, script: 0x5a, flags: 0x0},
-	825:  {region: 0x165, script: 0x5a, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x5a, flags: 0x0},
-	828:  {region: 0x165, script: 0x5a, flags: 0x0},
-	829:  {region: 0x165, script: 0x5a, flags: 0x0},
-	830:  {region: 0xdd, script: 0x5a, flags: 0x0},
-	831:  {region: 0x165, script: 0x5a, flags: 0x0},
-	832:  {region: 0x165, script: 0x5a, flags: 0x0},
-	834:  {region: 0x165, script: 0x5a, flags: 0x0},
+	800:  {region: 0xcc, script: 0x5b, flags: 0x0},
+	801:  {region: 0x166, script: 0x5b, flags: 0x0},
+	802:  {region: 0x166, script: 0x5b, flags: 0x0},
+	803:  {region: 0x166, script: 0x5b, flags: 0x0},
+	804:  {region: 0x9a, script: 0x22, flags: 0x0},
+	805:  {region: 0x52, script: 0x5b, flags: 0x0},
+	807:  {region: 0x166, script: 0x5b, flags: 0x0},
+	808:  {region: 0x136, script: 0x5b, flags: 0x0},
+	809:  {region: 0x166, script: 0x5b, flags: 0x0},
+	810:  {region: 0x166, script: 0x5b, flags: 0x0},
+	811:  {region: 0xe9, script: 0x5, flags: 0x0},
+	812:  {region: 0xc4, script: 0x5b, flags: 0x0},
+	813:  {region: 0x9a, script: 0x22, flags: 0x0},
+	814:  {region: 0x96, script: 0x5b, flags: 0x0},
+	815:  {region: 0x165, script: 0x5b, flags: 0x0},
+	816:  {region: 0x166, script: 0x5b, flags: 0x0},
+	817:  {region: 0xc5, script: 0x76, flags: 0x0},
+	818:  {region: 0x166, script: 0x5b, flags: 0x0},
+	819:  {region: 0x166, script: 0x2c, flags: 0x0},
+	820:  {region: 0x107, script: 0x20, flags: 0x0},
+	821:  {region: 0x166, script: 0x5b, flags: 0x0},
+	822:  {region: 0x132, script: 0x5b, flags: 0x0},
+	823:  {region: 0x9d, script: 0x67, flags: 0x0},
+	824:  {region: 0x166, script: 0x5b, flags: 0x0},
+	825:  {region: 0x166, script: 0x5b, flags: 0x0},
+	826:  {region: 0x9d, script: 0x5, flags: 0x0},
+	827:  {region: 0x166, script: 0x5b, flags: 0x0},
+	828:  {region: 0x166, script: 0x5b, flags: 0x0},
+	829:  {region: 0x166, script: 0x5b, flags: 0x0},
+	830:  {region: 0xde, script: 0x5b, flags: 0x0},
+	831:  {region: 0x166, script: 0x5b, flags: 0x0},
+	832:  {region: 0x166, script: 0x5b, flags: 0x0},
+	834:  {region: 0x166, script: 0x5b, flags: 0x0},
 	835:  {region: 0x53, script: 0x3b, flags: 0x0},
-	836:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	837:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	838:  {region: 0x165, script: 0x5a, flags: 0x0},
-	839:  {region: 0xda, script: 0x5a, flags: 0x0},
-	840:  {region: 0x165, script: 0x5a, flags: 0x0},
-	841:  {region: 0x165, script: 0x5a, flags: 0x0},
-	842:  {region: 0x165, script: 0x5a, flags: 0x0},
-	843:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	844:  {region: 0x165, script: 0x5a, flags: 0x0},
-	845:  {region: 0x165, script: 0x5a, flags: 0x0},
-	846:  {region: 0x164, script: 0x5a, flags: 0x0},
-	847:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	848:  {region: 0x60, script: 0x5a, flags: 0x0},
-	849:  {region: 0xdb, script: 0x22, flags: 0x0},
-	850:  {region: 0x165, script: 0x5a, flags: 0x0},
-	851:  {region: 0xdb, script: 0x22, flags: 0x0},
-	852:  {region: 0x165, script: 0x5a, flags: 0x0},
-	853:  {region: 0x165, script: 0x5a, flags: 0x0},
-	854:  {region: 0xd2, script: 0x5a, flags: 0x0},
-	855:  {region: 0x165, script: 0x5a, flags: 0x0},
-	856:  {region: 0x165, script: 0x5a, flags: 0x0},
-	857:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	858:  {region: 0x165, script: 0x5a, flags: 0x0},
-	859:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	860:  {region: 0xcf, script: 0x5a, flags: 0x0},
-	861:  {region: 0x165, script: 0x5a, flags: 0x0},
-	862:  {region: 0x165, script: 0x5a, flags: 0x0},
-	863:  {region: 0x95, script: 0x5a, flags: 0x0},
-	864:  {region: 0x165, script: 0x5a, flags: 0x0},
-	865:  {region: 0xdf, script: 0x5a, flags: 0x0},
-	866:  {region: 0x165, script: 0x5a, flags: 0x0},
-	867:  {region: 0x165, script: 0x5a, flags: 0x0},
-	868:  {region: 0x99, script: 0x5a, flags: 0x0},
-	869:  {region: 0x165, script: 0x5a, flags: 0x0},
-	870:  {region: 0x165, script: 0x5a, flags: 0x0},
-	871:  {region: 0xd9, script: 0x5a, flags: 0x0},
-	872:  {region: 0x52, script: 0x5a, flags: 0x0},
-	873:  {region: 0x165, script: 0x5a, flags: 0x0},
-	874:  {region: 0xda, script: 0x5a, flags: 0x0},
-	875:  {region: 0x165, script: 0x5a, flags: 0x0},
-	876:  {region: 0x52, script: 0x5a, flags: 0x0},
-	877:  {region: 0x165, script: 0x5a, flags: 0x0},
-	878:  {region: 0x165, script: 0x5a, flags: 0x0},
-	879:  {region: 0xda, script: 0x5a, flags: 0x0},
-	880:  {region: 0x123, script: 0x56, flags: 0x0},
-	881:  {region: 0x99, script: 0x22, flags: 0x0},
-	882:  {region: 0x10c, script: 0xc9, flags: 0x0},
-	883:  {region: 0x165, script: 0x5a, flags: 0x0},
-	884:  {region: 0x165, script: 0x5a, flags: 0x0},
-	885:  {region: 0x84, script: 0x7c, flags: 0x0},
-	886:  {region: 0x161, script: 0x5a, flags: 0x0},
-	887:  {region: 0x165, script: 0x5a, flags: 0x0},
+	836:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	837:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	838:  {region: 0x166, script: 0x5b, flags: 0x0},
+	839:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	840:  {region: 0x166, script: 0x5b, flags: 0x0},
+	841:  {region: 0x166, script: 0x5b, flags: 0x0},
+	842:  {region: 0x166, script: 0x5b, flags: 0x0},
+	843:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	844:  {region: 0x166, script: 0x5b, flags: 0x0},
+	845:  {region: 0x166, script: 0x5b, flags: 0x0},
+	846:  {region: 0x165, script: 0x5b, flags: 0x0},
+	847:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	848:  {region: 0x61, script: 0x5b, flags: 0x0},
+	849:  {region: 0xdc, script: 0x22, flags: 0x0},
+	850:  {region: 0x166, script: 0x5b, flags: 0x0},
+	851:  {region: 0xdc, script: 0x22, flags: 0x0},
+	852:  {region: 0x166, script: 0x5b, flags: 0x0},
+	853:  {region: 0x166, script: 0x5b, flags: 0x0},
+	854:  {region: 0xd3, script: 0x5b, flags: 0x0},
+	855:  {region: 0x166, script: 0x5b, flags: 0x0},
+	856:  {region: 0x166, script: 0x5b, flags: 0x0},
+	857:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	858:  {region: 0x166, script: 0x5b, flags: 0x0},
+	859:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	860:  {region: 0xd0, script: 0x5b, flags: 0x0},
+	861:  {region: 0x166, script: 0x5b, flags: 0x0},
+	862:  {region: 0x166, script: 0x5b, flags: 0x0},
+	863:  {region: 0x96, script: 0x5b, flags: 0x0},
+	864:  {region: 0x166, script: 0x5b, flags: 0x0},
+	865:  {region: 0xe0, script: 0x5b, flags: 0x0},
+	866:  {region: 0x166, script: 0x5b, flags: 0x0},
+	867:  {region: 0x166, script: 0x5b, flags: 0x0},
+	868:  {region: 0x9a, script: 0x5b, flags: 0x0},
+	869:  {region: 0x166, script: 0x5b, flags: 0x0},
+	870:  {region: 0x166, script: 0x5b, flags: 0x0},
+	871:  {region: 0xda, script: 0x5b, flags: 0x0},
+	872:  {region: 0x52, script: 0x5b, flags: 0x0},
+	873:  {region: 0x166, script: 0x5b, flags: 0x0},
+	874:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	875:  {region: 0x166, script: 0x5b, flags: 0x0},
+	876:  {region: 0x52, script: 0x5b, flags: 0x0},
+	877:  {region: 0x166, script: 0x5b, flags: 0x0},
+	878:  {region: 0x166, script: 0x5b, flags: 0x0},
+	879:  {region: 0xdb, script: 0x5b, flags: 0x0},
+	880:  {region: 0x124, script: 0x57, flags: 0x0},
+	881:  {region: 0x9a, script: 0x22, flags: 0x0},
+	882:  {region: 0x10d, script: 0xcb, flags: 0x0},
+	883:  {region: 0x166, script: 0x5b, flags: 0x0},
+	884:  {region: 0x166, script: 0x5b, flags: 0x0},
+	885:  {region: 0x85, script: 0x7e, flags: 0x0},
+	886:  {region: 0x162, script: 0x5b, flags: 0x0},
+	887:  {region: 0x166, script: 0x5b, flags: 0x0},
 	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x5a, flags: 0x0},
-	890:  {region: 0x161, script: 0x5a, flags: 0x0},
-	891:  {region: 0x165, script: 0x5a, flags: 0x0},
-	892:  {region: 0x165, script: 0x5a, flags: 0x0},
-	893:  {region: 0x165, script: 0x5a, flags: 0x0},
-	894:  {region: 0x165, script: 0x5a, flags: 0x0},
-	895:  {region: 0x165, script: 0x5a, flags: 0x0},
-	896:  {region: 0x117, script: 0x5a, flags: 0x0},
-	897:  {region: 0x165, script: 0x5a, flags: 0x0},
-	898:  {region: 0x165, script: 0x5a, flags: 0x0},
-	899:  {region: 0x135, script: 0x5a, flags: 0x0},
-	900:  {region: 0x165, script: 0x5a, flags: 0x0},
-	901:  {region: 0x53, script: 0x5a, flags: 0x0},
-	902:  {region: 0x165, script: 0x5a, flags: 0x0},
-	903:  {region: 0xce, script: 0x5a, flags: 0x0},
-	904:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	905:  {region: 0x131, script: 0x5a, flags: 0x0},
-	906:  {region: 0x80, script: 0x5a, flags: 0x0},
-	907:  {region: 0x78, script: 0x5a, flags: 0x0},
-	908:  {region: 0x165, script: 0x5a, flags: 0x0},
-	910:  {region: 0x165, script: 0x5a, flags: 0x0},
-	911:  {region: 0x165, script: 0x5a, flags: 0x0},
-	912:  {region: 0x6f, script: 0x5a, flags: 0x0},
-	913:  {region: 0x165, script: 0x5a, flags: 0x0},
-	914:  {region: 0x165, script: 0x5a, flags: 0x0},
-	915:  {region: 0x165, script: 0x5a, flags: 0x0},
-	916:  {region: 0x165, script: 0x5a, flags: 0x0},
-	917:  {region: 0x99, script: 0x81, flags: 0x0},
-	918:  {region: 0x165, script: 0x5a, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x20, flags: 0x0},
-	921:  {region: 0x135, script: 0x82, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x80, flags: 0x0},
-	924:  {region: 0x165, script: 0x5a, flags: 0x0},
+	889:  {region: 0x166, script: 0x5b, flags: 0x0},
+	890:  {region: 0x162, script: 0x5b, flags: 0x0},
+	891:  {region: 0x166, script: 0x5b, flags: 0x0},
+	892:  {region: 0x166, script: 0x5b, flags: 0x0},
+	893:  {region: 0x166, script: 0x5b, flags: 0x0},
+	894:  {region: 0x166, script: 0x5b, flags: 0x0},
+	895:  {region: 0x166, script: 0x5b, flags: 0x0},
+	896:  {region: 0x118, script: 0x5b, flags: 0x0},
+	897:  {region: 0x166, script: 0x5b, flags: 0x0},
+	898:  {region: 0x166, script: 0x5b, flags: 0x0},
+	899:  {region: 0x136, script: 0x5b, flags: 0x0},
+	900:  {region: 0x166, script: 0x5b, flags: 0x0},
+	901:  {region: 0x53, script: 0x5b, flags: 0x0},
+	902:  {region: 0x166, script: 0x5b, flags: 0x0},
+	903:  {region: 0xcf, script: 0x5b, flags: 0x0},
+	904:  {region: 0x130, script: 0x5b, flags: 0x0},
+	905:  {region: 0x132, script: 0x5b, flags: 0x0},
+	906:  {region: 0x81, script: 0x5b, flags: 0x0},
+	907:  {region: 0x79, script: 0x5b, flags: 0x0},
+	908:  {region: 0x166, script: 0x5b, flags: 0x0},
+	910:  {region: 0x166, script: 0x5b, flags: 0x0},
+	911:  {region: 0x166, script: 0x5b, flags: 0x0},
+	912:  {region: 0x70, script: 0x5b, flags: 0x0},
+	913:  {region: 0x166, script: 0x5b, flags: 0x0},
+	914:  {region: 0x166, script: 0x5b, flags: 0x0},
+	915:  {region: 0x166, script: 0x5b, flags: 0x0},
+	916:  {region: 0x166, script: 0x5b, flags: 0x0},
+	917:  {region: 0x9a, script: 0x83, flags: 0x0},
+	918:  {region: 0x166, script: 0x5b, flags: 0x0},
+	919:  {region: 0x166, script: 0x5, flags: 0x0},
+	920:  {region: 0x7e, script: 0x20, flags: 0x0},
+	921:  {region: 0x136, script: 0x84, flags: 0x0},
+	922:  {region: 0x166, script: 0x5, flags: 0x0},
+	923:  {region: 0xc6, script: 0x82, flags: 0x0},
+	924:  {region: 0x166, script: 0x5b, flags: 0x0},
 	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x5a, flags: 0x0},
+	926:  {region: 0xe8, script: 0x5b, flags: 0x0},
 	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x5a, flags: 0x0},
-	929:  {region: 0x30, script: 0x5a, flags: 0x0},
-	930:  {region: 0xf0, script: 0x5a, flags: 0x0},
-	931:  {region: 0x165, script: 0x5a, flags: 0x0},
-	932:  {region: 0x78, script: 0x5a, flags: 0x0},
-	933:  {region: 0xd6, script: 0x5a, flags: 0x0},
-	934:  {region: 0x135, script: 0x5a, flags: 0x0},
-	935:  {region: 0x49, script: 0x5a, flags: 0x0},
-	936:  {region: 0x165, script: 0x5a, flags: 0x0},
-	937:  {region: 0x9c, script: 0xf7, flags: 0x0},
-	938:  {region: 0x165, script: 0x5a, flags: 0x0},
-	939:  {region: 0x60, script: 0x5a, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x8e, flags: 0x0},
-	943:  {region: 0x165, script: 0x5a, flags: 0x0},
-	944:  {region: 0x165, script: 0x5a, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x5a, flags: 0x0},
-	947:  {region: 0xe9, script: 0x5a, flags: 0x0},
-	948:  {region: 0x165, script: 0x5a, flags: 0x0},
-	949:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	950:  {region: 0x165, script: 0x5a, flags: 0x0},
-	951:  {region: 0x165, script: 0x5a, flags: 0x0},
-	952:  {region: 0x87, script: 0x34, flags: 0x0},
-	953:  {region: 0x75, script: 0x5a, flags: 0x0},
-	954:  {region: 0x165, script: 0x5a, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4d, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x5a, flags: 0x0},
+	928:  {region: 0xe8, script: 0x5b, flags: 0x0},
+	929:  {region: 0x30, script: 0x5b, flags: 0x0},
+	930:  {region: 0xf1, script: 0x5b, flags: 0x0},
+	931:  {region: 0x166, script: 0x5b, flags: 0x0},
+	932:  {region: 0x79, script: 0x5b, flags: 0x0},
+	933:  {region: 0xd7, script: 0x5b, flags: 0x0},
+	934:  {region: 0x136, script: 0x5b, flags: 0x0},
+	935:  {region: 0x49, script: 0x5b, flags: 0x0},
+	936:  {region: 0x166, script: 0x5b, flags: 0x0},
+	937:  {region: 0x9d, script: 0xfa, flags: 0x0},
+	938:  {region: 0x166, script: 0x5b, flags: 0x0},
+	939:  {region: 0x61, script: 0x5b, flags: 0x0},
+	940:  {region: 0x166, script: 0x5, flags: 0x0},
+	941:  {region: 0xb1, script: 0x90, flags: 0x0},
+	943:  {region: 0x166, script: 0x5b, flags: 0x0},
+	944:  {region: 0x166, script: 0x5b, flags: 0x0},
+	945:  {region: 0x9a, script: 0x12, flags: 0x0},
+	946:  {region: 0xa5, script: 0x5b, flags: 0x0},
+	947:  {region: 0xea, script: 0x5b, flags: 0x0},
+	948:  {region: 0x166, script: 0x5b, flags: 0x0},
+	949:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	950:  {region: 0x166, script: 0x5b, flags: 0x0},
+	951:  {region: 0x166, script: 0x5b, flags: 0x0},
+	952:  {region: 0x88, script: 0x34, flags: 0x0},
+	953:  {region: 0x76, script: 0x5b, flags: 0x0},
+	954:  {region: 0x166, script: 0x5b, flags: 0x0},
+	955:  {region: 0xe9, script: 0x4e, flags: 0x0},
+	956:  {region: 0x9d, script: 0x5, flags: 0x0},
+	957:  {region: 0x1, script: 0x5b, flags: 0x0},
 	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x5a, flags: 0x0},
-	960:  {region: 0x41, script: 0x5a, flags: 0x0},
-	961:  {region: 0x165, script: 0x5a, flags: 0x0},
-	962:  {region: 0x7a, script: 0x5a, flags: 0x0},
-	963:  {region: 0x165, script: 0x5a, flags: 0x0},
-	964:  {region: 0xe4, script: 0x5a, flags: 0x0},
-	965:  {region: 0x89, script: 0x5a, flags: 0x0},
-	966:  {region: 0x69, script: 0x5a, flags: 0x0},
-	967:  {region: 0x165, script: 0x5a, flags: 0x0},
-	968:  {region: 0x99, script: 0x22, flags: 0x0},
-	969:  {region: 0x165, script: 0x5a, flags: 0x0},
-	970:  {region: 0x102, script: 0x5a, flags: 0x0},
-	971:  {region: 0x95, script: 0x5a, flags: 0x0},
-	972:  {region: 0x165, script: 0x5a, flags: 0x0},
-	973:  {region: 0x165, script: 0x5a, flags: 0x0},
-	974:  {region: 0x9e, script: 0x5a, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x5a, flags: 0x0},
+	959:  {region: 0x166, script: 0x5b, flags: 0x0},
+	960:  {region: 0x41, script: 0x5b, flags: 0x0},
+	961:  {region: 0x166, script: 0x5b, flags: 0x0},
+	962:  {region: 0x7b, script: 0x5b, flags: 0x0},
+	963:  {region: 0x166, script: 0x5b, flags: 0x0},
+	964:  {region: 0xe5, script: 0x5b, flags: 0x0},
+	965:  {region: 0x8a, script: 0x5b, flags: 0x0},
+	966:  {region: 0x6a, script: 0x5b, flags: 0x0},
+	967:  {region: 0x166, script: 0x5b, flags: 0x0},
+	968:  {region: 0x9a, script: 0x22, flags: 0x0},
+	969:  {region: 0x166, script: 0x5b, flags: 0x0},
+	970:  {region: 0x103, script: 0x5b, flags: 0x0},
+	971:  {region: 0x96, script: 0x5b, flags: 0x0},
+	972:  {region: 0x166, script: 0x5b, flags: 0x0},
+	973:  {region: 0x166, script: 0x5b, flags: 0x0},
+	974:  {region: 0x9f, script: 0x5b, flags: 0x0},
+	975:  {region: 0x166, script: 0x5, flags: 0x0},
+	976:  {region: 0x9a, script: 0x5b, flags: 0x0},
 	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x22, flags: 0x0},
+	978:  {region: 0xdc, script: 0x22, flags: 0x0},
 	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	981:  {region: 0x72, script: 0x5a, flags: 0x0},
-	982:  {region: 0x4e, script: 0x5a, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x5a, flags: 0x0},
-	985:  {region: 0x3a, script: 0x5a, flags: 0x0},
-	986:  {region: 0x165, script: 0x5a, flags: 0x0},
-	987:  {region: 0xd1, script: 0x5a, flags: 0x0},
-	988:  {region: 0x104, script: 0x5a, flags: 0x0},
-	989:  {region: 0x95, script: 0x5a, flags: 0x0},
-	990:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	991:  {region: 0x165, script: 0x5a, flags: 0x0},
-	992:  {region: 0x165, script: 0x5a, flags: 0x0},
-	993:  {region: 0x73, script: 0x5a, flags: 0x0},
-	994:  {region: 0x106, script: 0x20, flags: 0x0},
-	995:  {region: 0x130, script: 0x20, flags: 0x0},
-	996:  {region: 0x109, script: 0x5a, flags: 0x0},
-	997:  {region: 0x107, script: 0x5a, flags: 0x0},
-	998:  {region: 0x12f, script: 0x5a, flags: 0x0},
-	999:  {region: 0x165, script: 0x5a, flags: 0x0},
-	1000: {region: 0xa2, script: 0x4c, flags: 0x0},
-	1001: {region: 0x99, script: 0x22, flags: 0x0},
-	1002: {region: 0x80, script: 0x5a, flags: 0x0},
-	1003: {region: 0x106, script: 0x20, flags: 0x0},
-	1004: {region: 0xa4, script: 0x5a, flags: 0x0},
-	1005: {region: 0x95, script: 0x5a, flags: 0x0},
-	1006: {region: 0x99, script: 0x5a, flags: 0x0},
-	1007: {region: 0x114, script: 0x5a, flags: 0x0},
-	1008: {region: 0x99, script: 0xcd, flags: 0x0},
-	1009: {region: 0x165, script: 0x5a, flags: 0x0},
-	1010: {region: 0x165, script: 0x5a, flags: 0x0},
-	1011: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1012: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1013: {region: 0x99, script: 0x22, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1016: {region: 0x7b, script: 0x5a, flags: 0x0},
-	1017: {region: 0x49, script: 0x5a, flags: 0x0},
+	980:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	981:  {region: 0x73, script: 0x5b, flags: 0x0},
+	982:  {region: 0x4e, script: 0x5b, flags: 0x0},
+	983:  {region: 0x9d, script: 0x5, flags: 0x0},
+	984:  {region: 0x10d, script: 0x5b, flags: 0x0},
+	985:  {region: 0x3a, script: 0x5b, flags: 0x0},
+	986:  {region: 0x166, script: 0x5b, flags: 0x0},
+	987:  {region: 0xd2, script: 0x5b, flags: 0x0},
+	988:  {region: 0x105, script: 0x5b, flags: 0x0},
+	989:  {region: 0x96, script: 0x5b, flags: 0x0},
+	990:  {region: 0x130, script: 0x5b, flags: 0x0},
+	991:  {region: 0x166, script: 0x5b, flags: 0x0},
+	992:  {region: 0x166, script: 0x5b, flags: 0x0},
+	993:  {region: 0x74, script: 0x5b, flags: 0x0},
+	994:  {region: 0x107, script: 0x20, flags: 0x0},
+	995:  {region: 0x131, script: 0x20, flags: 0x0},
+	996:  {region: 0x10a, script: 0x5b, flags: 0x0},
+	997:  {region: 0x108, script: 0x5b, flags: 0x0},
+	998:  {region: 0x130, script: 0x5b, flags: 0x0},
+	999:  {region: 0x166, script: 0x5b, flags: 0x0},
+	1000: {region: 0xa3, script: 0x4c, flags: 0x0},
+	1001: {region: 0x9a, script: 0x22, flags: 0x0},
+	1002: {region: 0x81, script: 0x5b, flags: 0x0},
+	1003: {region: 0x107, script: 0x20, flags: 0x0},
+	1004: {region: 0xa5, script: 0x5b, flags: 0x0},
+	1005: {region: 0x96, script: 0x5b, flags: 0x0},
+	1006: {region: 0x9a, script: 0x5b, flags: 0x0},
+	1007: {region: 0x115, script: 0x5b, flags: 0x0},
+	1008: {region: 0x9a, script: 0xcf, flags: 0x0},
+	1009: {region: 0x166, script: 0x5b, flags: 0x0},
+	1010: {region: 0x166, script: 0x5b, flags: 0x0},
+	1011: {region: 0x130, script: 0x5b, flags: 0x0},
+	1012: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1013: {region: 0x9a, script: 0x22, flags: 0x0},
+	1014: {region: 0x166, script: 0x5, flags: 0x0},
+	1015: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1016: {region: 0x7c, script: 0x5b, flags: 0x0},
+	1017: {region: 0x49, script: 0x5b, flags: 0x0},
 	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x5a, flags: 0x0},
-	1022: {region: 0x4f, script: 0x5a, flags: 0x0},
-	1023: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1024: {region: 0xcf, script: 0x5a, flags: 0x0},
-	1025: {region: 0xc3, script: 0x5a, flags: 0x0},
-	1026: {region: 0x4c, script: 0x5a, flags: 0x0},
-	1027: {region: 0x96, script: 0x7e, flags: 0x0},
-	1028: {region: 0xb6, script: 0x5a, flags: 0x0},
-	1029: {region: 0x165, script: 0x2c, flags: 0x0},
-	1030: {region: 0x165, script: 0x5a, flags: 0x0},
-	1032: {region: 0xba, script: 0xe8, flags: 0x0},
-	1033: {region: 0x165, script: 0x5a, flags: 0x0},
-	1034: {region: 0xc4, script: 0x75, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xd4, flags: 0x0},
-	1037: {region: 0x6f, script: 0x5a, flags: 0x0},
-	1038: {region: 0x165, script: 0x5a, flags: 0x0},
-	1039: {region: 0x165, script: 0x5a, flags: 0x0},
-	1040: {region: 0x165, script: 0x5a, flags: 0x0},
-	1041: {region: 0x165, script: 0x5a, flags: 0x0},
-	1042: {region: 0x111, script: 0x5a, flags: 0x0},
-	1043: {region: 0x165, script: 0x5a, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x5a, flags: 0x0},
-	1046: {region: 0x10f, script: 0x5a, flags: 0x0},
-	1047: {region: 0x165, script: 0x5a, flags: 0x0},
-	1048: {region: 0xe9, script: 0x5a, flags: 0x0},
-	1049: {region: 0x165, script: 0x5a, flags: 0x0},
-	1050: {region: 0x95, script: 0x5a, flags: 0x0},
-	1051: {region: 0x142, script: 0x5a, flags: 0x0},
-	1052: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1054: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1055: {region: 0x72, script: 0x5a, flags: 0x0},
-	1056: {region: 0x97, script: 0xca, flags: 0x0},
-	1057: {region: 0x165, script: 0x5a, flags: 0x0},
-	1058: {region: 0x72, script: 0x5a, flags: 0x0},
-	1059: {region: 0x164, script: 0x5a, flags: 0x0},
-	1060: {region: 0x165, script: 0x5a, flags: 0x0},
-	1061: {region: 0xc3, script: 0x5a, flags: 0x0},
-	1062: {region: 0x165, script: 0x5a, flags: 0x0},
-	1063: {region: 0x165, script: 0x5a, flags: 0x0},
-	1064: {region: 0x165, script: 0x5a, flags: 0x0},
-	1065: {region: 0x115, script: 0x5a, flags: 0x0},
-	1066: {region: 0x165, script: 0x5a, flags: 0x0},
-	1067: {region: 0x165, script: 0x5a, flags: 0x0},
-	1068: {region: 0x123, script: 0xeb, flags: 0x0},
-	1069: {region: 0x165, script: 0x5a, flags: 0x0},
-	1070: {region: 0x165, script: 0x5a, flags: 0x0},
-	1071: {region: 0x165, script: 0x5a, flags: 0x0},
-	1072: {region: 0x165, script: 0x5a, flags: 0x0},
-	1073: {region: 0x27, script: 0x5a, flags: 0x0},
+	1019: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1020: {region: 0x9d, script: 0x5, flags: 0x0},
+	1021: {region: 0xdb, script: 0x5b, flags: 0x0},
+	1022: {region: 0x4f, script: 0x5b, flags: 0x0},
+	1023: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1024: {region: 0xd0, script: 0x5b, flags: 0x0},
+	1025: {region: 0xc4, script: 0x5b, flags: 0x0},
+	1026: {region: 0x4c, script: 0x5b, flags: 0x0},
+	1027: {region: 0x97, script: 0x80, flags: 0x0},
+	1028: {region: 0xb7, script: 0x5b, flags: 0x0},
+	1029: {region: 0x166, script: 0x2c, flags: 0x0},
+	1030: {region: 0x166, script: 0x5b, flags: 0x0},
+	1032: {region: 0xbb, script: 0xeb, flags: 0x0},
+	1033: {region: 0x166, script: 0x5b, flags: 0x0},
+	1034: {region: 0xc5, script: 0x76, flags: 0x0},
+	1035: {region: 0x166, script: 0x5, flags: 0x0},
+	1036: {region: 0xb4, script: 0xd6, flags: 0x0},
+	1037: {region: 0x70, script: 0x5b, flags: 0x0},
+	1038: {region: 0x166, script: 0x5b, flags: 0x0},
+	1039: {region: 0x166, script: 0x5b, flags: 0x0},
+	1040: {region: 0x166, script: 0x5b, flags: 0x0},
+	1041: {region: 0x166, script: 0x5b, flags: 0x0},
+	1042: {region: 0x112, script: 0x5b, flags: 0x0},
+	1043: {region: 0x166, script: 0x5b, flags: 0x0},
+	1044: {region: 0xe9, script: 0x5, flags: 0x0},
+	1045: {region: 0x166, script: 0x5b, flags: 0x0},
+	1046: {region: 0x110, script: 0x5b, flags: 0x0},
+	1047: {region: 0x166, script: 0x5b, flags: 0x0},
+	1048: {region: 0xea, script: 0x5b, flags: 0x0},
+	1049: {region: 0x166, script: 0x5b, flags: 0x0},
+	1050: {region: 0x96, script: 0x5b, flags: 0x0},
+	1051: {region: 0x143, script: 0x5b, flags: 0x0},
+	1052: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1054: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1055: {region: 0x73, script: 0x5b, flags: 0x0},
+	1056: {region: 0x98, script: 0xcc, flags: 0x0},
+	1057: {region: 0x166, script: 0x5b, flags: 0x0},
+	1058: {region: 0x73, script: 0x5b, flags: 0x0},
+	1059: {region: 0x165, script: 0x5b, flags: 0x0},
+	1060: {region: 0x166, script: 0x5b, flags: 0x0},
+	1061: {region: 0xc4, script: 0x5b, flags: 0x0},
+	1062: {region: 0x166, script: 0x5b, flags: 0x0},
+	1063: {region: 0x166, script: 0x5b, flags: 0x0},
+	1064: {region: 0x166, script: 0x5b, flags: 0x0},
+	1065: {region: 0x116, script: 0x5b, flags: 0x0},
+	1066: {region: 0x166, script: 0x5b, flags: 0x0},
+	1067: {region: 0x166, script: 0x5b, flags: 0x0},
+	1068: {region: 0x124, script: 0xee, flags: 0x0},
+	1069: {region: 0x166, script: 0x5b, flags: 0x0},
+	1070: {region: 0x166, script: 0x5b, flags: 0x0},
+	1071: {region: 0x166, script: 0x5b, flags: 0x0},
+	1072: {region: 0x166, script: 0x5b, flags: 0x0},
+	1073: {region: 0x27, script: 0x5b, flags: 0x0},
 	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xd7, flags: 0x0},
-	1076: {region: 0x116, script: 0x5a, flags: 0x0},
-	1077: {region: 0x114, script: 0x5a, flags: 0x0},
-	1078: {region: 0x99, script: 0x22, flags: 0x0},
-	1079: {region: 0x161, script: 0x5a, flags: 0x0},
-	1080: {region: 0x165, script: 0x5a, flags: 0x0},
-	1081: {region: 0x165, script: 0x5a, flags: 0x0},
-	1082: {region: 0x6d, script: 0x5a, flags: 0x0},
-	1083: {region: 0x161, script: 0x5a, flags: 0x0},
-	1084: {region: 0x165, script: 0x5a, flags: 0x0},
-	1085: {region: 0x60, script: 0x5a, flags: 0x0},
-	1086: {region: 0x95, script: 0x5a, flags: 0x0},
-	1087: {region: 0x165, script: 0x5a, flags: 0x0},
-	1088: {region: 0x165, script: 0x5a, flags: 0x0},
-	1089: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1090: {region: 0x165, script: 0x5a, flags: 0x0},
-	1091: {region: 0x84, script: 0x5a, flags: 0x0},
-	1092: {region: 0x10c, script: 0x5a, flags: 0x0},
-	1093: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x5a, flags: 0x0},
-	1096: {region: 0x60, script: 0x5a, flags: 0x0},
-	1097: {region: 0x165, script: 0x5a, flags: 0x0},
-	1098: {region: 0x99, script: 0x22, flags: 0x0},
-	1099: {region: 0x95, script: 0x5a, flags: 0x0},
-	1100: {region: 0x165, script: 0x5a, flags: 0x0},
+	1075: {region: 0x9a, script: 0xd9, flags: 0x0},
+	1076: {region: 0x117, script: 0x5b, flags: 0x0},
+	1077: {region: 0x115, script: 0x5b, flags: 0x0},
+	1078: {region: 0x9a, script: 0x22, flags: 0x0},
+	1079: {region: 0x162, script: 0x5b, flags: 0x0},
+	1080: {region: 0x166, script: 0x5b, flags: 0x0},
+	1081: {region: 0x166, script: 0x5b, flags: 0x0},
+	1082: {region: 0x6e, script: 0x5b, flags: 0x0},
+	1083: {region: 0x162, script: 0x5b, flags: 0x0},
+	1084: {region: 0x166, script: 0x5b, flags: 0x0},
+	1085: {region: 0x61, script: 0x5b, flags: 0x0},
+	1086: {region: 0x96, script: 0x5b, flags: 0x0},
+	1087: {region: 0x166, script: 0x5b, flags: 0x0},
+	1088: {region: 0x166, script: 0x5b, flags: 0x0},
+	1089: {region: 0x130, script: 0x5b, flags: 0x0},
+	1090: {region: 0x166, script: 0x5b, flags: 0x0},
+	1091: {region: 0x85, script: 0x5b, flags: 0x0},
+	1092: {region: 0x10d, script: 0x5b, flags: 0x0},
+	1093: {region: 0x130, script: 0x5b, flags: 0x0},
+	1094: {region: 0x160, script: 0x5, flags: 0x0},
+	1095: {region: 0x4b, script: 0x5b, flags: 0x0},
+	1096: {region: 0x61, script: 0x5b, flags: 0x0},
+	1097: {region: 0x166, script: 0x5b, flags: 0x0},
+	1098: {region: 0x9a, script: 0x22, flags: 0x0},
+	1099: {region: 0x96, script: 0x5b, flags: 0x0},
+	1100: {region: 0x166, script: 0x5b, flags: 0x0},
 	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xdb, flags: 0x0},
-	1103: {region: 0xe9, script: 0x5a, flags: 0x0},
-	1104: {region: 0x99, script: 0xe3, flags: 0x0},
-	1105: {region: 0xdb, script: 0x22, flags: 0x0},
-	1106: {region: 0x165, script: 0x5a, flags: 0x0},
-	1107: {region: 0x165, script: 0x5a, flags: 0x0},
-	1108: {region: 0x165, script: 0x5a, flags: 0x0},
-	1109: {region: 0x165, script: 0x5a, flags: 0x0},
-	1110: {region: 0x165, script: 0x5a, flags: 0x0},
-	1111: {region: 0x165, script: 0x5a, flags: 0x0},
-	1112: {region: 0x165, script: 0x5a, flags: 0x0},
-	1113: {region: 0x165, script: 0x5a, flags: 0x0},
-	1114: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1115: {region: 0x165, script: 0x5a, flags: 0x0},
-	1116: {region: 0x165, script: 0x5a, flags: 0x0},
-	1117: {region: 0x99, script: 0x52, flags: 0x0},
-	1118: {region: 0x53, script: 0xe1, flags: 0x0},
-	1119: {region: 0xdb, script: 0x22, flags: 0x0},
-	1120: {region: 0xdb, script: 0x22, flags: 0x0},
-	1121: {region: 0x99, script: 0xe6, flags: 0x0},
-	1122: {region: 0x165, script: 0x5a, flags: 0x0},
-	1123: {region: 0x112, script: 0x5a, flags: 0x0},
-	1124: {region: 0x131, script: 0x5a, flags: 0x0},
-	1125: {region: 0x126, script: 0x5a, flags: 0x0},
-	1126: {region: 0x165, script: 0x5a, flags: 0x0},
+	1102: {region: 0x9c, script: 0xde, flags: 0x0},
+	1103: {region: 0xea, script: 0x5b, flags: 0x0},
+	1104: {region: 0x9a, script: 0xe6, flags: 0x0},
+	1105: {region: 0xdc, script: 0x22, flags: 0x0},
+	1106: {region: 0x166, script: 0x5b, flags: 0x0},
+	1107: {region: 0x166, script: 0x5b, flags: 0x0},
+	1108: {region: 0x166, script: 0x5b, flags: 0x0},
+	1109: {region: 0x166, script: 0x5b, flags: 0x0},
+	1110: {region: 0x166, script: 0x5b, flags: 0x0},
+	1111: {region: 0x166, script: 0x5b, flags: 0x0},
+	1112: {region: 0x166, script: 0x5b, flags: 0x0},
+	1113: {region: 0x166, script: 0x5b, flags: 0x0},
+	1114: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1115: {region: 0x166, script: 0x5b, flags: 0x0},
+	1116: {region: 0x166, script: 0x5b, flags: 0x0},
+	1117: {region: 0x9a, script: 0x53, flags: 0x0},
+	1118: {region: 0x53, script: 0xe4, flags: 0x0},
+	1119: {region: 0xdc, script: 0x22, flags: 0x0},
+	1120: {region: 0xdc, script: 0x22, flags: 0x0},
+	1121: {region: 0x9a, script: 0xe9, flags: 0x0},
+	1122: {region: 0x166, script: 0x5b, flags: 0x0},
+	1123: {region: 0x113, script: 0x5b, flags: 0x0},
+	1124: {region: 0x132, script: 0x5b, flags: 0x0},
+	1125: {region: 0x127, script: 0x5b, flags: 0x0},
+	1126: {region: 0x166, script: 0x5b, flags: 0x0},
 	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x5a, flags: 0x0},
-	1129: {region: 0x165, script: 0x5a, flags: 0x0},
-	1130: {region: 0x165, script: 0x5a, flags: 0x0},
-	1131: {region: 0x123, script: 0xeb, flags: 0x0},
-	1132: {region: 0xdb, script: 0x22, flags: 0x0},
-	1133: {region: 0xdb, script: 0x22, flags: 0x0},
-	1134: {region: 0xdb, script: 0x22, flags: 0x0},
-	1135: {region: 0x6f, script: 0x2c, flags: 0x0},
-	1136: {region: 0x165, script: 0x5a, flags: 0x0},
-	1137: {region: 0x6d, script: 0x2c, flags: 0x0},
-	1138: {region: 0x165, script: 0x5a, flags: 0x0},
-	1139: {region: 0x165, script: 0x5a, flags: 0x0},
-	1140: {region: 0x165, script: 0x5a, flags: 0x0},
-	1141: {region: 0xd6, script: 0x5a, flags: 0x0},
-	1142: {region: 0x127, script: 0x5a, flags: 0x0},
-	1143: {region: 0x125, script: 0x5a, flags: 0x0},
-	1144: {region: 0x32, script: 0x5a, flags: 0x0},
-	1145: {region: 0xdb, script: 0x22, flags: 0x0},
-	1146: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1147: {region: 0x165, script: 0x5a, flags: 0x0},
-	1148: {region: 0x165, script: 0x5a, flags: 0x0},
-	1149: {region: 0x32, script: 0x5a, flags: 0x0},
-	1150: {region: 0xd4, script: 0x5a, flags: 0x0},
-	1151: {region: 0x165, script: 0x5a, flags: 0x0},
-	1152: {region: 0x161, script: 0x5a, flags: 0x0},
-	1153: {region: 0x165, script: 0x5a, flags: 0x0},
-	1154: {region: 0x129, script: 0x5a, flags: 0x0},
-	1155: {region: 0x165, script: 0x5a, flags: 0x0},
-	1156: {region: 0xce, script: 0x5a, flags: 0x0},
-	1157: {region: 0x165, script: 0x5a, flags: 0x0},
-	1158: {region: 0xe6, script: 0x5a, flags: 0x0},
-	1159: {region: 0x165, script: 0x5a, flags: 0x0},
-	1160: {region: 0x165, script: 0x5a, flags: 0x0},
-	1161: {region: 0x165, script: 0x5a, flags: 0x0},
-	1162: {region: 0x12b, script: 0x5a, flags: 0x0},
-	1163: {region: 0x12b, script: 0x5a, flags: 0x0},
-	1164: {region: 0x12e, script: 0x5a, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x5a, flags: 0x0},
-	1167: {region: 0x87, script: 0x34, flags: 0x0},
-	1168: {region: 0xdb, script: 0x22, flags: 0x0},
-	1169: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1170: {region: 0x43, script: 0xec, flags: 0x0},
-	1171: {region: 0x165, script: 0x5a, flags: 0x0},
-	1172: {region: 0x106, script: 0x20, flags: 0x0},
-	1173: {region: 0x165, script: 0x5a, flags: 0x0},
-	1174: {region: 0x165, script: 0x5a, flags: 0x0},
-	1175: {region: 0x131, script: 0x5a, flags: 0x0},
-	1176: {region: 0x165, script: 0x5a, flags: 0x0},
-	1177: {region: 0x123, script: 0xeb, flags: 0x0},
-	1178: {region: 0x32, script: 0x5a, flags: 0x0},
-	1179: {region: 0x165, script: 0x5a, flags: 0x0},
-	1180: {region: 0x165, script: 0x5a, flags: 0x0},
-	1181: {region: 0xce, script: 0x5a, flags: 0x0},
-	1182: {region: 0x165, script: 0x5a, flags: 0x0},
-	1183: {region: 0x165, script: 0x5a, flags: 0x0},
-	1184: {region: 0x12d, script: 0x5a, flags: 0x0},
-	1185: {region: 0x165, script: 0x5a, flags: 0x0},
-	1187: {region: 0x165, script: 0x5a, flags: 0x0},
-	1188: {region: 0xd4, script: 0x5a, flags: 0x0},
-	1189: {region: 0x53, script: 0xe4, flags: 0x0},
-	1190: {region: 0xe5, script: 0x5a, flags: 0x0},
-	1191: {region: 0x165, script: 0x5a, flags: 0x0},
-	1192: {region: 0x106, script: 0x20, flags: 0x0},
-	1193: {region: 0xba, script: 0x5a, flags: 0x0},
-	1194: {region: 0x165, script: 0x5a, flags: 0x0},
-	1195: {region: 0x106, script: 0x20, flags: 0x0},
+	1128: {region: 0x166, script: 0x5b, flags: 0x0},
+	1129: {region: 0x166, script: 0x5b, flags: 0x0},
+	1130: {region: 0x166, script: 0x5b, flags: 0x0},
+	1131: {region: 0x124, script: 0xee, flags: 0x0},
+	1132: {region: 0xdc, script: 0x22, flags: 0x0},
+	1133: {region: 0xdc, script: 0x22, flags: 0x0},
+	1134: {region: 0xdc, script: 0x22, flags: 0x0},
+	1135: {region: 0x70, script: 0x2c, flags: 0x0},
+	1136: {region: 0x166, script: 0x5b, flags: 0x0},
+	1137: {region: 0x6e, script: 0x2c, flags: 0x0},
+	1138: {region: 0x166, script: 0x5b, flags: 0x0},
+	1139: {region: 0x166, script: 0x5b, flags: 0x0},
+	1140: {region: 0x166, script: 0x5b, flags: 0x0},
+	1141: {region: 0xd7, script: 0x5b, flags: 0x0},
+	1142: {region: 0x128, script: 0x5b, flags: 0x0},
+	1143: {region: 0x126, script: 0x5b, flags: 0x0},
+	1144: {region: 0x32, script: 0x5b, flags: 0x0},
+	1145: {region: 0xdc, script: 0x22, flags: 0x0},
+	1146: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1147: {region: 0x166, script: 0x5b, flags: 0x0},
+	1148: {region: 0x166, script: 0x5b, flags: 0x0},
+	1149: {region: 0x32, script: 0x5b, flags: 0x0},
+	1150: {region: 0xd5, script: 0x5b, flags: 0x0},
+	1151: {region: 0x166, script: 0x5b, flags: 0x0},
+	1152: {region: 0x162, script: 0x5b, flags: 0x0},
+	1153: {region: 0x166, script: 0x5b, flags: 0x0},
+	1154: {region: 0x12a, script: 0x5b, flags: 0x0},
+	1155: {region: 0x166, script: 0x5b, flags: 0x0},
+	1156: {region: 0xcf, script: 0x5b, flags: 0x0},
+	1157: {region: 0x166, script: 0x5b, flags: 0x0},
+	1158: {region: 0xe7, script: 0x5b, flags: 0x0},
+	1159: {region: 0x166, script: 0x5b, flags: 0x0},
+	1160: {region: 0x166, script: 0x5b, flags: 0x0},
+	1161: {region: 0x166, script: 0x5b, flags: 0x0},
+	1162: {region: 0x12c, script: 0x5b, flags: 0x0},
+	1163: {region: 0x12c, script: 0x5b, flags: 0x0},
+	1164: {region: 0x12f, script: 0x5b, flags: 0x0},
+	1165: {region: 0x166, script: 0x5, flags: 0x0},
+	1166: {region: 0x162, script: 0x5b, flags: 0x0},
+	1167: {region: 0x88, script: 0x34, flags: 0x0},
+	1168: {region: 0xdc, script: 0x22, flags: 0x0},
+	1169: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1170: {region: 0x43, script: 0xef, flags: 0x0},
+	1171: {region: 0x166, script: 0x5b, flags: 0x0},
+	1172: {region: 0x107, script: 0x20, flags: 0x0},
+	1173: {region: 0x166, script: 0x5b, flags: 0x0},
+	1174: {region: 0x166, script: 0x5b, flags: 0x0},
+	1175: {region: 0x132, script: 0x5b, flags: 0x0},
+	1176: {region: 0x166, script: 0x5b, flags: 0x0},
+	1177: {region: 0x124, script: 0xee, flags: 0x0},
+	1178: {region: 0x32, script: 0x5b, flags: 0x0},
+	1179: {region: 0x166, script: 0x5b, flags: 0x0},
+	1180: {region: 0x166, script: 0x5b, flags: 0x0},
+	1181: {region: 0xcf, script: 0x5b, flags: 0x0},
+	1182: {region: 0x166, script: 0x5b, flags: 0x0},
+	1183: {region: 0x166, script: 0x5b, flags: 0x0},
+	1184: {region: 0x12e, script: 0x5b, flags: 0x0},
+	1185: {region: 0x166, script: 0x5b, flags: 0x0},
+	1187: {region: 0x166, script: 0x5b, flags: 0x0},
+	1188: {region: 0xd5, script: 0x5b, flags: 0x0},
+	1189: {region: 0x53, script: 0xe7, flags: 0x0},
+	1190: {region: 0xe6, script: 0x5b, flags: 0x0},
+	1191: {region: 0x166, script: 0x5b, flags: 0x0},
+	1192: {region: 0x107, script: 0x20, flags: 0x0},
+	1193: {region: 0xbb, script: 0x5b, flags: 0x0},
+	1194: {region: 0x166, script: 0x5b, flags: 0x0},
+	1195: {region: 0x107, script: 0x20, flags: 0x0},
 	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xf0, flags: 0x0},
-	1198: {region: 0x130, script: 0x20, flags: 0x0},
-	1199: {region: 0x75, script: 0x5a, flags: 0x0},
-	1200: {region: 0x2a, script: 0x5a, flags: 0x0},
+	1197: {region: 0x11d, script: 0xf3, flags: 0x0},
+	1198: {region: 0x131, script: 0x20, flags: 0x0},
+	1199: {region: 0x76, script: 0x5b, flags: 0x0},
+	1200: {region: 0x2a, script: 0x5b, flags: 0x0},
 	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x5a, flags: 0x0},
-	1206: {region: 0x165, script: 0x5a, flags: 0x0},
-	1207: {region: 0x165, script: 0x5a, flags: 0x0},
-	1208: {region: 0x165, script: 0x5a, flags: 0x0},
-	1209: {region: 0x165, script: 0x5a, flags: 0x0},
-	1210: {region: 0x165, script: 0x5a, flags: 0x0},
-	1211: {region: 0x165, script: 0x5a, flags: 0x0},
+	1203: {region: 0x9a, script: 0xe, flags: 0x0},
+	1204: {region: 0xe9, script: 0x5, flags: 0x0},
+	1205: {region: 0x166, script: 0x5b, flags: 0x0},
+	1206: {region: 0x166, script: 0x5b, flags: 0x0},
+	1207: {region: 0x166, script: 0x5b, flags: 0x0},
+	1208: {region: 0x166, script: 0x5b, flags: 0x0},
+	1209: {region: 0x166, script: 0x5b, flags: 0x0},
+	1210: {region: 0x166, script: 0x5b, flags: 0x0},
+	1211: {region: 0x166, script: 0x5b, flags: 0x0},
 	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x5a, flags: 0x0},
-	1214: {region: 0xb4, script: 0xf1, flags: 0x0},
-	1215: {region: 0x165, script: 0x5a, flags: 0x0},
-	1216: {region: 0x161, script: 0x5a, flags: 0x0},
-	1217: {region: 0x9e, script: 0x5a, flags: 0x0},
-	1218: {region: 0x106, script: 0x5a, flags: 0x0},
-	1219: {region: 0x13e, script: 0x5a, flags: 0x0},
-	1220: {region: 0x11b, script: 0x5a, flags: 0x0},
-	1221: {region: 0x165, script: 0x5a, flags: 0x0},
-	1222: {region: 0x36, script: 0x5a, flags: 0x0},
-	1223: {region: 0x60, script: 0x5a, flags: 0x0},
-	1224: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1225: {region: 0x1, script: 0x5a, flags: 0x0},
-	1226: {region: 0x106, script: 0x5a, flags: 0x0},
-	1227: {region: 0x6a, script: 0x5a, flags: 0x0},
-	1228: {region: 0x12f, script: 0x5a, flags: 0x0},
-	1229: {region: 0x165, script: 0x5a, flags: 0x0},
-	1230: {region: 0x36, script: 0x5a, flags: 0x0},
-	1231: {region: 0x4e, script: 0x5a, flags: 0x0},
-	1232: {region: 0x165, script: 0x5a, flags: 0x0},
-	1233: {region: 0x6f, script: 0x2c, flags: 0x0},
-	1234: {region: 0x165, script: 0x5a, flags: 0x0},
-	1235: {region: 0xe7, script: 0x5a, flags: 0x0},
-	1236: {region: 0x2f, script: 0x5a, flags: 0x0},
-	1237: {region: 0x99, script: 0xe6, flags: 0x0},
-	1238: {region: 0x99, script: 0x22, flags: 0x0},
-	1239: {region: 0x165, script: 0x5a, flags: 0x0},
-	1240: {region: 0x165, script: 0x5a, flags: 0x0},
-	1241: {region: 0x165, script: 0x5a, flags: 0x0},
-	1242: {region: 0x165, script: 0x5a, flags: 0x0},
-	1243: {region: 0x165, script: 0x5a, flags: 0x0},
-	1244: {region: 0x165, script: 0x5a, flags: 0x0},
-	1245: {region: 0x165, script: 0x5a, flags: 0x0},
-	1246: {region: 0x165, script: 0x5a, flags: 0x0},
-	1247: {region: 0x165, script: 0x5a, flags: 0x0},
-	1248: {region: 0x140, script: 0x5a, flags: 0x0},
-	1249: {region: 0x165, script: 0x5a, flags: 0x0},
-	1250: {region: 0x165, script: 0x5a, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x5a, flags: 0x0},
-	1253: {region: 0x114, script: 0x5a, flags: 0x0},
-	1254: {region: 0x165, script: 0x5a, flags: 0x0},
-	1255: {region: 0x165, script: 0x5a, flags: 0x0},
-	1256: {region: 0x165, script: 0x5a, flags: 0x0},
-	1257: {region: 0x165, script: 0x5a, flags: 0x0},
-	1258: {region: 0x99, script: 0x22, flags: 0x0},
+	1213: {region: 0x166, script: 0x5b, flags: 0x0},
+	1214: {region: 0xb5, script: 0xf4, flags: 0x0},
+	1215: {region: 0x166, script: 0x5b, flags: 0x0},
+	1216: {region: 0x162, script: 0x5b, flags: 0x0},
+	1217: {region: 0x9f, script: 0x5b, flags: 0x0},
+	1218: {region: 0x107, script: 0x5b, flags: 0x0},
+	1219: {region: 0x13f, script: 0x5b, flags: 0x0},
+	1220: {region: 0x11c, script: 0x5b, flags: 0x0},
+	1221: {region: 0x166, script: 0x5b, flags: 0x0},
+	1222: {region: 0x36, script: 0x5b, flags: 0x0},
+	1223: {region: 0x61, script: 0x5b, flags: 0x0},
+	1224: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1225: {region: 0x1, script: 0x5b, flags: 0x0},
+	1226: {region: 0x107, script: 0x5b, flags: 0x0},
+	1227: {region: 0x6b, script: 0x5b, flags: 0x0},
+	1228: {region: 0x130, script: 0x5b, flags: 0x0},
+	1229: {region: 0x166, script: 0x5b, flags: 0x0},
+	1230: {region: 0x36, script: 0x5b, flags: 0x0},
+	1231: {region: 0x4e, script: 0x5b, flags: 0x0},
+	1232: {region: 0x166, script: 0x5b, flags: 0x0},
+	1233: {region: 0x70, script: 0x2c, flags: 0x0},
+	1234: {region: 0x166, script: 0x5b, flags: 0x0},
+	1235: {region: 0xe8, script: 0x5b, flags: 0x0},
+	1236: {region: 0x2f, script: 0x5b, flags: 0x0},
+	1237: {region: 0x9a, script: 0xe9, flags: 0x0},
+	1238: {region: 0x9a, script: 0x22, flags: 0x0},
+	1239: {region: 0x166, script: 0x5b, flags: 0x0},
+	1240: {region: 0x166, script: 0x5b, flags: 0x0},
+	1241: {region: 0x166, script: 0x5b, flags: 0x0},
+	1242: {region: 0x166, script: 0x5b, flags: 0x0},
+	1243: {region: 0x166, script: 0x5b, flags: 0x0},
+	1244: {region: 0x166, script: 0x5b, flags: 0x0},
+	1245: {region: 0x166, script: 0x5b, flags: 0x0},
+	1246: {region: 0x166, script: 0x5b, flags: 0x0},
+	1247: {region: 0x166, script: 0x5b, flags: 0x0},
+	1248: {region: 0x141, script: 0x5b, flags: 0x0},
+	1249: {region: 0x166, script: 0x5b, flags: 0x0},
+	1250: {region: 0x166, script: 0x5b, flags: 0x0},
+	1251: {region: 0xa9, script: 0x5, flags: 0x0},
+	1252: {region: 0x166, script: 0x5b, flags: 0x0},
+	1253: {region: 0x115, script: 0x5b, flags: 0x0},
+	1254: {region: 0x166, script: 0x5b, flags: 0x0},
+	1255: {region: 0x166, script: 0x5b, flags: 0x0},
+	1256: {region: 0x166, script: 0x5b, flags: 0x0},
+	1257: {region: 0x166, script: 0x5b, flags: 0x0},
+	1258: {region: 0x9a, script: 0x22, flags: 0x0},
 	1259: {region: 0x53, script: 0x3b, flags: 0x0},
-	1260: {region: 0x165, script: 0x5a, flags: 0x0},
-	1261: {region: 0x165, script: 0x5a, flags: 0x0},
-	1262: {region: 0x41, script: 0x5a, flags: 0x0},
-	1263: {region: 0x165, script: 0x5a, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x5a, flags: 0x0},
-	1266: {region: 0x161, script: 0x5a, flags: 0x0},
-	1267: {region: 0x165, script: 0x5a, flags: 0x0},
-	1268: {region: 0x12b, script: 0x62, flags: 0x0},
-	1269: {region: 0x12b, script: 0x63, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2e, flags: 0x0},
-	1271: {region: 0x53, script: 0x67, flags: 0x0},
-	1272: {region: 0x10b, script: 0x6c, flags: 0x0},
-	1273: {region: 0x108, script: 0x77, flags: 0x0},
-	1274: {region: 0x99, script: 0x22, flags: 0x0},
-	1275: {region: 0x131, script: 0x5a, flags: 0x0},
-	1276: {region: 0x165, script: 0x5a, flags: 0x0},
-	1277: {region: 0x9c, script: 0x91, flags: 0x0},
-	1278: {region: 0x165, script: 0x5a, flags: 0x0},
-	1279: {region: 0x15e, script: 0xcc, flags: 0x0},
-	1280: {region: 0x165, script: 0x5a, flags: 0x0},
-	1281: {region: 0x165, script: 0x5a, flags: 0x0},
-	1282: {region: 0xdb, script: 0x22, flags: 0x0},
-	1283: {region: 0x165, script: 0x5a, flags: 0x0},
-	1284: {region: 0x165, script: 0x5a, flags: 0x0},
-	1285: {region: 0xd1, script: 0x5a, flags: 0x0},
-	1286: {region: 0x75, script: 0x5a, flags: 0x0},
-	1287: {region: 0x165, script: 0x5a, flags: 0x0},
-	1288: {region: 0x165, script: 0x5a, flags: 0x0},
-	1289: {region: 0x52, script: 0x5a, flags: 0x0},
-	1290: {region: 0x165, script: 0x5a, flags: 0x0},
-	1291: {region: 0x165, script: 0x5a, flags: 0x0},
-	1292: {region: 0x165, script: 0x5a, flags: 0x0},
-	1293: {region: 0x52, script: 0x5a, flags: 0x0},
-	1294: {region: 0x165, script: 0x5a, flags: 0x0},
-	1295: {region: 0x165, script: 0x5a, flags: 0x0},
-	1296: {region: 0x165, script: 0x5a, flags: 0x0},
-	1297: {region: 0x165, script: 0x5a, flags: 0x0},
+	1260: {region: 0x166, script: 0x5b, flags: 0x0},
+	1261: {region: 0x166, script: 0x5b, flags: 0x0},
+	1262: {region: 0x41, script: 0x5b, flags: 0x0},
+	1263: {region: 0x166, script: 0x5b, flags: 0x0},
+	1264: {region: 0x12c, script: 0x18, flags: 0x0},
+	1265: {region: 0x166, script: 0x5b, flags: 0x0},
+	1266: {region: 0x162, script: 0x5b, flags: 0x0},
+	1267: {region: 0x166, script: 0x5b, flags: 0x0},
+	1268: {region: 0x12c, script: 0x63, flags: 0x0},
+	1269: {region: 0x12c, script: 0x64, flags: 0x0},
+	1270: {region: 0x7e, script: 0x2e, flags: 0x0},
+	1271: {region: 0x53, script: 0x68, flags: 0x0},
+	1272: {region: 0x10c, script: 0x6d, flags: 0x0},
+	1273: {region: 0x109, script: 0x79, flags: 0x0},
+	1274: {region: 0x9a, script: 0x22, flags: 0x0},
+	1275: {region: 0x132, script: 0x5b, flags: 0x0},
+	1276: {region: 0x166, script: 0x5b, flags: 0x0},
+	1277: {region: 0x9d, script: 0x93, flags: 0x0},
+	1278: {region: 0x166, script: 0x5b, flags: 0x0},
+	1279: {region: 0x15f, script: 0xce, flags: 0x0},
+	1280: {region: 0x166, script: 0x5b, flags: 0x0},
+	1281: {region: 0x166, script: 0x5b, flags: 0x0},
+	1282: {region: 0xdc, script: 0x22, flags: 0x0},
+	1283: {region: 0x166, script: 0x5b, flags: 0x0},
+	1284: {region: 0x166, script: 0x5b, flags: 0x0},
+	1285: {region: 0xd2, script: 0x5b, flags: 0x0},
+	1286: {region: 0x76, script: 0x5b, flags: 0x0},
+	1287: {region: 0x166, script: 0x5b, flags: 0x0},
+	1288: {region: 0x166, script: 0x5b, flags: 0x0},
+	1289: {region: 0x52, script: 0x5b, flags: 0x0},
+	1290: {region: 0x166, script: 0x5b, flags: 0x0},
+	1291: {region: 0x166, script: 0x5b, flags: 0x0},
+	1292: {region: 0x166, script: 0x5b, flags: 0x0},
+	1293: {region: 0x52, script: 0x5b, flags: 0x0},
+	1294: {region: 0x166, script: 0x5b, flags: 0x0},
+	1295: {region: 0x166, script: 0x5b, flags: 0x0},
+	1296: {region: 0x166, script: 0x5b, flags: 0x0},
+	1297: {region: 0x166, script: 0x5b, flags: 0x0},
 	1298: {region: 0x1, script: 0x3e, flags: 0x0},
-	1299: {region: 0x165, script: 0x5a, flags: 0x0},
-	1300: {region: 0x165, script: 0x5a, flags: 0x0},
-	1301: {region: 0x165, script: 0x5a, flags: 0x0},
-	1302: {region: 0x165, script: 0x5a, flags: 0x0},
-	1303: {region: 0x165, script: 0x5a, flags: 0x0},
-	1304: {region: 0xd6, script: 0x5a, flags: 0x0},
-	1305: {region: 0x165, script: 0x5a, flags: 0x0},
-	1306: {region: 0x165, script: 0x5a, flags: 0x0},
-	1307: {region: 0x165, script: 0x5a, flags: 0x0},
-	1308: {region: 0x41, script: 0x5a, flags: 0x0},
-	1309: {region: 0x165, script: 0x5a, flags: 0x0},
-	1310: {region: 0xcf, script: 0x5a, flags: 0x0},
+	1299: {region: 0x166, script: 0x5b, flags: 0x0},
+	1300: {region: 0x166, script: 0x5b, flags: 0x0},
+	1301: {region: 0x166, script: 0x5b, flags: 0x0},
+	1302: {region: 0x166, script: 0x5b, flags: 0x0},
+	1303: {region: 0x166, script: 0x5b, flags: 0x0},
+	1304: {region: 0xd7, script: 0x5b, flags: 0x0},
+	1305: {region: 0x166, script: 0x5b, flags: 0x0},
+	1306: {region: 0x166, script: 0x5b, flags: 0x0},
+	1307: {region: 0x166, script: 0x5b, flags: 0x0},
+	1308: {region: 0x41, script: 0x5b, flags: 0x0},
+	1309: {region: 0x166, script: 0x5b, flags: 0x0},
+	1310: {region: 0xd0, script: 0x5b, flags: 0x0},
 	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x5a, flags: 0x0},
-	1313: {region: 0x165, script: 0x5a, flags: 0x0},
-	1314: {region: 0x165, script: 0x5a, flags: 0x0},
-	1315: {region: 0x53, script: 0x5a, flags: 0x0},
-	1316: {region: 0x10b, script: 0x5a, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x5a, flags: 0x0},
-	1320: {region: 0xba, script: 0xe8, flags: 0x0},
+	1312: {region: 0x166, script: 0x5b, flags: 0x0},
+	1313: {region: 0x166, script: 0x5b, flags: 0x0},
+	1314: {region: 0x166, script: 0x5b, flags: 0x0},
+	1315: {region: 0x53, script: 0x5b, flags: 0x0},
+	1316: {region: 0x10c, script: 0x5b, flags: 0x0},
+	1318: {region: 0xa9, script: 0x5, flags: 0x0},
+	1319: {region: 0xda, script: 0x5b, flags: 0x0},
+	1320: {region: 0xbb, script: 0xeb, flags: 0x0},
 	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x7d, flags: 0x0},
-	1323: {region: 0x165, script: 0x5a, flags: 0x0},
-	1324: {region: 0x122, script: 0x5a, flags: 0x0},
-	1325: {region: 0xd0, script: 0x5a, flags: 0x0},
-	1326: {region: 0x165, script: 0x5a, flags: 0x0},
-	1327: {region: 0x161, script: 0x5a, flags: 0x0},
-	1329: {region: 0x12b, script: 0x5a, flags: 0x0},
+	1322: {region: 0x53, script: 0x7f, flags: 0x0},
+	1323: {region: 0x166, script: 0x5b, flags: 0x0},
+	1324: {region: 0x123, script: 0x5b, flags: 0x0},
+	1325: {region: 0xd1, script: 0x5b, flags: 0x0},
+	1326: {region: 0x166, script: 0x5b, flags: 0x0},
+	1327: {region: 0x162, script: 0x5b, flags: 0x0},
+	1329: {region: 0x12c, script: 0x5b, flags: 0x0},
 }
 
 // likelyLangList holds lists info associated with likelyLang.
 // Size: 582 bytes, 97 elements
 var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x78, flags: 0x2},
-	2:  {region: 0x11c, script: 0x85, flags: 0x2},
-	3:  {region: 0x32, script: 0x5a, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x20, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x20, flags: 0x0},
+	0:  {region: 0x9d, script: 0x7, flags: 0x0},
+	1:  {region: 0xa2, script: 0x7a, flags: 0x2},
+	2:  {region: 0x11d, script: 0x87, flags: 0x2},
+	3:  {region: 0x32, script: 0x5b, flags: 0x0},
+	4:  {region: 0x9c, script: 0x5, flags: 0x4},
+	5:  {region: 0x9d, script: 0x5, flags: 0x4},
+	6:  {region: 0x107, script: 0x20, flags: 0x4},
+	7:  {region: 0x9d, script: 0x5, flags: 0x2},
+	8:  {region: 0x107, script: 0x20, flags: 0x0},
 	9:  {region: 0x38, script: 0x2f, flags: 0x2},
-	10: {region: 0x135, script: 0x5a, flags: 0x0},
-	11: {region: 0x7b, script: 0xcf, flags: 0x2},
-	12: {region: 0x114, script: 0x5a, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1f, flags: 0x0},
-	15: {region: 0x87, script: 0x5f, flags: 0x2},
-	16: {region: 0xd6, script: 0x5a, flags: 0x0},
+	10: {region: 0x136, script: 0x5b, flags: 0x0},
+	11: {region: 0x7c, script: 0xd1, flags: 0x2},
+	12: {region: 0x115, script: 0x5b, flags: 0x0},
+	13: {region: 0x85, script: 0x1, flags: 0x2},
+	14: {region: 0x5e, script: 0x1f, flags: 0x0},
+	15: {region: 0x88, script: 0x60, flags: 0x2},
+	16: {region: 0xd7, script: 0x5b, flags: 0x0},
 	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x20, flags: 0x0},
+	18: {region: 0x10c, script: 0x5, flags: 0x4},
+	19: {region: 0xaf, script: 0x20, flags: 0x0},
 	20: {region: 0x24, script: 0x5, flags: 0x4},
 	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
+	22: {region: 0x9d, script: 0x5, flags: 0x4},
+	23: {region: 0xc6, script: 0x5, flags: 0x4},
 	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x5a, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x20, flags: 0x0},
+	25: {region: 0x12c, script: 0x5b, flags: 0x0},
+	26: {region: 0xb1, script: 0x5, flags: 0x4},
+	27: {region: 0x9c, script: 0x5, flags: 0x2},
+	28: {region: 0xa6, script: 0x20, flags: 0x0},
 	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x5a, flags: 0x4},
+	30: {region: 0x12c, script: 0x5b, flags: 0x4},
 	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x5a, flags: 0x2},
-	33: {region: 0xdb, script: 0x22, flags: 0x0},
-	34: {region: 0x99, script: 0x5d, flags: 0x2},
-	35: {region: 0x83, script: 0x5a, flags: 0x0},
-	36: {region: 0x84, script: 0x7c, flags: 0x4},
-	37: {region: 0x84, script: 0x7c, flags: 0x2},
-	38: {region: 0xc5, script: 0x20, flags: 0x0},
-	39: {region: 0x53, script: 0x70, flags: 0x4},
-	40: {region: 0x53, script: 0x70, flags: 0x2},
-	41: {region: 0xd0, script: 0x5a, flags: 0x0},
+	32: {region: 0x12c, script: 0x5b, flags: 0x2},
+	33: {region: 0xdc, script: 0x22, flags: 0x0},
+	34: {region: 0x9a, script: 0x5e, flags: 0x2},
+	35: {region: 0x84, script: 0x5b, flags: 0x0},
+	36: {region: 0x85, script: 0x7e, flags: 0x4},
+	37: {region: 0x85, script: 0x7e, flags: 0x2},
+	38: {region: 0xc6, script: 0x20, flags: 0x0},
+	39: {region: 0x53, script: 0x71, flags: 0x4},
+	40: {region: 0x53, script: 0x71, flags: 0x2},
+	41: {region: 0xd1, script: 0x5b, flags: 0x0},
 	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x36, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x8b, flags: 0x0},
-	48: {region: 0x53, script: 0x8c, flags: 0x2},
-	49: {region: 0xba, script: 0xe8, flags: 0x0},
-	50: {region: 0xd9, script: 0x5a, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x22, flags: 0x2},
-	53: {region: 0x99, script: 0x4f, flags: 0x2},
-	54: {region: 0x99, script: 0xd3, flags: 0x2},
-	55: {region: 0x105, script: 0x20, flags: 0x0},
-	56: {region: 0xbd, script: 0x5a, flags: 0x4},
-	57: {region: 0x104, script: 0x5a, flags: 0x4},
-	58: {region: 0x106, script: 0x5a, flags: 0x4},
-	59: {region: 0x12b, script: 0x5a, flags: 0x4},
-	60: {region: 0x124, script: 0x20, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
+	43: {region: 0x96, script: 0x5, flags: 0x4},
+	44: {region: 0x9a, script: 0x36, flags: 0x0},
+	45: {region: 0xe9, script: 0x5, flags: 0x4},
+	46: {region: 0xe9, script: 0x5, flags: 0x2},
+	47: {region: 0x9d, script: 0x8d, flags: 0x0},
+	48: {region: 0x53, script: 0x8e, flags: 0x2},
+	49: {region: 0xbb, script: 0xeb, flags: 0x0},
+	50: {region: 0xda, script: 0x5b, flags: 0x4},
+	51: {region: 0xe9, script: 0x5, flags: 0x0},
+	52: {region: 0x9a, script: 0x22, flags: 0x2},
+	53: {region: 0x9a, script: 0x50, flags: 0x2},
+	54: {region: 0x9a, script: 0xd5, flags: 0x2},
+	55: {region: 0x106, script: 0x20, flags: 0x0},
+	56: {region: 0xbe, script: 0x5b, flags: 0x4},
+	57: {region: 0x105, script: 0x5b, flags: 0x4},
+	58: {region: 0x107, script: 0x5b, flags: 0x4},
+	59: {region: 0x12c, script: 0x5b, flags: 0x4},
+	60: {region: 0x125, script: 0x20, flags: 0x0},
+	61: {region: 0xe9, script: 0x5, flags: 0x4},
+	62: {region: 0xe9, script: 0x5, flags: 0x2},
 	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x20, flags: 0x4},
-	65: {region: 0xc5, script: 0x20, flags: 0x4},
-	66: {region: 0xae, script: 0x20, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x22, flags: 0x4},
-	69: {region: 0xdb, script: 0x22, flags: 0x2},
-	70: {region: 0x137, script: 0x5a, flags: 0x0},
+	64: {region: 0xaf, script: 0x20, flags: 0x4},
+	65: {region: 0xc6, script: 0x20, flags: 0x4},
+	66: {region: 0xaf, script: 0x20, flags: 0x2},
+	67: {region: 0x9a, script: 0xe, flags: 0x0},
+	68: {region: 0xdc, script: 0x22, flags: 0x4},
+	69: {region: 0xdc, script: 0x22, flags: 0x2},
+	70: {region: 0x138, script: 0x5b, flags: 0x0},
 	71: {region: 0x24, script: 0x5, flags: 0x4},
 	72: {region: 0x53, script: 0x20, flags: 0x4},
 	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x3c, flags: 0x0},
+	74: {region: 0x8e, script: 0x3c, flags: 0x0},
 	75: {region: 0x53, script: 0x3b, flags: 0x4},
 	76: {region: 0x53, script: 0x3b, flags: 0x2},
 	77: {region: 0x53, script: 0x3b, flags: 0x0},
 	78: {region: 0x2f, script: 0x3c, flags: 0x4},
 	79: {region: 0x3e, script: 0x3c, flags: 0x4},
-	80: {region: 0x7b, script: 0x3c, flags: 0x4},
-	81: {region: 0x7e, script: 0x3c, flags: 0x4},
-	82: {region: 0x8d, script: 0x3c, flags: 0x4},
-	83: {region: 0x95, script: 0x3c, flags: 0x4},
-	84: {region: 0xc6, script: 0x3c, flags: 0x4},
-	85: {region: 0xd0, script: 0x3c, flags: 0x4},
-	86: {region: 0xe2, script: 0x3c, flags: 0x4},
-	87: {region: 0xe5, script: 0x3c, flags: 0x4},
-	88: {region: 0xe7, script: 0x3c, flags: 0x4},
-	89: {region: 0x116, script: 0x3c, flags: 0x4},
-	90: {region: 0x123, script: 0x3c, flags: 0x4},
-	91: {region: 0x12e, script: 0x3c, flags: 0x4},
-	92: {region: 0x135, script: 0x3c, flags: 0x4},
-	93: {region: 0x13e, script: 0x3c, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x37, flags: 0x2},
-	96: {region: 0x12e, script: 0x3c, flags: 0x2},
+	80: {region: 0x7c, script: 0x3c, flags: 0x4},
+	81: {region: 0x7f, script: 0x3c, flags: 0x4},
+	82: {region: 0x8e, script: 0x3c, flags: 0x4},
+	83: {region: 0x96, script: 0x3c, flags: 0x4},
+	84: {region: 0xc7, script: 0x3c, flags: 0x4},
+	85: {region: 0xd1, script: 0x3c, flags: 0x4},
+	86: {region: 0xe3, script: 0x3c, flags: 0x4},
+	87: {region: 0xe6, script: 0x3c, flags: 0x4},
+	88: {region: 0xe8, script: 0x3c, flags: 0x4},
+	89: {region: 0x117, script: 0x3c, flags: 0x4},
+	90: {region: 0x124, script: 0x3c, flags: 0x4},
+	91: {region: 0x12f, script: 0x3c, flags: 0x4},
+	92: {region: 0x136, script: 0x3c, flags: 0x4},
+	93: {region: 0x13f, script: 0x3c, flags: 0x4},
+	94: {region: 0x12f, script: 0x11, flags: 0x2},
+	95: {region: 0x12f, script: 0x37, flags: 0x2},
+	96: {region: 0x12f, script: 0x3c, flags: 0x2},
 }
 
 type likelyLangScript struct {
@@ -2987,306 +3009,306 @@ type likelyLangScript struct {
 // for a given regionID, lang and script are the index and size respectively
 // of the list in likelyRegionList.
 // TODO: exclude containers and user-definable regions from the list.
-// Size: 2148 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x5a, flags: 0x0},
+// Size: 2154 bytes, 359 elements
+var likelyRegion = [359]likelyLangScript{
+	34:  {lang: 0xd7, script: 0x5b, flags: 0x0},
 	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
 	36:  {lang: 0x0, script: 0x2, flags: 0x1},
 	39:  {lang: 0x2, script: 0x2, flags: 0x1},
 	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	43:  {lang: 0x0, script: 0x5a, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x5a, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	48:  {lang: 0x367, script: 0x5a, flags: 0x0},
-	49:  {lang: 0x444, script: 0x5a, flags: 0x0},
-	50:  {lang: 0x58, script: 0x5a, flags: 0x0},
+	42:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	43:  {lang: 0x0, script: 0x5b, flags: 0x0},
+	44:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	45:  {lang: 0x41b, script: 0x5b, flags: 0x0},
+	46:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	48:  {lang: 0x367, script: 0x5b, flags: 0x0},
+	49:  {lang: 0x444, script: 0x5b, flags: 0x0},
+	50:  {lang: 0x58, script: 0x5b, flags: 0x0},
 	51:  {lang: 0x6, script: 0x2, flags: 0x1},
 	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x5a, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x5a, flags: 0x0},
+	54:  {lang: 0x367, script: 0x5b, flags: 0x0},
+	55:  {lang: 0x15e, script: 0x5b, flags: 0x0},
 	56:  {lang: 0x7e, script: 0x20, flags: 0x0},
 	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x5a, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x5a, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x5a, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
+	58:  {lang: 0x3d9, script: 0x5b, flags: 0x0},
+	59:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	60:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	62:  {lang: 0x31f, script: 0x5b, flags: 0x0},
+	63:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	64:  {lang: 0x3a1, script: 0x5b, flags: 0x0},
+	65:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
 	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x5a, flags: 0x0},
+	69:  {lang: 0x0, script: 0x5b, flags: 0x0},
 	71:  {lang: 0x71, script: 0x20, flags: 0x0},
 	73:  {lang: 0x512, script: 0x3e, flags: 0x2},
 	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x5a, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x5a, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x5a, flags: 0x0},
+	75:  {lang: 0x445, script: 0x5b, flags: 0x0},
+	76:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	77:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	78:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	79:  {lang: 0x15e, script: 0x5b, flags: 0x0},
+	81:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	82:  {lang: 0x15e, script: 0x5b, flags: 0x0},
 	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	85:  {lang: 0x0, script: 0x5a, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x5a, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x5a, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x5a, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x5a, flags: 0x0},
-	98:  {lang: 0x1, script: 0x5a, flags: 0x0},
-	99:  {lang: 0x101, script: 0x5a, flags: 0x0},
-	101: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	105: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	106: {lang: 0x140, script: 0x5a, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
+	84:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	85:  {lang: 0x0, script: 0x5b, flags: 0x0},
+	87:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	90:  {lang: 0x13e, script: 0x5b, flags: 0x0},
+	91:  {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	92:  {lang: 0x3a1, script: 0x5b, flags: 0x0},
+	94:  {lang: 0xe, script: 0x2, flags: 0x1},
+	95:  {lang: 0xfa, script: 0x5b, flags: 0x0},
+	97:  {lang: 0x10d, script: 0x5b, flags: 0x0},
+	99:  {lang: 0x1, script: 0x5b, flags: 0x0},
+	100: {lang: 0x101, script: 0x5b, flags: 0x0},
+	102: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	104: {lang: 0x10, script: 0x2, flags: 0x1},
+	105: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	106: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	107: {lang: 0x140, script: 0x5b, flags: 0x0},
 	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x2c, flags: 0x0},
-	110: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x5a, flags: 0x0},
-	114: {lang: 0x151, script: 0x5a, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x22, flags: 0x2},
-	118: {lang: 0x158, script: 0x5a, flags: 0x0},
-	120: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	122: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	128: {lang: 0x21, script: 0x5a, flags: 0x0},
-	130: {lang: 0x245, script: 0x5a, flags: 0x0},
-	132: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	133: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	134: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x5a, flags: 0x0},
-	137: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	141: {lang: 0x529, script: 0x3c, flags: 0x0},
-	142: {lang: 0x0, script: 0x5a, flags: 0x0},
-	143: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x5a, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x5a, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x5a, flags: 0x0},
-	148: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3e, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x5a, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x49, flags: 0x0},
-	164: {lang: 0x445, script: 0x5a, flags: 0x0},
-	165: {lang: 0x28a, script: 0x20, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x53, flags: 0x0},
-	171: {lang: 0x254, script: 0x53, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x20, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x5a, flags: 0x0},
-	179: {lang: 0x40c, script: 0xd4, flags: 0x0},
-	181: {lang: 0x43b, script: 0x5a, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x5a, flags: 0x0},
-	183: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x5a, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x5a, flags: 0x0},
-	190: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x5a, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x5a, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x5a, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xea, flags: 0x0},
-	207: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	208: {lang: 0x31f, script: 0x5a, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	210: {lang: 0x16, script: 0x5a, flags: 0x0},
-	211: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x5a, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	217: {lang: 0x367, script: 0x5a, flags: 0x0},
-	218: {lang: 0x347, script: 0x5a, flags: 0x0},
-	219: {lang: 0x351, script: 0x22, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	228: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	229: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	230: {lang: 0x486, script: 0x5a, flags: 0x0},
-	231: {lang: 0x153, script: 0x5a, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x5a, flags: 0x0},
-	234: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	236: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x5a, flags: 0x0},
-	241: {lang: 0x194, script: 0x5a, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x20, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x5a, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x5a, flags: 0x0},
-	272: {lang: 0x347, script: 0x5a, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	276: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	277: {lang: 0x429, script: 0x5a, flags: 0x0},
-	278: {lang: 0x367, script: 0x5a, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	282: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	289: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x5a, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x5a, flags: 0x0},
-	295: {lang: 0x476, script: 0x5a, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x5a, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x5a, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x5a, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x5a, flags: 0x0},
-	309: {lang: 0x512, script: 0x3e, flags: 0x2},
-	310: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x5a, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x5a, flags: 0x0},
-	315: {lang: 0x13e, script: 0x5a, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x5a, flags: 0x0},
-	319: {lang: 0x8a, script: 0x5a, flags: 0x0},
-	320: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	322: {lang: 0x41b, script: 0x5a, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x5a, flags: 0x0},
+	109: {lang: 0x3a, script: 0x5, flags: 0x0},
+	110: {lang: 0x46f, script: 0x2c, flags: 0x0},
+	111: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	112: {lang: 0x12, script: 0x2, flags: 0x1},
+	114: {lang: 0x10d, script: 0x5b, flags: 0x0},
+	115: {lang: 0x151, script: 0x5b, flags: 0x0},
+	116: {lang: 0x1c0, script: 0x22, flags: 0x2},
+	119: {lang: 0x158, script: 0x5b, flags: 0x0},
+	121: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	123: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	124: {lang: 0x14, script: 0x2, flags: 0x1},
+	126: {lang: 0x16, script: 0x3, flags: 0x1},
+	127: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	129: {lang: 0x21, script: 0x5b, flags: 0x0},
+	131: {lang: 0x245, script: 0x5b, flags: 0x0},
+	133: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	134: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	135: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	136: {lang: 0x19, script: 0x2, flags: 0x1},
+	137: {lang: 0x0, script: 0x5b, flags: 0x0},
+	138: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	140: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	142: {lang: 0x529, script: 0x3c, flags: 0x0},
+	143: {lang: 0x0, script: 0x5b, flags: 0x0},
+	144: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	145: {lang: 0x1d1, script: 0x5b, flags: 0x0},
+	146: {lang: 0x1d4, script: 0x5b, flags: 0x0},
+	147: {lang: 0x1d5, script: 0x5b, flags: 0x0},
+	149: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	150: {lang: 0x1b, script: 0x2, flags: 0x1},
+	152: {lang: 0x1bc, script: 0x3e, flags: 0x0},
+	154: {lang: 0x1d, script: 0x3, flags: 0x1},
+	156: {lang: 0x3a, script: 0x5, flags: 0x0},
+	157: {lang: 0x20, script: 0x2, flags: 0x1},
+	158: {lang: 0x1f8, script: 0x5b, flags: 0x0},
+	159: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	162: {lang: 0x3a, script: 0x5, flags: 0x0},
+	163: {lang: 0x200, script: 0x49, flags: 0x0},
+	165: {lang: 0x445, script: 0x5b, flags: 0x0},
+	166: {lang: 0x28a, script: 0x20, flags: 0x0},
+	167: {lang: 0x22, script: 0x3, flags: 0x1},
+	169: {lang: 0x25, script: 0x2, flags: 0x1},
+	171: {lang: 0x254, script: 0x54, flags: 0x0},
+	172: {lang: 0x254, script: 0x54, flags: 0x0},
+	173: {lang: 0x3a, script: 0x5, flags: 0x0},
+	175: {lang: 0x3e2, script: 0x20, flags: 0x0},
+	176: {lang: 0x27, script: 0x2, flags: 0x1},
+	177: {lang: 0x3a, script: 0x5, flags: 0x0},
+	179: {lang: 0x10d, script: 0x5b, flags: 0x0},
+	180: {lang: 0x40c, script: 0xd6, flags: 0x0},
+	182: {lang: 0x43b, script: 0x5b, flags: 0x0},
+	183: {lang: 0x2c0, script: 0x5b, flags: 0x0},
+	184: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	185: {lang: 0x2c7, script: 0x5b, flags: 0x0},
+	186: {lang: 0x3a, script: 0x5, flags: 0x0},
+	187: {lang: 0x29, script: 0x2, flags: 0x1},
+	188: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	189: {lang: 0x2b, script: 0x2, flags: 0x1},
+	190: {lang: 0x432, script: 0x5b, flags: 0x0},
+	191: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	192: {lang: 0x2f1, script: 0x5b, flags: 0x0},
+	195: {lang: 0x2d, script: 0x2, flags: 0x1},
+	196: {lang: 0xa0, script: 0x5b, flags: 0x0},
+	197: {lang: 0x2f, script: 0x2, flags: 0x1},
+	198: {lang: 0x31, script: 0x2, flags: 0x1},
+	199: {lang: 0x33, script: 0x2, flags: 0x1},
+	201: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	202: {lang: 0x35, script: 0x2, flags: 0x1},
+	204: {lang: 0x320, script: 0x5b, flags: 0x0},
+	205: {lang: 0x37, script: 0x3, flags: 0x1},
+	206: {lang: 0x128, script: 0xed, flags: 0x0},
+	208: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	209: {lang: 0x31f, script: 0x5b, flags: 0x0},
+	210: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	211: {lang: 0x16, script: 0x5b, flags: 0x0},
+	212: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	213: {lang: 0x1b4, script: 0x5b, flags: 0x0},
+	215: {lang: 0x1b4, script: 0x5, flags: 0x2},
+	217: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	218: {lang: 0x367, script: 0x5b, flags: 0x0},
+	219: {lang: 0x347, script: 0x5b, flags: 0x0},
+	220: {lang: 0x351, script: 0x22, flags: 0x0},
+	226: {lang: 0x3a, script: 0x5, flags: 0x0},
+	227: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	229: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	230: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	231: {lang: 0x486, script: 0x5b, flags: 0x0},
+	232: {lang: 0x153, script: 0x5b, flags: 0x0},
+	233: {lang: 0x3a, script: 0x3, flags: 0x1},
+	234: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+	235: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	237: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	238: {lang: 0x3a, script: 0x5, flags: 0x0},
+	239: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	241: {lang: 0x3a2, script: 0x5b, flags: 0x0},
+	242: {lang: 0x194, script: 0x5b, flags: 0x0},
+	244: {lang: 0x3a, script: 0x5, flags: 0x0},
+	259: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	261: {lang: 0x3d, script: 0x2, flags: 0x1},
+	262: {lang: 0x432, script: 0x20, flags: 0x0},
+	263: {lang: 0x3f, script: 0x2, flags: 0x1},
+	264: {lang: 0x3e5, script: 0x5b, flags: 0x0},
+	265: {lang: 0x3a, script: 0x5, flags: 0x0},
+	267: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	268: {lang: 0x3a, script: 0x5, flags: 0x0},
+	269: {lang: 0x41, script: 0x2, flags: 0x1},
+	272: {lang: 0x416, script: 0x5b, flags: 0x0},
+	273: {lang: 0x347, script: 0x5b, flags: 0x0},
+	274: {lang: 0x43, script: 0x2, flags: 0x1},
+	276: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	277: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	278: {lang: 0x429, script: 0x5b, flags: 0x0},
+	279: {lang: 0x367, script: 0x5b, flags: 0x0},
+	281: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	283: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	285: {lang: 0x45, script: 0x2, flags: 0x1},
+	289: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	290: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	291: {lang: 0x47, script: 0x2, flags: 0x1},
+	292: {lang: 0x49, script: 0x3, flags: 0x1},
+	293: {lang: 0x4c, script: 0x2, flags: 0x1},
+	294: {lang: 0x477, script: 0x5b, flags: 0x0},
+	295: {lang: 0x3c0, script: 0x5b, flags: 0x0},
+	296: {lang: 0x476, script: 0x5b, flags: 0x0},
+	297: {lang: 0x4e, script: 0x2, flags: 0x1},
+	298: {lang: 0x482, script: 0x5b, flags: 0x0},
+	300: {lang: 0x50, script: 0x4, flags: 0x1},
+	302: {lang: 0x4a0, script: 0x5b, flags: 0x0},
+	303: {lang: 0x54, script: 0x2, flags: 0x1},
+	304: {lang: 0x445, script: 0x5b, flags: 0x0},
+	305: {lang: 0x56, script: 0x3, flags: 0x1},
+	306: {lang: 0x445, script: 0x5b, flags: 0x0},
+	310: {lang: 0x512, script: 0x3e, flags: 0x2},
+	311: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	312: {lang: 0x4bc, script: 0x5b, flags: 0x0},
+	313: {lang: 0x1f9, script: 0x5b, flags: 0x0},
+	316: {lang: 0x13e, script: 0x5b, flags: 0x0},
+	319: {lang: 0x4c3, script: 0x5b, flags: 0x0},
+	320: {lang: 0x8a, script: 0x5b, flags: 0x0},
+	321: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	323: {lang: 0x41b, script: 0x5b, flags: 0x0},
+	334: {lang: 0x59, script: 0x2, flags: 0x1},
+	351: {lang: 0x3a, script: 0x5, flags: 0x0},
+	352: {lang: 0x5b, script: 0x2, flags: 0x1},
+	357: {lang: 0x423, script: 0x5b, flags: 0x0},
 }
 
 // likelyRegionList holds lists info associated with likelyRegion.
 // Size: 558 bytes, 93 elements
 var likelyRegionList = [93]likelyLangScript{
 	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x5a, flags: 0x0},
-	2:  {lang: 0x431, script: 0x5a, flags: 0x0},
+	1:  {lang: 0x476, script: 0x5b, flags: 0x0},
+	2:  {lang: 0x431, script: 0x5b, flags: 0x0},
 	3:  {lang: 0x2ff, script: 0x20, flags: 0x0},
 	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x5a, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x5a, flags: 0x0},
+	5:  {lang: 0x274, script: 0x5b, flags: 0x0},
+	6:  {lang: 0xb7, script: 0x5b, flags: 0x0},
 	7:  {lang: 0x432, script: 0x20, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xec, flags: 0x0},
+	8:  {lang: 0x12d, script: 0xef, flags: 0x0},
 	9:  {lang: 0x351, script: 0x22, flags: 0x0},
 	10: {lang: 0x529, script: 0x3b, flags: 0x0},
 	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x5a, flags: 0x0},
-	13: {lang: 0x29a, script: 0xeb, flags: 0x0},
+	12: {lang: 0x523, script: 0x5b, flags: 0x0},
+	13: {lang: 0x29a, script: 0xee, flags: 0x0},
 	14: {lang: 0x136, script: 0x34, flags: 0x0},
-	15: {lang: 0x48a, script: 0x5a, flags: 0x0},
+	15: {lang: 0x48a, script: 0x5b, flags: 0x0},
 	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x5a, flags: 0x0},
+	17: {lang: 0x15e, script: 0x5b, flags: 0x0},
 	18: {lang: 0x27, script: 0x2c, flags: 0x0},
-	19: {lang: 0x139, script: 0x5a, flags: 0x0},
+	19: {lang: 0x139, script: 0x5b, flags: 0x0},
 	20: {lang: 0x26a, script: 0x5, flags: 0x2},
 	21: {lang: 0x512, script: 0x3e, flags: 0x2},
 	22: {lang: 0x210, script: 0x2e, flags: 0x0},
 	23: {lang: 0x5, script: 0x20, flags: 0x0},
-	24: {lang: 0x274, script: 0x5a, flags: 0x0},
+	24: {lang: 0x274, script: 0x5b, flags: 0x0},
 	25: {lang: 0x136, script: 0x34, flags: 0x0},
 	26: {lang: 0x2ff, script: 0x20, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x5a, flags: 0x0},
+	27: {lang: 0x1e1, script: 0x5b, flags: 0x0},
 	28: {lang: 0x31f, script: 0x5, flags: 0x0},
 	29: {lang: 0x1be, script: 0x22, flags: 0x0},
 	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x75, flags: 0x0},
+	31: {lang: 0x236, script: 0x76, flags: 0x0},
 	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x5a, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4e, flags: 0x0},
+	33: {lang: 0x476, script: 0x5b, flags: 0x0},
+	34: {lang: 0x24a, script: 0x4f, flags: 0x0},
 	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xeb, flags: 0x0},
+	36: {lang: 0x226, script: 0xee, flags: 0x0},
 	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x57, flags: 0x0},
-	40: {lang: 0x226, script: 0xeb, flags: 0x0},
+	38: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	39: {lang: 0x2b8, script: 0x58, flags: 0x0},
+	40: {lang: 0x226, script: 0xee, flags: 0x0},
 	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x5a, flags: 0x0},
+	42: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	43: {lang: 0x3dc, script: 0x5b, flags: 0x0},
 	44: {lang: 0x4ae, script: 0x20, flags: 0x0},
 	45: {lang: 0x2ff, script: 0x20, flags: 0x0},
-	46: {lang: 0x431, script: 0x5a, flags: 0x0},
-	47: {lang: 0x331, script: 0x75, flags: 0x0},
-	48: {lang: 0x213, script: 0x5a, flags: 0x0},
+	46: {lang: 0x431, script: 0x5b, flags: 0x0},
+	47: {lang: 0x331, script: 0x76, flags: 0x0},
+	48: {lang: 0x213, script: 0x5b, flags: 0x0},
 	49: {lang: 0x30b, script: 0x20, flags: 0x0},
 	50: {lang: 0x242, script: 0x5, flags: 0x0},
 	51: {lang: 0x529, script: 0x3c, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x5a, flags: 0x0},
+	52: {lang: 0x3c0, script: 0x5b, flags: 0x0},
 	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x5a, flags: 0x0},
+	54: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	55: {lang: 0x2ed, script: 0x5b, flags: 0x0},
 	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
 	57: {lang: 0x88, script: 0x22, flags: 0x0},
 	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
 	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
 	60: {lang: 0xbe, script: 0x22, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x5a, flags: 0x0},
+	61: {lang: 0x3dc, script: 0x5b, flags: 0x0},
 	62: {lang: 0x7e, script: 0x20, flags: 0x0},
 	63: {lang: 0x3e2, script: 0x20, flags: 0x0},
-	64: {lang: 0x267, script: 0x5a, flags: 0x0},
-	65: {lang: 0x444, script: 0x5a, flags: 0x0},
+	64: {lang: 0x267, script: 0x5b, flags: 0x0},
+	65: {lang: 0x444, script: 0x5b, flags: 0x0},
 	66: {lang: 0x512, script: 0x3e, flags: 0x0},
-	67: {lang: 0x412, script: 0x5a, flags: 0x0},
+	67: {lang: 0x412, script: 0x5b, flags: 0x0},
 	68: {lang: 0x4ae, script: 0x20, flags: 0x0},
 	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	71: {lang: 0x15e, script: 0x5a, flags: 0x0},
+	70: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	71: {lang: 0x15e, script: 0x5b, flags: 0x0},
 	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xeb, flags: 0x0},
+	73: {lang: 0x46b, script: 0xee, flags: 0x0},
 	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x75, flags: 0x0},
+	75: {lang: 0x30f, script: 0x76, flags: 0x0},
 	76: {lang: 0x467, script: 0x20, flags: 0x0},
 	77: {lang: 0x148, script: 0x5, flags: 0x0},
 	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x5a, flags: 0x0},
-	80: {lang: 0x48a, script: 0x5a, flags: 0x0},
+	79: {lang: 0x15e, script: 0x5b, flags: 0x0},
+	80: {lang: 0x48a, script: 0x5b, flags: 0x0},
 	81: {lang: 0x58, script: 0x5, flags: 0x0},
 	82: {lang: 0x219, script: 0x20, flags: 0x0},
 	83: {lang: 0x81, script: 0x34, flags: 0x0},
 	84: {lang: 0x529, script: 0x3c, flags: 0x0},
-	85: {lang: 0x48c, script: 0x5a, flags: 0x0},
+	85: {lang: 0x48c, script: 0x5b, flags: 0x0},
 	86: {lang: 0x4ae, script: 0x20, flags: 0x0},
 	87: {lang: 0x512, script: 0x3e, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x5a, flags: 0x0},
-	89: {lang: 0x431, script: 0x5a, flags: 0x0},
+	88: {lang: 0x3b3, script: 0x5b, flags: 0x0},
+	89: {lang: 0x431, script: 0x5b, flags: 0x0},
 	90: {lang: 0x432, script: 0x20, flags: 0x0},
-	91: {lang: 0x15e, script: 0x5a, flags: 0x0},
+	91: {lang: 0x15e, script: 0x5b, flags: 0x0},
 	92: {lang: 0x446, script: 0x5, flags: 0x0},
 }
 
@@ -3298,38 +3320,38 @@ type likelyTag struct {
 
 // Size: 198 bytes, 33 elements
 var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x5a},
-	2:  {lang: 0x139, region: 0x135, script: 0x5a},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x5a},
-	4:  {lang: 0x139, region: 0x2f, script: 0x5a},
-	5:  {lang: 0x139, region: 0xd6, script: 0x5a},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x5a},
-	7:  {lang: 0x445, region: 0x12f, script: 0x5a},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x5a},
-	10: {lang: 0x139, region: 0x161, script: 0x5a},
-	11: {lang: 0x139, region: 0x135, script: 0x5a},
-	12: {lang: 0x139, region: 0x135, script: 0x5a},
-	13: {lang: 0x13e, region: 0x59, script: 0x5a},
+	1:  {lang: 0x139, region: 0xd7, script: 0x5b},
+	2:  {lang: 0x139, region: 0x136, script: 0x5b},
+	3:  {lang: 0x3c0, region: 0x41, script: 0x5b},
+	4:  {lang: 0x139, region: 0x2f, script: 0x5b},
+	5:  {lang: 0x139, region: 0xd7, script: 0x5b},
+	6:  {lang: 0x13e, region: 0xd0, script: 0x5b},
+	7:  {lang: 0x445, region: 0x130, script: 0x5b},
+	8:  {lang: 0x3a, region: 0x6c, script: 0x5},
+	9:  {lang: 0x445, region: 0x4b, script: 0x5b},
+	10: {lang: 0x139, region: 0x162, script: 0x5b},
+	11: {lang: 0x139, region: 0x136, script: 0x5b},
+	12: {lang: 0x139, region: 0x136, script: 0x5b},
+	13: {lang: 0x13e, region: 0x5a, script: 0x5b},
 	14: {lang: 0x529, region: 0x53, script: 0x3b},
-	15: {lang: 0x1be, region: 0x99, script: 0x22},
-	16: {lang: 0x1e1, region: 0x95, script: 0x5a},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x5a},
-	18: {lang: 0x139, region: 0x2f, script: 0x5a},
-	19: {lang: 0x139, region: 0xe6, script: 0x5a},
-	20: {lang: 0x139, region: 0x8a, script: 0x5a},
-	21: {lang: 0x41b, region: 0x142, script: 0x5a},
+	15: {lang: 0x1be, region: 0x9a, script: 0x22},
+	16: {lang: 0x1e1, region: 0x96, script: 0x5b},
+	17: {lang: 0x1f9, region: 0x9f, script: 0x5b},
+	18: {lang: 0x139, region: 0x2f, script: 0x5b},
+	19: {lang: 0x139, region: 0xe7, script: 0x5b},
+	20: {lang: 0x139, region: 0x8b, script: 0x5b},
+	21: {lang: 0x41b, region: 0x143, script: 0x5b},
 	22: {lang: 0x529, region: 0x53, script: 0x3b},
-	23: {lang: 0x4bc, region: 0x137, script: 0x5a},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x20},
-	26: {lang: 0x3e2, region: 0x106, script: 0x20},
-	27: {lang: 0x139, region: 0x7b, script: 0x5a},
-	28: {lang: 0x10d, region: 0x60, script: 0x5a},
-	29: {lang: 0x139, region: 0xd6, script: 0x5a},
-	30: {lang: 0x13e, region: 0x1f, script: 0x5a},
-	31: {lang: 0x139, region: 0x9a, script: 0x5a},
-	32: {lang: 0x139, region: 0x7b, script: 0x5a},
+	23: {lang: 0x4bc, region: 0x138, script: 0x5b},
+	24: {lang: 0x3a, region: 0x109, script: 0x5},
+	25: {lang: 0x3e2, region: 0x107, script: 0x20},
+	26: {lang: 0x3e2, region: 0x107, script: 0x20},
+	27: {lang: 0x139, region: 0x7c, script: 0x5b},
+	28: {lang: 0x10d, region: 0x61, script: 0x5b},
+	29: {lang: 0x139, region: 0xd7, script: 0x5b},
+	30: {lang: 0x13e, region: 0x1f, script: 0x5b},
+	31: {lang: 0x139, region: 0x9b, script: 0x5b},
+	32: {lang: 0x139, region: 0x7c, script: 0x5b},
 }
 
 // Size: 264 bytes, 33 elements
@@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{
 // regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
 // where each set holds all groupings that are directly connected in a region
 // containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
+// Size: 359 bytes, 359 elements
+var regionInclusion = [359]uint8{
 	// Entry 0 - 3F
 	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
 	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
@@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{
 	// Entry 40 - 7F
 	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
 	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34,
+	0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e,
+	0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21,
+	0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a,
+	0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c,
+	0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28,
 	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+	0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27,
+	0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22,
+	0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38,
+	0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a,
+	0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31,
+	0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d,
+	0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38,
+	0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26,
 	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+	0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36,
+	0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f,
+	0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d,
+	0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24,
+	0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b,
+	0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a,
+	0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f,
 	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
 	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+	0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33,
+	0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d,
+	0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28,
+	0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22,
+	0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31,
+	0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36,
+	0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28,
+	0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31,
 	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+	0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21,
 	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24,
+	0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
 }
 
 // regionInclusionBits is an array of bit vectors where every vector represents
@@ -3462,11 +3484,11 @@ type parentRel struct {
 
 // Size: 414 bytes, 5 elements
 var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+	0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}},
+	1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}},
+	2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}},
+	3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}},
+	4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}},
 }
 
-// Total table size 30244 bytes (29KiB); checksum: B6B15F30
+// Total table size 30466 bytes (29KiB); checksum: 7544152B
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
index ee45f494747..1153baf291c 100644
--- a/vendor/golang.org/x/text/language/match.go
+++ b/vendor/golang.org/x/text/language/match.go
@@ -434,7 +434,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher {
 	// (their canonicalization simply substitutes a different language code, but
 	// nothing else), the match confidence is Exact, otherwise it is High.
 	for i, lm := range language.AliasMap {
-		// If deprecated codes match and there is no fiddling with the script or
+		// If deprecated codes match and there is no fiddling with the script
 		// or region, we consider it an exact match.
 		conf := Exact
 		if language.AliasTypes[i] != language.Macro {
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
index 34a732b699d..a6573dcb215 100644
--- a/vendor/golang.org/x/text/language/tables.go
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -23,31 +23,31 @@ const (
 	_419 = 31
 	_BR  = 65
 	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
+	_ES  = 111
+	_GB  = 124
+	_MD  = 189
+	_PT  = 239
+	_UK  = 307
+	_US  = 310
+	_ZZ  = 358
+	_XA  = 324
+	_XC  = 326
+	_XK  = 334
 )
 const (
-	_Latn = 90
+	_Latn = 91
 	_Hani = 57
 	_Hans = 59
 	_Hant = 60
-	_Qaaa = 147
-	_Qaai = 155
-	_Qabx = 196
-	_Zinh = 252
-	_Zyyy = 257
-	_Zzzz = 258
+	_Qaaa = 149
+	_Qaai = 157
+	_Qabx = 198
+	_Zinh = 255
+	_Zyyy = 260
+	_Zzzz = 261
 )
 
-var regionToGroups = []uint8{ // 358 elements
+var regionToGroups = []uint8{ // 359 elements
 	// Entry 0 - 3F
 	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
 	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
@@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements
 	// Entry 40 - 7F
 	0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
-	0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+	0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04,
 	// Entry 80 - BF
-	0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
-	0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00,
+	0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00,
+	0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
 	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04,
 	// Entry C0 - FF
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
-	0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02,
+	0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00,
 	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
 	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00,
+	0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	// Entry 100 - 13F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
-	0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00,
+	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+	0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+	0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04,
+	0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00,
 	// Entry 140 - 17F
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
 	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-} // Size: 382 bytes
+	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 383 bytes
 
 var paradigmLocales = [][3]uint16{ // 3 elements
-	0: [3]uint16{0x139, 0x0, 0x7b},
+	0: [3]uint16{0x139, 0x0, 0x7c},
 	1: [3]uint16{0x13e, 0x0, 0x1f},
-	2: [3]uint16{0x3c0, 0x41, 0xee},
+	2: [3]uint16{0x3c0, 0x41, 0xef},
 } // Size: 42 bytes
 
 type mutualIntelligibility struct {
@@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements
 // matchScript holds pairs of scriptIDs where readers of one script
 // can typically also read the other. Each is associated with a confidence.
 var matchScript = []scriptIntelligibility{ // 26 elements
-	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5},
-	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5},
-	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa},
+	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5},
+	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5},
+	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa},
 	4:  {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa},
-	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa},
-	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa},
-	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa},
-	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa},
-	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa},
-	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa},
-	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa},
-	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa},
-	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa},
-	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa},
-	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa},
-	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa},
-	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa},
-	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa},
-	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa},
-	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa},
+	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa},
+	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa},
+	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa},
+	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa},
+	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa},
+	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa},
+	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa},
+	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa},
+	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa},
+	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa},
+	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa},
+	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa},
+	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa},
+	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa},
+	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa},
+	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa},
 	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf},
 	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13},
 } // Size: 232 bytes
@@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements
 	14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5},
 } // Size: 114 bytes
 
-// Total table size 1472 bytes (1KiB); checksum: F86C669
+// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C
diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go
index 8a7392c4a16..784bb880876 100644
--- a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go
+++ b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build go1.10
-// +build go1.10
 
 package bidirule
 
diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go
index bb0a920018c..8e1e9439552 100644
--- a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go
+++ b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go
@@ -3,7 +3,6 @@
 // license that can be found in the LICENSE file.
 
 //go:build !go1.10
-// +build !go1.10
 
 package bidirule
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
index 42fa8d72cec..d2bd71181d9 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.10 && !go1.13
-// +build go1.10,!go1.13
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
index 56a0e1ea216..f76bdca2735 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.13 && !go1.14
-// +build go1.13,!go1.14
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go
index baacf32b43c..3aa2c3bdf8c 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables12.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.14 && !go1.16
-// +build go1.14,!go1.16
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go
index f248effae17..a7137579069 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables13.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
-//go:build go1.16
-// +build go1.16
+//go:build go1.16 && !go1.21
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go
new file mode 100644
index 00000000000..f15746f7df5
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/bidi/tables15.0.0.go
@@ -0,0 +1,2042 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+//go:build go1.21
+
+package bidi
+
+// UnicodeVersion is the Unicode version from which the tables in this package are derived.
+const UnicodeVersion = "15.0.0"
+
+// xorMasks contains masks to be xor-ed with brackets to get the reverse
+// version.
+var xorMasks = []int32{ // 8 elements
+	0, 1, 6, 7, 3, 15, 29, 63,
+} // Size: 56 bytes
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return bidiValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = bidiIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupUnsafe(s []byte) uint8 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return bidiValues[c0]
+	}
+	i := bidiIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *bidiTrie) lookupString(s string) (v uint8, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return bidiValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := bidiIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = bidiIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = bidiIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *bidiTrie) lookupStringUnsafe(s string) uint8 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return bidiValues[c0]
+	}
+	i := bidiIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = bidiIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// bidiTrie. Total size: 19904 bytes (19.44 KiB). Checksum: b1f201ed2debb6c8.
+type bidiTrie struct{}
+
+func newBidiTrie(i int) *bidiTrie {
+	return &bidiTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 {
+	switch {
+	default:
+		return uint8(bidiValues[n<<6+uint32(b)])
+	}
+}
+
+// bidiValues: 259 blocks, 16576 entries, 16576 bytes
+// The third block is the zero block.
+var bidiValues = [16576]uint8{
+	// Block 0x0, offset 0x0
+	0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b,
+	0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008,
+	0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b,
+	0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b,
+	0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007,
+	0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004,
+	0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a,
+	0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006,
+	0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002,
+	0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a,
+	0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a,
+	// Block 0x1, offset 0x40
+	0x40: 0x000a,
+	0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a,
+	0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a,
+	0x7b: 0x005a,
+	0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007,
+	0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b,
+	0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b,
+	0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b,
+	0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b,
+	0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004,
+	0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a,
+	0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a,
+	0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a,
+	0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a,
+	0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a,
+	// Block 0x4, offset 0x100
+	0x117: 0x000a,
+	0x137: 0x000a,
+	// Block 0x5, offset 0x140
+	0x179: 0x000a, 0x17a: 0x000a,
+	// Block 0x6, offset 0x180
+	0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a,
+	0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a,
+	0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a,
+	0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a,
+	0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a,
+	0x19e: 0x000a, 0x19f: 0x000a,
+	0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a,
+	0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a,
+	0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a,
+	0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a,
+	0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c,
+	0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c,
+	0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c,
+	0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c,
+	0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c,
+	0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c,
+	0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c,
+	0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c,
+	0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c,
+	0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c,
+	0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c,
+	// Block 0x8, offset 0x200
+	0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c,
+	0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c,
+	0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c,
+	0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c,
+	0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c,
+	0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c,
+	0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c,
+	0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c,
+	0x234: 0x000a, 0x235: 0x000a,
+	0x23e: 0x000a,
+	// Block 0x9, offset 0x240
+	0x244: 0x000a, 0x245: 0x000a,
+	0x247: 0x000a,
+	// Block 0xa, offset 0x280
+	0x2b6: 0x000a,
+	// Block 0xb, offset 0x2c0
+	0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c,
+	0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c,
+	// Block 0xc, offset 0x300
+	0x30a: 0x000a,
+	0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c,
+	0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c,
+	0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c,
+	0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c,
+	0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c,
+	0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c,
+	0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c,
+	0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c,
+	0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c,
+	// Block 0xd, offset 0x340
+	0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c,
+	0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001,
+	0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001,
+	0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001,
+	0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001,
+	0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001,
+	0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001,
+	0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001,
+	0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001,
+	0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001,
+	0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001,
+	// Block 0xe, offset 0x380
+	0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005,
+	0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d,
+	0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c,
+	0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c,
+	0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d,
+	0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d,
+	0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d,
+	0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d,
+	0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d,
+	0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d,
+	0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d,
+	// Block 0xf, offset 0x3c0
+	0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d,
+	0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c,
+	0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c,
+	0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c,
+	0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c,
+	0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005,
+	0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005,
+	0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d,
+	0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d,
+	0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d,
+	0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d,
+	// Block 0x10, offset 0x400
+	0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d,
+	0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d,
+	0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d,
+	0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d,
+	0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d,
+	0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d,
+	0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d,
+	0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d,
+	0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d,
+	0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d,
+	0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d,
+	// Block 0x11, offset 0x440
+	0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d,
+	0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d,
+	0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d,
+	0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c,
+	0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005,
+	0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c,
+	0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a,
+	0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d,
+	0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002,
+	0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d,
+	0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d,
+	// Block 0x12, offset 0x480
+	0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d,
+	0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d,
+	0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c,
+	0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d,
+	0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d,
+	0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d,
+	0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d,
+	0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d,
+	0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c,
+	0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c,
+	0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c,
+	// Block 0x13, offset 0x4c0
+	0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c,
+	0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d,
+	0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d,
+	0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d,
+	0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d,
+	0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d,
+	0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d,
+	0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d,
+	0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d,
+	0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d,
+	0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d,
+	// Block 0x14, offset 0x500
+	0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d,
+	0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d,
+	0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d,
+	0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d,
+	0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d,
+	0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d,
+	0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c,
+	0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c,
+	0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d,
+	0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d,
+	0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d,
+	// Block 0x15, offset 0x540
+	0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001,
+	0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001,
+	0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001,
+	0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001,
+	0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001,
+	0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001,
+	0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001,
+	0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c,
+	0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001,
+	0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001,
+	0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001,
+	// Block 0x16, offset 0x580
+	0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001,
+	0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001,
+	0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001,
+	0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c,
+	0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c,
+	0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c,
+	0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c,
+	0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001,
+	0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001,
+	0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001,
+	0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001,
+	0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001,
+	0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001,
+	0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001,
+	0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001,
+	0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d,
+	0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d,
+	0x5ea: 0x000d, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001,
+	0x5f0: 0x000d, 0x5f1: 0x000d, 0x5f2: 0x000d, 0x5f3: 0x000d, 0x5f4: 0x000d, 0x5f5: 0x000d,
+	0x5f6: 0x000d, 0x5f7: 0x000d, 0x5f8: 0x000d, 0x5f9: 0x000d, 0x5fa: 0x000d, 0x5fb: 0x000d,
+	0x5fc: 0x000d, 0x5fd: 0x000d, 0x5fe: 0x000d, 0x5ff: 0x000d,
+	// Block 0x18, offset 0x600
+	0x600: 0x000d, 0x601: 0x000d, 0x602: 0x000d, 0x603: 0x000d, 0x604: 0x000d, 0x605: 0x000d,
+	0x606: 0x000d, 0x607: 0x000d, 0x608: 0x000d, 0x609: 0x000d, 0x60a: 0x000d, 0x60b: 0x000d,
+	0x60c: 0x000d, 0x60d: 0x000d, 0x60e: 0x000d, 0x60f: 0x0001, 0x610: 0x0005, 0x611: 0x0005,
+	0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001,
+	0x618: 0x000c, 0x619: 0x000c, 0x61a: 0x000c, 0x61b: 0x000c, 0x61c: 0x000c, 0x61d: 0x000c,
+	0x61e: 0x000c, 0x61f: 0x000c, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d,
+	0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d,
+	0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d,
+	0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d,
+	0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d,
+	0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d,
+	// Block 0x19, offset 0x640
+	0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d,
+	0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000c, 0x64b: 0x000c,
+	0x64c: 0x000c, 0x64d: 0x000c, 0x64e: 0x000c, 0x64f: 0x000c, 0x650: 0x000c, 0x651: 0x000c,
+	0x652: 0x000c, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c,
+	0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c,
+	0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c,
+	0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c,
+	0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c,
+	0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c,
+	0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c,
+	0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c,
+	// Block 0x1a, offset 0x680
+	0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c,
+	0x6ba: 0x000c,
+	0x6bc: 0x000c,
+	// Block 0x1b, offset 0x6c0
+	0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c,
+	0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c,
+	0x6cd: 0x000c, 0x6d1: 0x000c,
+	0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c,
+	0x6e2: 0x000c, 0x6e3: 0x000c,
+	// Block 0x1c, offset 0x700
+	0x701: 0x000c,
+	0x73c: 0x000c,
+	// Block 0x1d, offset 0x740
+	0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c,
+	0x74d: 0x000c,
+	0x762: 0x000c, 0x763: 0x000c,
+	0x772: 0x0004, 0x773: 0x0004,
+	0x77b: 0x0004,
+	0x77e: 0x000c,
+	// Block 0x1e, offset 0x780
+	0x781: 0x000c, 0x782: 0x000c,
+	0x7bc: 0x000c,
+	// Block 0x1f, offset 0x7c0
+	0x7c1: 0x000c, 0x7c2: 0x000c,
+	0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c,
+	0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c,
+	0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c,
+	// Block 0x20, offset 0x800
+	0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c,
+	0x807: 0x000c, 0x808: 0x000c,
+	0x80d: 0x000c,
+	0x822: 0x000c, 0x823: 0x000c,
+	0x831: 0x0004,
+	0x83a: 0x000c, 0x83b: 0x000c,
+	0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c,
+	// Block 0x21, offset 0x840
+	0x841: 0x000c,
+	0x87c: 0x000c, 0x87f: 0x000c,
+	// Block 0x22, offset 0x880
+	0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c,
+	0x88d: 0x000c,
+	0x895: 0x000c, 0x896: 0x000c,
+	0x8a2: 0x000c, 0x8a3: 0x000c,
+	// Block 0x23, offset 0x8c0
+	0x8c2: 0x000c,
+	// Block 0x24, offset 0x900
+	0x900: 0x000c,
+	0x90d: 0x000c,
+	0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a,
+	0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a,
+	// Block 0x25, offset 0x940
+	0x940: 0x000c, 0x944: 0x000c,
+	0x97c: 0x000c, 0x97e: 0x000c, 0x97f: 0x000c,
+	// Block 0x26, offset 0x980
+	0x980: 0x000c,
+	0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c,
+	0x98c: 0x000c, 0x98d: 0x000c,
+	0x995: 0x000c, 0x996: 0x000c,
+	0x9a2: 0x000c, 0x9a3: 0x000c,
+	0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a,
+	0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a,
+	// Block 0x27, offset 0x9c0
+	0x9cc: 0x000c, 0x9cd: 0x000c,
+	0x9e2: 0x000c, 0x9e3: 0x000c,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x000c, 0xa01: 0x000c,
+	0xa3b: 0x000c,
+	0xa3c: 0x000c,
+	// Block 0x29, offset 0xa40
+	0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c,
+	0xa4d: 0x000c,
+	0xa62: 0x000c, 0xa63: 0x000c,
+	// Block 0x2a, offset 0xa80
+	0xa81: 0x000c,
+	// Block 0x2b, offset 0xac0
+	0xaca: 0x000c,
+	0xad2: 0x000c, 0xad3: 0x000c, 0xad4: 0x000c, 0xad6: 0x000c,
+	// Block 0x2c, offset 0xb00
+	0xb31: 0x000c, 0xb34: 0x000c, 0xb35: 0x000c,
+	0xb36: 0x000c, 0xb37: 0x000c, 0xb38: 0x000c, 0xb39: 0x000c, 0xb3a: 0x000c,
+	0xb3f: 0x0004,
+	// Block 0x2d, offset 0xb40
+	0xb47: 0x000c, 0xb48: 0x000c, 0xb49: 0x000c, 0xb4a: 0x000c, 0xb4b: 0x000c,
+	0xb4c: 0x000c, 0xb4d: 0x000c, 0xb4e: 0x000c,
+	// Block 0x2e, offset 0xb80
+	0xbb1: 0x000c, 0xbb4: 0x000c, 0xbb5: 0x000c,
+	0xbb6: 0x000c, 0xbb7: 0x000c, 0xbb8: 0x000c, 0xbb9: 0x000c, 0xbba: 0x000c, 0xbbb: 0x000c,
+	0xbbc: 0x000c,
+	// Block 0x2f, offset 0xbc0
+	0xbc8: 0x000c, 0xbc9: 0x000c, 0xbca: 0x000c, 0xbcb: 0x000c,
+	0xbcc: 0x000c, 0xbcd: 0x000c, 0xbce: 0x000c,
+	// Block 0x30, offset 0xc00
+	0xc18: 0x000c, 0xc19: 0x000c,
+	0xc35: 0x000c,
+	0xc37: 0x000c, 0xc39: 0x000c, 0xc3a: 0x003a, 0xc3b: 0x002a,
+	0xc3c: 0x003a, 0xc3d: 0x002a,
+	// Block 0x31, offset 0xc40
+	0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c,
+	0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c,
+	0xc7c: 0x000c, 0xc7d: 0x000c, 0xc7e: 0x000c,
+	// Block 0x32, offset 0xc80
+	0xc80: 0x000c, 0xc81: 0x000c, 0xc82: 0x000c, 0xc83: 0x000c, 0xc84: 0x000c,
+	0xc86: 0x000c, 0xc87: 0x000c,
+	0xc8d: 0x000c, 0xc8e: 0x000c, 0xc8f: 0x000c, 0xc90: 0x000c, 0xc91: 0x000c,
+	0xc92: 0x000c, 0xc93: 0x000c, 0xc94: 0x000c, 0xc95: 0x000c, 0xc96: 0x000c, 0xc97: 0x000c,
+	0xc99: 0x000c, 0xc9a: 0x000c, 0xc9b: 0x000c, 0xc9c: 0x000c, 0xc9d: 0x000c,
+	0xc9e: 0x000c, 0xc9f: 0x000c, 0xca0: 0x000c, 0xca1: 0x000c, 0xca2: 0x000c, 0xca3: 0x000c,
+	0xca4: 0x000c, 0xca5: 0x000c, 0xca6: 0x000c, 0xca7: 0x000c, 0xca8: 0x000c, 0xca9: 0x000c,
+	0xcaa: 0x000c, 0xcab: 0x000c, 0xcac: 0x000c, 0xcad: 0x000c, 0xcae: 0x000c, 0xcaf: 0x000c,
+	0xcb0: 0x000c, 0xcb1: 0x000c, 0xcb2: 0x000c, 0xcb3: 0x000c, 0xcb4: 0x000c, 0xcb5: 0x000c,
+	0xcb6: 0x000c, 0xcb7: 0x000c, 0xcb8: 0x000c, 0xcb9: 0x000c, 0xcba: 0x000c, 0xcbb: 0x000c,
+	0xcbc: 0x000c,
+	// Block 0x33, offset 0xcc0
+	0xcc6: 0x000c,
+	// Block 0x34, offset 0xd00
+	0xd2d: 0x000c, 0xd2e: 0x000c, 0xd2f: 0x000c,
+	0xd30: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, 0xd35: 0x000c,
+	0xd36: 0x000c, 0xd37: 0x000c, 0xd39: 0x000c, 0xd3a: 0x000c,
+	0xd3d: 0x000c, 0xd3e: 0x000c,
+	// Block 0x35, offset 0xd40
+	0xd58: 0x000c, 0xd59: 0x000c,
+	0xd5e: 0x000c, 0xd5f: 0x000c, 0xd60: 0x000c,
+	0xd71: 0x000c, 0xd72: 0x000c, 0xd73: 0x000c, 0xd74: 0x000c,
+	// Block 0x36, offset 0xd80
+	0xd82: 0x000c, 0xd85: 0x000c,
+	0xd86: 0x000c,
+	0xd8d: 0x000c,
+	0xd9d: 0x000c,
+	// Block 0x37, offset 0xdc0
+	0xddd: 0x000c,
+	0xdde: 0x000c, 0xddf: 0x000c,
+	// Block 0x38, offset 0xe00
+	0xe10: 0x000a, 0xe11: 0x000a,
+	0xe12: 0x000a, 0xe13: 0x000a, 0xe14: 0x000a, 0xe15: 0x000a, 0xe16: 0x000a, 0xe17: 0x000a,
+	0xe18: 0x000a, 0xe19: 0x000a,
+	// Block 0x39, offset 0xe40
+	0xe40: 0x000a,
+	// Block 0x3a, offset 0xe80
+	0xe80: 0x0009,
+	0xe9b: 0x007a, 0xe9c: 0x006a,
+	// Block 0x3b, offset 0xec0
+	0xed2: 0x000c, 0xed3: 0x000c, 0xed4: 0x000c,
+	0xef2: 0x000c, 0xef3: 0x000c,
+	// Block 0x3c, offset 0xf00
+	0xf12: 0x000c, 0xf13: 0x000c,
+	0xf32: 0x000c, 0xf33: 0x000c,
+	// Block 0x3d, offset 0xf40
+	0xf74: 0x000c, 0xf75: 0x000c,
+	0xf77: 0x000c, 0xf78: 0x000c, 0xf79: 0x000c, 0xf7a: 0x000c, 0xf7b: 0x000c,
+	0xf7c: 0x000c, 0xf7d: 0x000c,
+	// Block 0x3e, offset 0xf80
+	0xf86: 0x000c, 0xf89: 0x000c, 0xf8a: 0x000c, 0xf8b: 0x000c,
+	0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000c, 0xf8f: 0x000c, 0xf90: 0x000c, 0xf91: 0x000c,
+	0xf92: 0x000c, 0xf93: 0x000c,
+	0xf9b: 0x0004, 0xf9d: 0x000c,
+	0xfb0: 0x000a, 0xfb1: 0x000a, 0xfb2: 0x000a, 0xfb3: 0x000a, 0xfb4: 0x000a, 0xfb5: 0x000a,
+	0xfb6: 0x000a, 0xfb7: 0x000a, 0xfb8: 0x000a, 0xfb9: 0x000a,
+	// Block 0x3f, offset 0xfc0
+	0xfc0: 0x000a, 0xfc1: 0x000a, 0xfc2: 0x000a, 0xfc3: 0x000a, 0xfc4: 0x000a, 0xfc5: 0x000a,
+	0xfc6: 0x000a, 0xfc7: 0x000a, 0xfc8: 0x000a, 0xfc9: 0x000a, 0xfca: 0x000a, 0xfcb: 0x000c,
+	0xfcc: 0x000c, 0xfcd: 0x000c, 0xfce: 0x000b, 0xfcf: 0x000c,
+	// Block 0x40, offset 0x1000
+	0x1005: 0x000c,
+	0x1006: 0x000c,
+	0x1029: 0x000c,
+	// Block 0x41, offset 0x1040
+	0x1060: 0x000c, 0x1061: 0x000c, 0x1062: 0x000c,
+	0x1067: 0x000c, 0x1068: 0x000c,
+	0x1072: 0x000c,
+	0x1079: 0x000c, 0x107a: 0x000c, 0x107b: 0x000c,
+	// Block 0x42, offset 0x1080
+	0x1080: 0x000a, 0x1084: 0x000a, 0x1085: 0x000a,
+	// Block 0x43, offset 0x10c0
+	0x10de: 0x000a, 0x10df: 0x000a, 0x10e0: 0x000a, 0x10e1: 0x000a, 0x10e2: 0x000a, 0x10e3: 0x000a,
+	0x10e4: 0x000a, 0x10e5: 0x000a, 0x10e6: 0x000a, 0x10e7: 0x000a, 0x10e8: 0x000a, 0x10e9: 0x000a,
+	0x10ea: 0x000a, 0x10eb: 0x000a, 0x10ec: 0x000a, 0x10ed: 0x000a, 0x10ee: 0x000a, 0x10ef: 0x000a,
+	0x10f0: 0x000a, 0x10f1: 0x000a, 0x10f2: 0x000a, 0x10f3: 0x000a, 0x10f4: 0x000a, 0x10f5: 0x000a,
+	0x10f6: 0x000a, 0x10f7: 0x000a, 0x10f8: 0x000a, 0x10f9: 0x000a, 0x10fa: 0x000a, 0x10fb: 0x000a,
+	0x10fc: 0x000a, 0x10fd: 0x000a, 0x10fe: 0x000a, 0x10ff: 0x000a,
+	// Block 0x44, offset 0x1100
+	0x1117: 0x000c,
+	0x1118: 0x000c, 0x111b: 0x000c,
+	// Block 0x45, offset 0x1140
+	0x1156: 0x000c,
+	0x1158: 0x000c, 0x1159: 0x000c, 0x115a: 0x000c, 0x115b: 0x000c, 0x115c: 0x000c, 0x115d: 0x000c,
+	0x115e: 0x000c, 0x1160: 0x000c, 0x1162: 0x000c,
+	0x1165: 0x000c, 0x1166: 0x000c, 0x1167: 0x000c, 0x1168: 0x000c, 0x1169: 0x000c,
+	0x116a: 0x000c, 0x116b: 0x000c, 0x116c: 0x000c,
+	0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c,
+	0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c,
+	0x117c: 0x000c, 0x117f: 0x000c,
+	// Block 0x46, offset 0x1180
+	0x11b0: 0x000c, 0x11b1: 0x000c, 0x11b2: 0x000c, 0x11b3: 0x000c, 0x11b4: 0x000c, 0x11b5: 0x000c,
+	0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, 0x11bb: 0x000c,
+	0x11bc: 0x000c, 0x11bd: 0x000c, 0x11be: 0x000c, 0x11bf: 0x000c,
+	// Block 0x47, offset 0x11c0
+	0x11c0: 0x000c, 0x11c1: 0x000c, 0x11c2: 0x000c, 0x11c3: 0x000c, 0x11c4: 0x000c, 0x11c5: 0x000c,
+	0x11c6: 0x000c, 0x11c7: 0x000c, 0x11c8: 0x000c, 0x11c9: 0x000c, 0x11ca: 0x000c, 0x11cb: 0x000c,
+	0x11cc: 0x000c, 0x11cd: 0x000c, 0x11ce: 0x000c,
+	// Block 0x48, offset 0x1200
+	0x1200: 0x000c, 0x1201: 0x000c, 0x1202: 0x000c, 0x1203: 0x000c,
+	0x1234: 0x000c,
+	0x1236: 0x000c, 0x1237: 0x000c, 0x1238: 0x000c, 0x1239: 0x000c, 0x123a: 0x000c,
+	0x123c: 0x000c,
+	// Block 0x49, offset 0x1240
+	0x1242: 0x000c,
+	0x126b: 0x000c, 0x126c: 0x000c, 0x126d: 0x000c, 0x126e: 0x000c, 0x126f: 0x000c,
+	0x1270: 0x000c, 0x1271: 0x000c, 0x1272: 0x000c, 0x1273: 0x000c,
+	// Block 0x4a, offset 0x1280
+	0x1280: 0x000c, 0x1281: 0x000c,
+	0x12a2: 0x000c, 0x12a3: 0x000c,
+	0x12a4: 0x000c, 0x12a5: 0x000c, 0x12a8: 0x000c, 0x12a9: 0x000c,
+	0x12ab: 0x000c, 0x12ac: 0x000c, 0x12ad: 0x000c,
+	// Block 0x4b, offset 0x12c0
+	0x12e6: 0x000c, 0x12e8: 0x000c, 0x12e9: 0x000c,
+	0x12ed: 0x000c, 0x12ef: 0x000c,
+	0x12f0: 0x000c, 0x12f1: 0x000c,
+	// Block 0x4c, offset 0x1300
+	0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c,
+	0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c,
+	0x1336: 0x000c, 0x1337: 0x000c,
+	// Block 0x4d, offset 0x1340
+	0x1350: 0x000c, 0x1351: 0x000c,
+	0x1352: 0x000c, 0x1354: 0x000c, 0x1355: 0x000c, 0x1356: 0x000c, 0x1357: 0x000c,
+	0x1358: 0x000c, 0x1359: 0x000c, 0x135a: 0x000c, 0x135b: 0x000c, 0x135c: 0x000c, 0x135d: 0x000c,
+	0x135e: 0x000c, 0x135f: 0x000c, 0x1360: 0x000c, 0x1362: 0x000c, 0x1363: 0x000c,
+	0x1364: 0x000c, 0x1365: 0x000c, 0x1366: 0x000c, 0x1367: 0x000c, 0x1368: 0x000c,
+	0x136d: 0x000c,
+	0x1374: 0x000c,
+	0x1378: 0x000c, 0x1379: 0x000c,
+	// Block 0x4e, offset 0x1380
+	0x13bd: 0x000a, 0x13bf: 0x000a,
+	// Block 0x4f, offset 0x13c0
+	0x13c0: 0x000a, 0x13c1: 0x000a,
+	0x13cd: 0x000a, 0x13ce: 0x000a, 0x13cf: 0x000a,
+	0x13dd: 0x000a,
+	0x13de: 0x000a, 0x13df: 0x000a,
+	0x13ed: 0x000a, 0x13ee: 0x000a, 0x13ef: 0x000a,
+	0x13fd: 0x000a, 0x13fe: 0x000a,
+	// Block 0x50, offset 0x1400
+	0x1400: 0x0009, 0x1401: 0x0009, 0x1402: 0x0009, 0x1403: 0x0009, 0x1404: 0x0009, 0x1405: 0x0009,
+	0x1406: 0x0009, 0x1407: 0x0009, 0x1408: 0x0009, 0x1409: 0x0009, 0x140a: 0x0009, 0x140b: 0x000b,
+	0x140c: 0x000b, 0x140d: 0x000b, 0x140f: 0x0001, 0x1410: 0x000a, 0x1411: 0x000a,
+	0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a,
+	0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a,
+	0x141e: 0x000a, 0x141f: 0x000a, 0x1420: 0x000a, 0x1421: 0x000a, 0x1422: 0x000a, 0x1423: 0x000a,
+	0x1424: 0x000a, 0x1425: 0x000a, 0x1426: 0x000a, 0x1427: 0x000a, 0x1428: 0x0009, 0x1429: 0x0007,
+	0x142a: 0x000e, 0x142b: 0x000e, 0x142c: 0x000e, 0x142d: 0x000e, 0x142e: 0x000e, 0x142f: 0x0006,
+	0x1430: 0x0004, 0x1431: 0x0004, 0x1432: 0x0004, 0x1433: 0x0004, 0x1434: 0x0004, 0x1435: 0x000a,
+	0x1436: 0x000a, 0x1437: 0x000a, 0x1438: 0x000a, 0x1439: 0x000a, 0x143a: 0x000a, 0x143b: 0x000a,
+	0x143c: 0x000a, 0x143d: 0x000a, 0x143e: 0x000a, 0x143f: 0x000a,
+	// Block 0x51, offset 0x1440
+	0x1440: 0x000a, 0x1441: 0x000a, 0x1442: 0x000a, 0x1443: 0x000a, 0x1444: 0x0006, 0x1445: 0x009a,
+	0x1446: 0x008a, 0x1447: 0x000a, 0x1448: 0x000a, 0x1449: 0x000a, 0x144a: 0x000a, 0x144b: 0x000a,
+	0x144c: 0x000a, 0x144d: 0x000a, 0x144e: 0x000a, 0x144f: 0x000a, 0x1450: 0x000a, 0x1451: 0x000a,
+	0x1452: 0x000a, 0x1453: 0x000a, 0x1454: 0x000a, 0x1455: 0x000a, 0x1456: 0x000a, 0x1457: 0x000a,
+	0x1458: 0x000a, 0x1459: 0x000a, 0x145a: 0x000a, 0x145b: 0x000a, 0x145c: 0x000a, 0x145d: 0x000a,
+	0x145e: 0x000a, 0x145f: 0x0009, 0x1460: 0x000b, 0x1461: 0x000b, 0x1462: 0x000b, 0x1463: 0x000b,
+	0x1464: 0x000b, 0x1465: 0x000b, 0x1466: 0x000e, 0x1467: 0x000e, 0x1468: 0x000e, 0x1469: 0x000e,
+	0x146a: 0x000b, 0x146b: 0x000b, 0x146c: 0x000b, 0x146d: 0x000b, 0x146e: 0x000b, 0x146f: 0x000b,
+	0x1470: 0x0002, 0x1474: 0x0002, 0x1475: 0x0002,
+	0x1476: 0x0002, 0x1477: 0x0002, 0x1478: 0x0002, 0x1479: 0x0002, 0x147a: 0x0003, 0x147b: 0x0003,
+	0x147c: 0x000a, 0x147d: 0x009a, 0x147e: 0x008a,
+	// Block 0x52, offset 0x1480
+	0x1480: 0x0002, 0x1481: 0x0002, 0x1482: 0x0002, 0x1483: 0x0002, 0x1484: 0x0002, 0x1485: 0x0002,
+	0x1486: 0x0002, 0x1487: 0x0002, 0x1488: 0x0002, 0x1489: 0x0002, 0x148a: 0x0003, 0x148b: 0x0003,
+	0x148c: 0x000a, 0x148d: 0x009a, 0x148e: 0x008a,
+	0x14a0: 0x0004, 0x14a1: 0x0004, 0x14a2: 0x0004, 0x14a3: 0x0004,
+	0x14a4: 0x0004, 0x14a5: 0x0004, 0x14a6: 0x0004, 0x14a7: 0x0004, 0x14a8: 0x0004, 0x14a9: 0x0004,
+	0x14aa: 0x0004, 0x14ab: 0x0004, 0x14ac: 0x0004, 0x14ad: 0x0004, 0x14ae: 0x0004, 0x14af: 0x0004,
+	0x14b0: 0x0004, 0x14b1: 0x0004, 0x14b2: 0x0004, 0x14b3: 0x0004, 0x14b4: 0x0004, 0x14b5: 0x0004,
+	0x14b6: 0x0004, 0x14b7: 0x0004, 0x14b8: 0x0004, 0x14b9: 0x0004, 0x14ba: 0x0004, 0x14bb: 0x0004,
+	0x14bc: 0x0004, 0x14bd: 0x0004, 0x14be: 0x0004, 0x14bf: 0x0004,
+	// Block 0x53, offset 0x14c0
+	0x14c0: 0x0004, 0x14c1: 0x0004, 0x14c2: 0x0004, 0x14c3: 0x0004, 0x14c4: 0x0004, 0x14c5: 0x0004,
+	0x14c6: 0x0004, 0x14c7: 0x0004, 0x14c8: 0x0004, 0x14c9: 0x0004, 0x14ca: 0x0004, 0x14cb: 0x0004,
+	0x14cc: 0x0004, 0x14cd: 0x0004, 0x14ce: 0x0004, 0x14cf: 0x0004, 0x14d0: 0x000c, 0x14d1: 0x000c,
+	0x14d2: 0x000c, 0x14d3: 0x000c, 0x14d4: 0x000c, 0x14d5: 0x000c, 0x14d6: 0x000c, 0x14d7: 0x000c,
+	0x14d8: 0x000c, 0x14d9: 0x000c, 0x14da: 0x000c, 0x14db: 0x000c, 0x14dc: 0x000c, 0x14dd: 0x000c,
+	0x14de: 0x000c, 0x14df: 0x000c, 0x14e0: 0x000c, 0x14e1: 0x000c, 0x14e2: 0x000c, 0x14e3: 0x000c,
+	0x14e4: 0x000c, 0x14e5: 0x000c, 0x14e6: 0x000c, 0x14e7: 0x000c, 0x14e8: 0x000c, 0x14e9: 0x000c,
+	0x14ea: 0x000c, 0x14eb: 0x000c, 0x14ec: 0x000c, 0x14ed: 0x000c, 0x14ee: 0x000c, 0x14ef: 0x000c,
+	0x14f0: 0x000c,
+	// Block 0x54, offset 0x1500
+	0x1500: 0x000a, 0x1501: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, 0x1505: 0x000a,
+	0x1506: 0x000a, 0x1508: 0x000a, 0x1509: 0x000a,
+	0x1514: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a,
+	0x1518: 0x000a,
+	0x151e: 0x000a, 0x151f: 0x000a, 0x1520: 0x000a, 0x1521: 0x000a, 0x1522: 0x000a, 0x1523: 0x000a,
+	0x1525: 0x000a, 0x1527: 0x000a, 0x1529: 0x000a,
+	0x152e: 0x0004,
+	0x153a: 0x000a, 0x153b: 0x000a,
+	// Block 0x55, offset 0x1540
+	0x1540: 0x000a, 0x1541: 0x000a, 0x1542: 0x000a, 0x1543: 0x000a, 0x1544: 0x000a,
+	0x154a: 0x000a, 0x154b: 0x000a,
+	0x154c: 0x000a, 0x154d: 0x000a, 0x1550: 0x000a, 0x1551: 0x000a,
+	0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a,
+	0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a,
+	0x155e: 0x000a, 0x155f: 0x000a,
+	// Block 0x56, offset 0x1580
+	0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a,
+	0x1590: 0x000a, 0x1591: 0x000a,
+	0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a,
+	0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a,
+	0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a,
+	0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a,
+	0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a,
+	0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a,
+	0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a,
+	0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a,
+	// Block 0x57, offset 0x15c0
+	0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a,
+	0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a,
+	0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a,
+	0x15d2: 0x000a, 0x15d3: 0x000a, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a,
+	0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a,
+	0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a,
+	0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a,
+	0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a,
+	0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a,
+	0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a,
+	0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a,
+	// Block 0x58, offset 0x1600
+	0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a,
+	0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x000a, 0x1609: 0x000a, 0x160a: 0x000a, 0x160b: 0x000a,
+	0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a,
+	0x1612: 0x0003, 0x1613: 0x0004, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a,
+	0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a,
+	0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a,
+	0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x000a,
+	0x162a: 0x000a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a,
+	0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a,
+	0x1636: 0x000a, 0x1637: 0x000a, 0x1638: 0x000a, 0x1639: 0x000a, 0x163a: 0x000a, 0x163b: 0x000a,
+	0x163c: 0x000a, 0x163d: 0x000a, 0x163e: 0x000a, 0x163f: 0x000a,
+	// Block 0x59, offset 0x1640
+	0x1640: 0x000a, 0x1641: 0x000a, 0x1642: 0x000a, 0x1643: 0x000a, 0x1644: 0x000a, 0x1645: 0x000a,
+	0x1646: 0x000a, 0x1647: 0x000a, 0x1648: 0x003a, 0x1649: 0x002a, 0x164a: 0x003a, 0x164b: 0x002a,
+	0x164c: 0x000a, 0x164d: 0x000a, 0x164e: 0x000a, 0x164f: 0x000a, 0x1650: 0x000a, 0x1651: 0x000a,
+	0x1652: 0x000a, 0x1653: 0x000a, 0x1654: 0x000a, 0x1655: 0x000a, 0x1656: 0x000a, 0x1657: 0x000a,
+	0x1658: 0x000a, 0x1659: 0x000a, 0x165a: 0x000a, 0x165b: 0x000a, 0x165c: 0x000a, 0x165d: 0x000a,
+	0x165e: 0x000a, 0x165f: 0x000a, 0x1660: 0x000a, 0x1661: 0x000a, 0x1662: 0x000a, 0x1663: 0x000a,
+	0x1664: 0x000a, 0x1665: 0x000a, 0x1666: 0x000a, 0x1667: 0x000a, 0x1668: 0x000a, 0x1669: 0x009a,
+	0x166a: 0x008a, 0x166b: 0x000a, 0x166c: 0x000a, 0x166d: 0x000a, 0x166e: 0x000a, 0x166f: 0x000a,
+	0x1670: 0x000a, 0x1671: 0x000a, 0x1672: 0x000a, 0x1673: 0x000a, 0x1674: 0x000a, 0x1675: 0x000a,
+	// Block 0x5a, offset 0x1680
+	0x16bb: 0x000a,
+	0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a,
+	// Block 0x5b, offset 0x16c0
+	0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a,
+	0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a,
+	0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a,
+	0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a,
+	0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a,
+	0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a,
+	0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a,
+	0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a,
+	0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a,
+	0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a,
+	0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, 0x16ff: 0x000a,
+	// Block 0x5c, offset 0x1700
+	0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a,
+	0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a,
+	0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a,
+	0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a,
+	0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a,
+	0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a,
+	0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a,
+	// Block 0x5d, offset 0x1740
+	0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a,
+	0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a,
+	0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a,
+	0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a,
+	0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a,
+	0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a,
+	0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a,
+	0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a,
+	// Block 0x5e, offset 0x1780
+	0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a,
+	0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002,
+	0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002,
+	0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002,
+	0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002,
+	// Block 0x5f, offset 0x17c0
+	0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a,
+	0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a,
+	0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a,
+	0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a,
+	// Block 0x60, offset 0x1800
+	0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a,
+	0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a,
+	0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a,
+	0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a,
+	0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a,
+	0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a,
+	0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a,
+	0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a,
+	0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a,
+	0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a,
+	0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a,
+	// Block 0x61, offset 0x1840
+	0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a,
+	0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a,
+	0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a,
+	0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a,
+	0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a,
+	0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a,
+	0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a,
+	0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a,
+	0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a,
+	0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a,
+	0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a,
+	// Block 0x62, offset 0x1880
+	0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a,
+	0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a,
+	0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a,
+	0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a,
+	0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a,
+	0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a,
+	0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a,
+	0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a,
+	0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a,
+	0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a,
+	0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a,
+	// Block 0x63, offset 0x18c0
+	0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a,
+	0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a,
+	0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a,
+	0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba,
+	0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a,
+	0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a,
+	0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a,
+	0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a,
+	0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a,
+	0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a,
+	0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a,
+	// Block 0x64, offset 0x1900
+	0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a,
+	0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a,
+	0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a,
+	0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a,
+	0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a,
+	0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a,
+	0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a,
+	0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a,
+	0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a,
+	0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a,
+	0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a,
+	// Block 0x65, offset 0x1940
+	0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a,
+	0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a,
+	0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a,
+	0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a,
+	0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a,
+	0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a,
+	0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a,
+	0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a,
+	0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a,
+	0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a,
+	0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a,
+	// Block 0x66, offset 0x1980
+	0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a,
+	0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a,
+	0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a,
+	0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1997: 0x000a,
+	0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a,
+	0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a,
+	0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a,
+	0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a,
+	0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a,
+	0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a,
+	0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a,
+	// Block 0x67, offset 0x19c0
+	0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a,
+	0x19ea: 0x000a, 0x19ef: 0x000c,
+	0x19f0: 0x000c, 0x19f1: 0x000c,
+	0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a,
+	0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a,
+	// Block 0x68, offset 0x1a00
+	0x1a3f: 0x000c,
+	// Block 0x69, offset 0x1a40
+	0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c,
+	0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c,
+	0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c,
+	0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c,
+	0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c,
+	0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c,
+	// Block 0x6a, offset 0x1a80
+	0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a,
+	0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a,
+	0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a,
+	0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a,
+	0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a,
+	0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a,
+	0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a,
+	0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a,
+	0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a,
+	0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a,
+	0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a,
+	// Block 0x6b, offset 0x1ac0
+	0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a,
+	0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a,
+	0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a,
+	0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x009a, 0x1ad6: 0x008a, 0x1ad7: 0x00ba,
+	0x1ad8: 0x00aa, 0x1ad9: 0x009a, 0x1ada: 0x008a, 0x1adb: 0x007a, 0x1adc: 0x006a, 0x1add: 0x000a,
+	// Block 0x6c, offset 0x1b00
+	0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a,
+	0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a,
+	0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a,
+	0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a,
+	0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a,
+	0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a,
+	0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a,
+	0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a,
+	0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a,
+	0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a,
+	0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a,
+	// Block 0x6d, offset 0x1b40
+	0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a,
+	0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a,
+	0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a,
+	0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a,
+	0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a,
+	0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a,
+	0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a,
+	0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a,
+	0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a,
+	// Block 0x6e, offset 0x1b80
+	0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a,
+	0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a,
+	0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a,
+	0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a,
+	0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a,
+	0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a,
+	// Block 0x6f, offset 0x1bc0
+	0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a,
+	0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a,
+	0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a,
+	0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a,
+	0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a,
+	0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a,
+	0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c,
+	0x1bf0: 0x000a,
+	0x1bf6: 0x000a, 0x1bf7: 0x000a,
+	0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a,
+	// Block 0x70, offset 0x1c00
+	0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a,
+	0x1c20: 0x000a,
+	// Block 0x71, offset 0x1c40
+	0x1c7b: 0x000a,
+	// Block 0x72, offset 0x1c80
+	0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a,
+	0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a,
+	0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a,
+	0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a,
+	0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a,
+	0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a,
+	// Block 0x73, offset 0x1cc0
+	0x1cdd: 0x000a,
+	0x1cde: 0x000a,
+	// Block 0x74, offset 0x1d00
+	0x1d10: 0x000a, 0x1d11: 0x000a,
+	0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a,
+	0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a,
+	0x1d1e: 0x000a, 0x1d1f: 0x000a,
+	0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a,
+	// Block 0x75, offset 0x1d40
+	0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a,
+	0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a,
+	0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a,
+	// Block 0x76, offset 0x1d80
+	0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a,
+	// Block 0x77, offset 0x1dc0
+	0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a,
+	// Block 0x78, offset 0x1e00
+	0x1e1e: 0x000a, 0x1e1f: 0x000a,
+	0x1e3f: 0x000a,
+	// Block 0x79, offset 0x1e40
+	0x1e50: 0x000a, 0x1e51: 0x000a,
+	0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a,
+	0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a,
+	0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a,
+	0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a,
+	0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a,
+	0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a,
+	0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a,
+	0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a,
+	// Block 0x7a, offset 0x1e80
+	0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a,
+	0x1e86: 0x000a,
+	// Block 0x7b, offset 0x1ec0
+	0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a,
+	// Block 0x7c, offset 0x1f00
+	0x1f2f: 0x000c,
+	0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c,
+	0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c,
+	0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a,
+	// Block 0x7d, offset 0x1f40
+	0x1f5e: 0x000c, 0x1f5f: 0x000c,
+	// Block 0x7e, offset 0x1f80
+	0x1fb0: 0x000c, 0x1fb1: 0x000c,
+	// Block 0x7f, offset 0x1fc0
+	0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a,
+	0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a,
+	0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a,
+	0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a,
+	0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a,
+	0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a,
+	// Block 0x80, offset 0x2000
+	0x2008: 0x000a,
+	// Block 0x81, offset 0x2040
+	0x2042: 0x000c,
+	0x2046: 0x000c, 0x204b: 0x000c,
+	0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a,
+	0x206a: 0x000a, 0x206b: 0x000a, 0x206c: 0x000c,
+	0x2078: 0x0004, 0x2079: 0x0004,
+	// Block 0x82, offset 0x2080
+	0x20b4: 0x000a, 0x20b5: 0x000a,
+	0x20b6: 0x000a, 0x20b7: 0x000a,
+	// Block 0x83, offset 0x20c0
+	0x20c4: 0x000c, 0x20c5: 0x000c,
+	0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c,
+	0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c,
+	0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c,
+	0x20f0: 0x000c, 0x20f1: 0x000c,
+	0x20ff: 0x000c,
+	// Block 0x84, offset 0x2100
+	0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c,
+	0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c,
+	// Block 0x85, offset 0x2140
+	0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c,
+	0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c,
+	// Block 0x86, offset 0x2180
+	0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c,
+	0x21b3: 0x000c,
+	0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c,
+	0x21bc: 0x000c, 0x21bd: 0x000c,
+	// Block 0x87, offset 0x21c0
+	0x21e5: 0x000c,
+	// Block 0x88, offset 0x2200
+	0x2229: 0x000c,
+	0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c,
+	0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c,
+	0x2236: 0x000c,
+	// Block 0x89, offset 0x2240
+	0x2243: 0x000c,
+	0x224c: 0x000c,
+	0x227c: 0x000c,
+	// Block 0x8a, offset 0x2280
+	0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c,
+	0x22b7: 0x000c, 0x22b8: 0x000c,
+	0x22be: 0x000c, 0x22bf: 0x000c,
+	// Block 0x8b, offset 0x22c0
+	0x22c1: 0x000c,
+	0x22ec: 0x000c, 0x22ed: 0x000c,
+	0x22f6: 0x000c,
+	// Block 0x8c, offset 0x2300
+	0x232a: 0x000a, 0x232b: 0x000a,
+	// Block 0x8d, offset 0x2340
+	0x2365: 0x000c, 0x2368: 0x000c,
+	0x236d: 0x000c,
+	// Block 0x8e, offset 0x2380
+	0x239d: 0x0001,
+	0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001,
+	0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003,
+	0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001,
+	0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001,
+	0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001,
+	0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001,
+	// Block 0x8f, offset 0x23c0
+	0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001,
+	0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001,
+	0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d,
+	0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d,
+	0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d,
+	0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d,
+	0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d,
+	0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d,
+	0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d,
+	0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d,
+	0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d,
+	// Block 0x90, offset 0x2400
+	0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d,
+	0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d,
+	0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d,
+	0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d,
+	0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d,
+	0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d,
+	0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d,
+	0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d,
+	0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d,
+	0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d,
+	0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a,
+	// Block 0x91, offset 0x2440
+	0x2440: 0x000a, 0x2441: 0x000a, 0x2442: 0x000a, 0x2443: 0x000a, 0x2444: 0x000a, 0x2445: 0x000a,
+	0x2446: 0x000a, 0x2447: 0x000a, 0x2448: 0x000a, 0x2449: 0x000a, 0x244a: 0x000a, 0x244b: 0x000a,
+	0x244c: 0x000a, 0x244d: 0x000a, 0x244e: 0x000a, 0x244f: 0x000a, 0x2450: 0x000d, 0x2451: 0x000d,
+	0x2452: 0x000d, 0x2453: 0x000d, 0x2454: 0x000d, 0x2455: 0x000d, 0x2456: 0x000d, 0x2457: 0x000d,
+	0x2458: 0x000d, 0x2459: 0x000d, 0x245a: 0x000d, 0x245b: 0x000d, 0x245c: 0x000d, 0x245d: 0x000d,
+	0x245e: 0x000d, 0x245f: 0x000d, 0x2460: 0x000d, 0x2461: 0x000d, 0x2462: 0x000d, 0x2463: 0x000d,
+	0x2464: 0x000d, 0x2465: 0x000d, 0x2466: 0x000d, 0x2467: 0x000d, 0x2468: 0x000d, 0x2469: 0x000d,
+	0x246a: 0x000d, 0x246b: 0x000d, 0x246c: 0x000d, 0x246d: 0x000d, 0x246e: 0x000d, 0x246f: 0x000d,
+	0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d,
+	0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d,
+	0x247c: 0x000d, 0x247d: 0x000d, 0x247e: 0x000d, 0x247f: 0x000d,
+	// Block 0x92, offset 0x2480
+	0x2480: 0x000d, 0x2481: 0x000d, 0x2482: 0x000d, 0x2483: 0x000d, 0x2484: 0x000d, 0x2485: 0x000d,
+	0x2486: 0x000d, 0x2487: 0x000d, 0x2488: 0x000d, 0x2489: 0x000d, 0x248a: 0x000d, 0x248b: 0x000d,
+	0x248c: 0x000d, 0x248d: 0x000d, 0x248e: 0x000d, 0x248f: 0x000a, 0x2490: 0x000b, 0x2491: 0x000b,
+	0x2492: 0x000b, 0x2493: 0x000b, 0x2494: 0x000b, 0x2495: 0x000b, 0x2496: 0x000b, 0x2497: 0x000b,
+	0x2498: 0x000b, 0x2499: 0x000b, 0x249a: 0x000b, 0x249b: 0x000b, 0x249c: 0x000b, 0x249d: 0x000b,
+	0x249e: 0x000b, 0x249f: 0x000b, 0x24a0: 0x000b, 0x24a1: 0x000b, 0x24a2: 0x000b, 0x24a3: 0x000b,
+	0x24a4: 0x000b, 0x24a5: 0x000b, 0x24a6: 0x000b, 0x24a7: 0x000b, 0x24a8: 0x000b, 0x24a9: 0x000b,
+	0x24aa: 0x000b, 0x24ab: 0x000b, 0x24ac: 0x000b, 0x24ad: 0x000b, 0x24ae: 0x000b, 0x24af: 0x000b,
+	0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d,
+	0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d,
+	0x24bc: 0x000d, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a,
+	// Block 0x93, offset 0x24c0
+	0x24c0: 0x000c, 0x24c1: 0x000c, 0x24c2: 0x000c, 0x24c3: 0x000c, 0x24c4: 0x000c, 0x24c5: 0x000c,
+	0x24c6: 0x000c, 0x24c7: 0x000c, 0x24c8: 0x000c, 0x24c9: 0x000c, 0x24ca: 0x000c, 0x24cb: 0x000c,
+	0x24cc: 0x000c, 0x24cd: 0x000c, 0x24ce: 0x000c, 0x24cf: 0x000c, 0x24d0: 0x000a, 0x24d1: 0x000a,
+	0x24d2: 0x000a, 0x24d3: 0x000a, 0x24d4: 0x000a, 0x24d5: 0x000a, 0x24d6: 0x000a, 0x24d7: 0x000a,
+	0x24d8: 0x000a, 0x24d9: 0x000a,
+	0x24e0: 0x000c, 0x24e1: 0x000c, 0x24e2: 0x000c, 0x24e3: 0x000c,
+	0x24e4: 0x000c, 0x24e5: 0x000c, 0x24e6: 0x000c, 0x24e7: 0x000c, 0x24e8: 0x000c, 0x24e9: 0x000c,
+	0x24ea: 0x000c, 0x24eb: 0x000c, 0x24ec: 0x000c, 0x24ed: 0x000c, 0x24ee: 0x000c, 0x24ef: 0x000c,
+	0x24f0: 0x000a, 0x24f1: 0x000a, 0x24f2: 0x000a, 0x24f3: 0x000a, 0x24f4: 0x000a, 0x24f5: 0x000a,
+	0x24f6: 0x000a, 0x24f7: 0x000a, 0x24f8: 0x000a, 0x24f9: 0x000a, 0x24fa: 0x000a, 0x24fb: 0x000a,
+	0x24fc: 0x000a, 0x24fd: 0x000a, 0x24fe: 0x000a, 0x24ff: 0x000a,
+	// Block 0x94, offset 0x2500
+	0x2500: 0x000a, 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x000a, 0x2504: 0x000a, 0x2505: 0x000a,
+	0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x000a, 0x2509: 0x000a, 0x250a: 0x000a, 0x250b: 0x000a,
+	0x250c: 0x000a, 0x250d: 0x000a, 0x250e: 0x000a, 0x250f: 0x000a, 0x2510: 0x0006, 0x2511: 0x000a,
+	0x2512: 0x0006, 0x2514: 0x000a, 0x2515: 0x0006, 0x2516: 0x000a, 0x2517: 0x000a,
+	0x2518: 0x000a, 0x2519: 0x009a, 0x251a: 0x008a, 0x251b: 0x007a, 0x251c: 0x006a, 0x251d: 0x009a,
+	0x251e: 0x008a, 0x251f: 0x0004, 0x2520: 0x000a, 0x2521: 0x000a, 0x2522: 0x0003, 0x2523: 0x0003,
+	0x2524: 0x000a, 0x2525: 0x000a, 0x2526: 0x000a, 0x2528: 0x000a, 0x2529: 0x0004,
+	0x252a: 0x0004, 0x252b: 0x000a,
+	0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d,
+	0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d,
+	0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000d,
+	// Block 0x95, offset 0x2540
+	0x2540: 0x000d, 0x2541: 0x000d, 0x2542: 0x000d, 0x2543: 0x000d, 0x2544: 0x000d, 0x2545: 0x000d,
+	0x2546: 0x000d, 0x2547: 0x000d, 0x2548: 0x000d, 0x2549: 0x000d, 0x254a: 0x000d, 0x254b: 0x000d,
+	0x254c: 0x000d, 0x254d: 0x000d, 0x254e: 0x000d, 0x254f: 0x000d, 0x2550: 0x000d, 0x2551: 0x000d,
+	0x2552: 0x000d, 0x2553: 0x000d, 0x2554: 0x000d, 0x2555: 0x000d, 0x2556: 0x000d, 0x2557: 0x000d,
+	0x2558: 0x000d, 0x2559: 0x000d, 0x255a: 0x000d, 0x255b: 0x000d, 0x255c: 0x000d, 0x255d: 0x000d,
+	0x255e: 0x000d, 0x255f: 0x000d, 0x2560: 0x000d, 0x2561: 0x000d, 0x2562: 0x000d, 0x2563: 0x000d,
+	0x2564: 0x000d, 0x2565: 0x000d, 0x2566: 0x000d, 0x2567: 0x000d, 0x2568: 0x000d, 0x2569: 0x000d,
+	0x256a: 0x000d, 0x256b: 0x000d, 0x256c: 0x000d, 0x256d: 0x000d, 0x256e: 0x000d, 0x256f: 0x000d,
+	0x2570: 0x000d, 0x2571: 0x000d, 0x2572: 0x000d, 0x2573: 0x000d, 0x2574: 0x000d, 0x2575: 0x000d,
+	0x2576: 0x000d, 0x2577: 0x000d, 0x2578: 0x000d, 0x2579: 0x000d, 0x257a: 0x000d, 0x257b: 0x000d,
+	0x257c: 0x000d, 0x257d: 0x000d, 0x257e: 0x000d, 0x257f: 0x000b,
+	// Block 0x96, offset 0x2580
+	0x2581: 0x000a, 0x2582: 0x000a, 0x2583: 0x0004, 0x2584: 0x0004, 0x2585: 0x0004,
+	0x2586: 0x000a, 0x2587: 0x000a, 0x2588: 0x003a, 0x2589: 0x002a, 0x258a: 0x000a, 0x258b: 0x0003,
+	0x258c: 0x0006, 0x258d: 0x0003, 0x258e: 0x0006, 0x258f: 0x0006, 0x2590: 0x0002, 0x2591: 0x0002,
+	0x2592: 0x0002, 0x2593: 0x0002, 0x2594: 0x0002, 0x2595: 0x0002, 0x2596: 0x0002, 0x2597: 0x0002,
+	0x2598: 0x0002, 0x2599: 0x0002, 0x259a: 0x0006, 0x259b: 0x000a, 0x259c: 0x000a, 0x259d: 0x000a,
+	0x259e: 0x000a, 0x259f: 0x000a, 0x25a0: 0x000a,
+	0x25bb: 0x005a,
+	0x25bc: 0x000a, 0x25bd: 0x004a, 0x25be: 0x000a, 0x25bf: 0x000a,
+	// Block 0x97, offset 0x25c0
+	0x25c0: 0x000a,
+	0x25db: 0x005a, 0x25dc: 0x000a, 0x25dd: 0x004a,
+	0x25de: 0x000a, 0x25df: 0x00fa, 0x25e0: 0x00ea, 0x25e1: 0x000a, 0x25e2: 0x003a, 0x25e3: 0x002a,
+	0x25e4: 0x000a, 0x25e5: 0x000a,
+	// Block 0x98, offset 0x2600
+	0x2620: 0x0004, 0x2621: 0x0004, 0x2622: 0x000a, 0x2623: 0x000a,
+	0x2624: 0x000a, 0x2625: 0x0004, 0x2626: 0x0004, 0x2628: 0x000a, 0x2629: 0x000a,
+	0x262a: 0x000a, 0x262b: 0x000a, 0x262c: 0x000a, 0x262d: 0x000a, 0x262e: 0x000a,
+	0x2630: 0x000b, 0x2631: 0x000b, 0x2632: 0x000b, 0x2633: 0x000b, 0x2634: 0x000b, 0x2635: 0x000b,
+	0x2636: 0x000b, 0x2637: 0x000b, 0x2638: 0x000b, 0x2639: 0x000a, 0x263a: 0x000a, 0x263b: 0x000a,
+	0x263c: 0x000a, 0x263d: 0x000a, 0x263e: 0x000b, 0x263f: 0x000b,
+	// Block 0x99, offset 0x2640
+	0x2641: 0x000a,
+	// Block 0x9a, offset 0x2680
+	0x2680: 0x000a, 0x2681: 0x000a, 0x2682: 0x000a, 0x2683: 0x000a, 0x2684: 0x000a, 0x2685: 0x000a,
+	0x2686: 0x000a, 0x2687: 0x000a, 0x2688: 0x000a, 0x2689: 0x000a, 0x268a: 0x000a, 0x268b: 0x000a,
+	0x268c: 0x000a, 0x2690: 0x000a, 0x2691: 0x000a,
+	0x2692: 0x000a, 0x2693: 0x000a, 0x2694: 0x000a, 0x2695: 0x000a, 0x2696: 0x000a, 0x2697: 0x000a,
+	0x2698: 0x000a, 0x2699: 0x000a, 0x269a: 0x000a, 0x269b: 0x000a, 0x269c: 0x000a,
+	0x26a0: 0x000a,
+	// Block 0x9b, offset 0x26c0
+	0x26fd: 0x000c,
+	// Block 0x9c, offset 0x2700
+	0x2720: 0x000c, 0x2721: 0x0002, 0x2722: 0x0002, 0x2723: 0x0002,
+	0x2724: 0x0002, 0x2725: 0x0002, 0x2726: 0x0002, 0x2727: 0x0002, 0x2728: 0x0002, 0x2729: 0x0002,
+	0x272a: 0x0002, 0x272b: 0x0002, 0x272c: 0x0002, 0x272d: 0x0002, 0x272e: 0x0002, 0x272f: 0x0002,
+	0x2730: 0x0002, 0x2731: 0x0002, 0x2732: 0x0002, 0x2733: 0x0002, 0x2734: 0x0002, 0x2735: 0x0002,
+	0x2736: 0x0002, 0x2737: 0x0002, 0x2738: 0x0002, 0x2739: 0x0002, 0x273a: 0x0002, 0x273b: 0x0002,
+	// Block 0x9d, offset 0x2740
+	0x2776: 0x000c, 0x2777: 0x000c, 0x2778: 0x000c, 0x2779: 0x000c, 0x277a: 0x000c,
+	// Block 0x9e, offset 0x2780
+	0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001,
+	0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001,
+	0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001,
+	0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001,
+	0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001,
+	0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001,
+	0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001,
+	0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001,
+	0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001,
+	0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001,
+	0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001,
+	// Block 0x9f, offset 0x27c0
+	0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001,
+	0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001,
+	0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001,
+	0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001,
+	0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001,
+	0x27de: 0x0001, 0x27df: 0x000a, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001,
+	0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001,
+	0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001,
+	0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001,
+	0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001,
+	0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001,
+	// Block 0xa0, offset 0x2800
+	0x2800: 0x0001, 0x2801: 0x000c, 0x2802: 0x000c, 0x2803: 0x000c, 0x2804: 0x0001, 0x2805: 0x000c,
+	0x2806: 0x000c, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001,
+	0x280c: 0x000c, 0x280d: 0x000c, 0x280e: 0x000c, 0x280f: 0x000c, 0x2810: 0x0001, 0x2811: 0x0001,
+	0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001,
+	0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001,
+	0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001,
+	0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001,
+	0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001,
+	0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001,
+	0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x000c, 0x2839: 0x000c, 0x283a: 0x000c, 0x283b: 0x0001,
+	0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x000c,
+	// Block 0xa1, offset 0x2840
+	0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001,
+	0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001,
+	0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001,
+	0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001,
+	0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001,
+	0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001,
+	0x2864: 0x0001, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001,
+	0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001,
+	0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001,
+	0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x0001, 0x287a: 0x0001, 0x287b: 0x0001,
+	0x287c: 0x0001, 0x287d: 0x0001, 0x287e: 0x0001, 0x287f: 0x0001,
+	// Block 0xa2, offset 0x2880
+	0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001,
+	0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001,
+	0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001,
+	0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001,
+	0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001,
+	0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0001, 0x28a1: 0x0001, 0x28a2: 0x0001, 0x28a3: 0x0001,
+	0x28a4: 0x0001, 0x28a5: 0x0001, 0x28a6: 0x0001, 0x28a7: 0x0001, 0x28a8: 0x0001, 0x28a9: 0x0001,
+	0x28aa: 0x0001, 0x28ab: 0x0001, 0x28ac: 0x0001, 0x28ad: 0x0001, 0x28ae: 0x0001, 0x28af: 0x0001,
+	0x28b0: 0x0001, 0x28b1: 0x0001, 0x28b2: 0x0001, 0x28b3: 0x0001, 0x28b4: 0x0001, 0x28b5: 0x0001,
+	0x28b6: 0x0001, 0x28b7: 0x0001, 0x28b8: 0x0001, 0x28b9: 0x000a, 0x28ba: 0x000a, 0x28bb: 0x000a,
+	0x28bc: 0x000a, 0x28bd: 0x000a, 0x28be: 0x000a, 0x28bf: 0x000a,
+	// Block 0xa3, offset 0x28c0
+	0x28c0: 0x000d, 0x28c1: 0x000d, 0x28c2: 0x000d, 0x28c3: 0x000d, 0x28c4: 0x000d, 0x28c5: 0x000d,
+	0x28c6: 0x000d, 0x28c7: 0x000d, 0x28c8: 0x000d, 0x28c9: 0x000d, 0x28ca: 0x000d, 0x28cb: 0x000d,
+	0x28cc: 0x000d, 0x28cd: 0x000d, 0x28ce: 0x000d, 0x28cf: 0x000d, 0x28d0: 0x000d, 0x28d1: 0x000d,
+	0x28d2: 0x000d, 0x28d3: 0x000d, 0x28d4: 0x000d, 0x28d5: 0x000d, 0x28d6: 0x000d, 0x28d7: 0x000d,
+	0x28d8: 0x000d, 0x28d9: 0x000d, 0x28da: 0x000d, 0x28db: 0x000d, 0x28dc: 0x000d, 0x28dd: 0x000d,
+	0x28de: 0x000d, 0x28df: 0x000d, 0x28e0: 0x000d, 0x28e1: 0x000d, 0x28e2: 0x000d, 0x28e3: 0x000d,
+	0x28e4: 0x000c, 0x28e5: 0x000c, 0x28e6: 0x000c, 0x28e7: 0x000c, 0x28e8: 0x0001, 0x28e9: 0x0001,
+	0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001,
+	0x28f0: 0x0005, 0x28f1: 0x0005, 0x28f2: 0x0005, 0x28f3: 0x0005, 0x28f4: 0x0005, 0x28f5: 0x0005,
+	0x28f6: 0x0005, 0x28f7: 0x0005, 0x28f8: 0x0005, 0x28f9: 0x0005, 0x28fa: 0x0001, 0x28fb: 0x0001,
+	0x28fc: 0x0001, 0x28fd: 0x0001, 0x28fe: 0x0001, 0x28ff: 0x0001,
+	// Block 0xa4, offset 0x2900
+	0x2900: 0x0001, 0x2901: 0x0001, 0x2902: 0x0001, 0x2903: 0x0001, 0x2904: 0x0001, 0x2905: 0x0001,
+	0x2906: 0x0001, 0x2907: 0x0001, 0x2908: 0x0001, 0x2909: 0x0001, 0x290a: 0x0001, 0x290b: 0x0001,
+	0x290c: 0x0001, 0x290d: 0x0001, 0x290e: 0x0001, 0x290f: 0x0001, 0x2910: 0x0001, 0x2911: 0x0001,
+	0x2912: 0x0001, 0x2913: 0x0001, 0x2914: 0x0001, 0x2915: 0x0001, 0x2916: 0x0001, 0x2917: 0x0001,
+	0x2918: 0x0001, 0x2919: 0x0001, 0x291a: 0x0001, 0x291b: 0x0001, 0x291c: 0x0001, 0x291d: 0x0001,
+	0x291e: 0x0001, 0x291f: 0x0001, 0x2920: 0x0005, 0x2921: 0x0005, 0x2922: 0x0005, 0x2923: 0x0005,
+	0x2924: 0x0005, 0x2925: 0x0005, 0x2926: 0x0005, 0x2927: 0x0005, 0x2928: 0x0005, 0x2929: 0x0005,
+	0x292a: 0x0005, 0x292b: 0x0005, 0x292c: 0x0005, 0x292d: 0x0005, 0x292e: 0x0005, 0x292f: 0x0005,
+	0x2930: 0x0005, 0x2931: 0x0005, 0x2932: 0x0005, 0x2933: 0x0005, 0x2934: 0x0005, 0x2935: 0x0005,
+	0x2936: 0x0005, 0x2937: 0x0005, 0x2938: 0x0005, 0x2939: 0x0005, 0x293a: 0x0005, 0x293b: 0x0005,
+	0x293c: 0x0005, 0x293d: 0x0005, 0x293e: 0x0005, 0x293f: 0x0001,
+	// Block 0xa5, offset 0x2940
+	0x2940: 0x0001, 0x2941: 0x0001, 0x2942: 0x0001, 0x2943: 0x0001, 0x2944: 0x0001, 0x2945: 0x0001,
+	0x2946: 0x0001, 0x2947: 0x0001, 0x2948: 0x0001, 0x2949: 0x0001, 0x294a: 0x0001, 0x294b: 0x0001,
+	0x294c: 0x0001, 0x294d: 0x0001, 0x294e: 0x0001, 0x294f: 0x0001, 0x2950: 0x0001, 0x2951: 0x0001,
+	0x2952: 0x0001, 0x2953: 0x0001, 0x2954: 0x0001, 0x2955: 0x0001, 0x2956: 0x0001, 0x2957: 0x0001,
+	0x2958: 0x0001, 0x2959: 0x0001, 0x295a: 0x0001, 0x295b: 0x0001, 0x295c: 0x0001, 0x295d: 0x0001,
+	0x295e: 0x0001, 0x295f: 0x0001, 0x2960: 0x0001, 0x2961: 0x0001, 0x2962: 0x0001, 0x2963: 0x0001,
+	0x2964: 0x0001, 0x2965: 0x0001, 0x2966: 0x0001, 0x2967: 0x0001, 0x2968: 0x0001, 0x2969: 0x0001,
+	0x296a: 0x0001, 0x296b: 0x000c, 0x296c: 0x000c, 0x296d: 0x0001, 0x296e: 0x0001, 0x296f: 0x0001,
+	0x2970: 0x0001, 0x2971: 0x0001, 0x2972: 0x0001, 0x2973: 0x0001, 0x2974: 0x0001, 0x2975: 0x0001,
+	0x2976: 0x0001, 0x2977: 0x0001, 0x2978: 0x0001, 0x2979: 0x0001, 0x297a: 0x0001, 0x297b: 0x0001,
+	0x297c: 0x0001, 0x297d: 0x0001, 0x297e: 0x0001, 0x297f: 0x0001,
+	// Block 0xa6, offset 0x2980
+	0x2980: 0x0001, 0x2981: 0x0001, 0x2982: 0x0001, 0x2983: 0x0001, 0x2984: 0x0001, 0x2985: 0x0001,
+	0x2986: 0x0001, 0x2987: 0x0001, 0x2988: 0x0001, 0x2989: 0x0001, 0x298a: 0x0001, 0x298b: 0x0001,
+	0x298c: 0x0001, 0x298d: 0x0001, 0x298e: 0x0001, 0x298f: 0x0001, 0x2990: 0x0001, 0x2991: 0x0001,
+	0x2992: 0x0001, 0x2993: 0x0001, 0x2994: 0x0001, 0x2995: 0x0001, 0x2996: 0x0001, 0x2997: 0x0001,
+	0x2998: 0x0001, 0x2999: 0x0001, 0x299a: 0x0001, 0x299b: 0x0001, 0x299c: 0x0001, 0x299d: 0x0001,
+	0x299e: 0x0001, 0x299f: 0x0001, 0x29a0: 0x0001, 0x29a1: 0x0001, 0x29a2: 0x0001, 0x29a3: 0x0001,
+	0x29a4: 0x0001, 0x29a5: 0x0001, 0x29a6: 0x0001, 0x29a7: 0x0001, 0x29a8: 0x0001, 0x29a9: 0x0001,
+	0x29aa: 0x0001, 0x29ab: 0x0001, 0x29ac: 0x0001, 0x29ad: 0x0001, 0x29ae: 0x0001, 0x29af: 0x0001,
+	0x29b0: 0x0001, 0x29b1: 0x0001, 0x29b2: 0x0001, 0x29b3: 0x0001, 0x29b4: 0x0001, 0x29b5: 0x0001,
+	0x29b6: 0x0001, 0x29b7: 0x0001, 0x29b8: 0x0001, 0x29b9: 0x0001, 0x29ba: 0x0001, 0x29bb: 0x0001,
+	0x29bc: 0x0001, 0x29bd: 0x000c, 0x29be: 0x000c, 0x29bf: 0x000c,
+	// Block 0xa7, offset 0x29c0
+	0x29c0: 0x0001, 0x29c1: 0x0001, 0x29c2: 0x0001, 0x29c3: 0x0001, 0x29c4: 0x0001, 0x29c5: 0x0001,
+	0x29c6: 0x0001, 0x29c7: 0x0001, 0x29c8: 0x0001, 0x29c9: 0x0001, 0x29ca: 0x0001, 0x29cb: 0x0001,
+	0x29cc: 0x0001, 0x29cd: 0x0001, 0x29ce: 0x0001, 0x29cf: 0x0001, 0x29d0: 0x0001, 0x29d1: 0x0001,
+	0x29d2: 0x0001, 0x29d3: 0x0001, 0x29d4: 0x0001, 0x29d5: 0x0001, 0x29d6: 0x0001, 0x29d7: 0x0001,
+	0x29d8: 0x0001, 0x29d9: 0x0001, 0x29da: 0x0001, 0x29db: 0x0001, 0x29dc: 0x0001, 0x29dd: 0x0001,
+	0x29de: 0x0001, 0x29df: 0x0001, 0x29e0: 0x0001, 0x29e1: 0x0001, 0x29e2: 0x0001, 0x29e3: 0x0001,
+	0x29e4: 0x0001, 0x29e5: 0x0001, 0x29e6: 0x0001, 0x29e7: 0x0001, 0x29e8: 0x0001, 0x29e9: 0x0001,
+	0x29ea: 0x0001, 0x29eb: 0x0001, 0x29ec: 0x0001, 0x29ed: 0x0001, 0x29ee: 0x0001, 0x29ef: 0x0001,
+	0x29f0: 0x000d, 0x29f1: 0x000d, 0x29f2: 0x000d, 0x29f3: 0x000d, 0x29f4: 0x000d, 0x29f5: 0x000d,
+	0x29f6: 0x000d, 0x29f7: 0x000d, 0x29f8: 0x000d, 0x29f9: 0x000d, 0x29fa: 0x000d, 0x29fb: 0x000d,
+	0x29fc: 0x000d, 0x29fd: 0x000d, 0x29fe: 0x000d, 0x29ff: 0x000d,
+	// Block 0xa8, offset 0x2a00
+	0x2a00: 0x000d, 0x2a01: 0x000d, 0x2a02: 0x000d, 0x2a03: 0x000d, 0x2a04: 0x000d, 0x2a05: 0x000d,
+	0x2a06: 0x000c, 0x2a07: 0x000c, 0x2a08: 0x000c, 0x2a09: 0x000c, 0x2a0a: 0x000c, 0x2a0b: 0x000c,
+	0x2a0c: 0x000c, 0x2a0d: 0x000c, 0x2a0e: 0x000c, 0x2a0f: 0x000c, 0x2a10: 0x000c, 0x2a11: 0x000d,
+	0x2a12: 0x000d, 0x2a13: 0x000d, 0x2a14: 0x000d, 0x2a15: 0x000d, 0x2a16: 0x000d, 0x2a17: 0x000d,
+	0x2a18: 0x000d, 0x2a19: 0x000d, 0x2a1a: 0x0001, 0x2a1b: 0x0001, 0x2a1c: 0x0001, 0x2a1d: 0x0001,
+	0x2a1e: 0x0001, 0x2a1f: 0x0001, 0x2a20: 0x0001, 0x2a21: 0x0001, 0x2a22: 0x0001, 0x2a23: 0x0001,
+	0x2a24: 0x0001, 0x2a25: 0x0001, 0x2a26: 0x0001, 0x2a27: 0x0001, 0x2a28: 0x0001, 0x2a29: 0x0001,
+	0x2a2a: 0x0001, 0x2a2b: 0x0001, 0x2a2c: 0x0001, 0x2a2d: 0x0001, 0x2a2e: 0x0001, 0x2a2f: 0x0001,
+	0x2a30: 0x0001, 0x2a31: 0x0001, 0x2a32: 0x0001, 0x2a33: 0x0001, 0x2a34: 0x0001, 0x2a35: 0x0001,
+	0x2a36: 0x0001, 0x2a37: 0x0001, 0x2a38: 0x0001, 0x2a39: 0x0001, 0x2a3a: 0x0001, 0x2a3b: 0x0001,
+	0x2a3c: 0x0001, 0x2a3d: 0x0001, 0x2a3e: 0x0001, 0x2a3f: 0x0001,
+	// Block 0xa9, offset 0x2a40
+	0x2a40: 0x0001, 0x2a41: 0x0001, 0x2a42: 0x000c, 0x2a43: 0x000c, 0x2a44: 0x000c, 0x2a45: 0x000c,
+	0x2a46: 0x0001, 0x2a47: 0x0001, 0x2a48: 0x0001, 0x2a49: 0x0001, 0x2a4a: 0x0001, 0x2a4b: 0x0001,
+	0x2a4c: 0x0001, 0x2a4d: 0x0001, 0x2a4e: 0x0001, 0x2a4f: 0x0001, 0x2a50: 0x0001, 0x2a51: 0x0001,
+	0x2a52: 0x0001, 0x2a53: 0x0001, 0x2a54: 0x0001, 0x2a55: 0x0001, 0x2a56: 0x0001, 0x2a57: 0x0001,
+	0x2a58: 0x0001, 0x2a59: 0x0001, 0x2a5a: 0x0001, 0x2a5b: 0x0001, 0x2a5c: 0x0001, 0x2a5d: 0x0001,
+	0x2a5e: 0x0001, 0x2a5f: 0x0001, 0x2a60: 0x0001, 0x2a61: 0x0001, 0x2a62: 0x0001, 0x2a63: 0x0001,
+	0x2a64: 0x0001, 0x2a65: 0x0001, 0x2a66: 0x0001, 0x2a67: 0x0001, 0x2a68: 0x0001, 0x2a69: 0x0001,
+	0x2a6a: 0x0001, 0x2a6b: 0x0001, 0x2a6c: 0x0001, 0x2a6d: 0x0001, 0x2a6e: 0x0001, 0x2a6f: 0x0001,
+	0x2a70: 0x0001, 0x2a71: 0x0001, 0x2a72: 0x0001, 0x2a73: 0x0001, 0x2a74: 0x0001, 0x2a75: 0x0001,
+	0x2a76: 0x0001, 0x2a77: 0x0001, 0x2a78: 0x0001, 0x2a79: 0x0001, 0x2a7a: 0x0001, 0x2a7b: 0x0001,
+	0x2a7c: 0x0001, 0x2a7d: 0x0001, 0x2a7e: 0x0001, 0x2a7f: 0x0001,
+	// Block 0xaa, offset 0x2a80
+	0x2a81: 0x000c,
+	0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c,
+	0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, 0x2abf: 0x000c,
+	// Block 0xab, offset 0x2ac0
+	0x2ac0: 0x000c, 0x2ac1: 0x000c, 0x2ac2: 0x000c, 0x2ac3: 0x000c, 0x2ac4: 0x000c, 0x2ac5: 0x000c,
+	0x2ac6: 0x000c,
+	0x2ad2: 0x000a, 0x2ad3: 0x000a, 0x2ad4: 0x000a, 0x2ad5: 0x000a, 0x2ad6: 0x000a, 0x2ad7: 0x000a,
+	0x2ad8: 0x000a, 0x2ad9: 0x000a, 0x2ada: 0x000a, 0x2adb: 0x000a, 0x2adc: 0x000a, 0x2add: 0x000a,
+	0x2ade: 0x000a, 0x2adf: 0x000a, 0x2ae0: 0x000a, 0x2ae1: 0x000a, 0x2ae2: 0x000a, 0x2ae3: 0x000a,
+	0x2ae4: 0x000a, 0x2ae5: 0x000a,
+	0x2af0: 0x000c, 0x2af3: 0x000c, 0x2af4: 0x000c,
+	0x2aff: 0x000c,
+	// Block 0xac, offset 0x2b00
+	0x2b00: 0x000c, 0x2b01: 0x000c,
+	0x2b33: 0x000c, 0x2b34: 0x000c, 0x2b35: 0x000c,
+	0x2b36: 0x000c, 0x2b39: 0x000c, 0x2b3a: 0x000c,
+	// Block 0xad, offset 0x2b40
+	0x2b40: 0x000c, 0x2b41: 0x000c, 0x2b42: 0x000c,
+	0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c,
+	0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6d: 0x000c, 0x2b6e: 0x000c, 0x2b6f: 0x000c,
+	0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c,
+	// Block 0xae, offset 0x2b80
+	0x2bb3: 0x000c,
+	// Block 0xaf, offset 0x2bc0
+	0x2bc0: 0x000c, 0x2bc1: 0x000c,
+	0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c,
+	0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c,
+	// Block 0xb0, offset 0x2c00
+	0x2c09: 0x000c, 0x2c0a: 0x000c, 0x2c0b: 0x000c,
+	0x2c0c: 0x000c, 0x2c0f: 0x000c,
+	// Block 0xb1, offset 0x2c40
+	0x2c6f: 0x000c,
+	0x2c70: 0x000c, 0x2c71: 0x000c, 0x2c74: 0x000c,
+	0x2c76: 0x000c, 0x2c77: 0x000c,
+	0x2c7e: 0x000c,
+	// Block 0xb2, offset 0x2c80
+	0x2c9f: 0x000c, 0x2ca3: 0x000c,
+	0x2ca4: 0x000c, 0x2ca5: 0x000c, 0x2ca6: 0x000c, 0x2ca7: 0x000c, 0x2ca8: 0x000c, 0x2ca9: 0x000c,
+	0x2caa: 0x000c,
+	// Block 0xb3, offset 0x2cc0
+	0x2cc0: 0x000c,
+	0x2ce6: 0x000c, 0x2ce7: 0x000c, 0x2ce8: 0x000c, 0x2ce9: 0x000c,
+	0x2cea: 0x000c, 0x2ceb: 0x000c, 0x2cec: 0x000c,
+	0x2cf0: 0x000c, 0x2cf1: 0x000c, 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c,
+	// Block 0xb4, offset 0x2d00
+	0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, 0x2d3b: 0x000c,
+	0x2d3c: 0x000c, 0x2d3d: 0x000c, 0x2d3e: 0x000c, 0x2d3f: 0x000c,
+	// Block 0xb5, offset 0x2d40
+	0x2d42: 0x000c, 0x2d43: 0x000c, 0x2d44: 0x000c,
+	0x2d46: 0x000c,
+	0x2d5e: 0x000c,
+	// Block 0xb6, offset 0x2d80
+	0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c,
+	0x2db6: 0x000c, 0x2db7: 0x000c, 0x2db8: 0x000c, 0x2dba: 0x000c,
+	0x2dbf: 0x000c,
+	// Block 0xb7, offset 0x2dc0
+	0x2dc0: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c,
+	// Block 0xb8, offset 0x2e00
+	0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c,
+	0x2e3c: 0x000c, 0x2e3d: 0x000c, 0x2e3f: 0x000c,
+	// Block 0xb9, offset 0x2e40
+	0x2e40: 0x000c,
+	0x2e5c: 0x000c, 0x2e5d: 0x000c,
+	// Block 0xba, offset 0x2e80
+	0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c,
+	0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c,
+	0x2ebd: 0x000c, 0x2ebf: 0x000c,
+	// Block 0xbb, offset 0x2ec0
+	0x2ec0: 0x000c,
+	0x2ee0: 0x000a, 0x2ee1: 0x000a, 0x2ee2: 0x000a, 0x2ee3: 0x000a,
+	0x2ee4: 0x000a, 0x2ee5: 0x000a, 0x2ee6: 0x000a, 0x2ee7: 0x000a, 0x2ee8: 0x000a, 0x2ee9: 0x000a,
+	0x2eea: 0x000a, 0x2eeb: 0x000a, 0x2eec: 0x000a,
+	// Block 0xbc, offset 0x2f00
+	0x2f2b: 0x000c, 0x2f2d: 0x000c,
+	0x2f30: 0x000c, 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c,
+	0x2f37: 0x000c,
+	// Block 0xbd, offset 0x2f40
+	0x2f5d: 0x000c,
+	0x2f5e: 0x000c, 0x2f5f: 0x000c, 0x2f62: 0x000c, 0x2f63: 0x000c,
+	0x2f64: 0x000c, 0x2f65: 0x000c, 0x2f67: 0x000c, 0x2f68: 0x000c, 0x2f69: 0x000c,
+	0x2f6a: 0x000c, 0x2f6b: 0x000c,
+	// Block 0xbe, offset 0x2f80
+	0x2faf: 0x000c,
+	0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, 0x2fb5: 0x000c,
+	0x2fb6: 0x000c, 0x2fb7: 0x000c, 0x2fb9: 0x000c, 0x2fba: 0x000c,
+	// Block 0xbf, offset 0x2fc0
+	0x2ffb: 0x000c,
+	0x2ffc: 0x000c, 0x2ffe: 0x000c,
+	// Block 0xc0, offset 0x3000
+	0x3003: 0x000c,
+	// Block 0xc1, offset 0x3040
+	0x3054: 0x000c, 0x3055: 0x000c, 0x3056: 0x000c, 0x3057: 0x000c,
+	0x305a: 0x000c, 0x305b: 0x000c,
+	0x3060: 0x000c,
+	// Block 0xc2, offset 0x3080
+	0x3081: 0x000c, 0x3082: 0x000c, 0x3083: 0x000c, 0x3084: 0x000c, 0x3085: 0x000c,
+	0x3086: 0x000c, 0x3089: 0x000c, 0x308a: 0x000c,
+	0x30b3: 0x000c, 0x30b4: 0x000c, 0x30b5: 0x000c,
+	0x30b6: 0x000c, 0x30b7: 0x000c, 0x30b8: 0x000c, 0x30bb: 0x000c,
+	0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c,
+	// Block 0xc3, offset 0x30c0
+	0x30c7: 0x000c,
+	0x30d1: 0x000c,
+	0x30d2: 0x000c, 0x30d3: 0x000c, 0x30d4: 0x000c, 0x30d5: 0x000c, 0x30d6: 0x000c,
+	0x30d9: 0x000c, 0x30da: 0x000c, 0x30db: 0x000c,
+	// Block 0xc4, offset 0x3100
+	0x310a: 0x000c, 0x310b: 0x000c,
+	0x310c: 0x000c, 0x310d: 0x000c, 0x310e: 0x000c, 0x310f: 0x000c, 0x3110: 0x000c, 0x3111: 0x000c,
+	0x3112: 0x000c, 0x3113: 0x000c, 0x3114: 0x000c, 0x3115: 0x000c, 0x3116: 0x000c,
+	0x3118: 0x000c, 0x3119: 0x000c,
+	// Block 0xc5, offset 0x3140
+	0x3170: 0x000c, 0x3171: 0x000c, 0x3172: 0x000c, 0x3173: 0x000c, 0x3174: 0x000c, 0x3175: 0x000c,
+	0x3176: 0x000c, 0x3178: 0x000c, 0x3179: 0x000c, 0x317a: 0x000c, 0x317b: 0x000c,
+	0x317c: 0x000c, 0x317d: 0x000c,
+	// Block 0xc6, offset 0x3180
+	0x3192: 0x000c, 0x3193: 0x000c, 0x3194: 0x000c, 0x3195: 0x000c, 0x3196: 0x000c, 0x3197: 0x000c,
+	0x3198: 0x000c, 0x3199: 0x000c, 0x319a: 0x000c, 0x319b: 0x000c, 0x319c: 0x000c, 0x319d: 0x000c,
+	0x319e: 0x000c, 0x319f: 0x000c, 0x31a0: 0x000c, 0x31a1: 0x000c, 0x31a2: 0x000c, 0x31a3: 0x000c,
+	0x31a4: 0x000c, 0x31a5: 0x000c, 0x31a6: 0x000c, 0x31a7: 0x000c,
+	0x31aa: 0x000c, 0x31ab: 0x000c, 0x31ac: 0x000c, 0x31ad: 0x000c, 0x31ae: 0x000c, 0x31af: 0x000c,
+	0x31b0: 0x000c, 0x31b2: 0x000c, 0x31b3: 0x000c, 0x31b5: 0x000c,
+	0x31b6: 0x000c,
+	// Block 0xc7, offset 0x31c0
+	0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c,
+	0x31f6: 0x000c, 0x31fa: 0x000c,
+	0x31fc: 0x000c, 0x31fd: 0x000c, 0x31ff: 0x000c,
+	// Block 0xc8, offset 0x3200
+	0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c,
+	0x3207: 0x000c,
+	// Block 0xc9, offset 0x3240
+	0x3250: 0x000c, 0x3251: 0x000c,
+	0x3255: 0x000c, 0x3257: 0x000c,
+	// Block 0xca, offset 0x3280
+	0x32b3: 0x000c, 0x32b4: 0x000c,
+	// Block 0xcb, offset 0x32c0
+	0x32c0: 0x000c, 0x32c1: 0x000c,
+	0x32f6: 0x000c, 0x32f7: 0x000c, 0x32f8: 0x000c, 0x32f9: 0x000c, 0x32fa: 0x000c,
+	// Block 0xcc, offset 0x3300
+	0x3300: 0x000c, 0x3302: 0x000c,
+	// Block 0xcd, offset 0x3340
+	0x3355: 0x000a, 0x3356: 0x000a, 0x3357: 0x000a,
+	0x3358: 0x000a, 0x3359: 0x000a, 0x335a: 0x000a, 0x335b: 0x000a, 0x335c: 0x000a, 0x335d: 0x0004,
+	0x335e: 0x0004, 0x335f: 0x0004, 0x3360: 0x0004, 0x3361: 0x000a, 0x3362: 0x000a, 0x3363: 0x000a,
+	0x3364: 0x000a, 0x3365: 0x000a, 0x3366: 0x000a, 0x3367: 0x000a, 0x3368: 0x000a, 0x3369: 0x000a,
+	0x336a: 0x000a, 0x336b: 0x000a, 0x336c: 0x000a, 0x336d: 0x000a, 0x336e: 0x000a, 0x336f: 0x000a,
+	0x3370: 0x000a, 0x3371: 0x000a,
+	// Block 0xce, offset 0x3380
+	0x3380: 0x000c,
+	0x3387: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c,
+	0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c,
+	0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c,
+	// Block 0xcf, offset 0x33c0
+	0x33f0: 0x000c, 0x33f1: 0x000c, 0x33f2: 0x000c, 0x33f3: 0x000c, 0x33f4: 0x000c,
+	// Block 0xd0, offset 0x3400
+	0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c,
+	0x3436: 0x000c,
+	// Block 0xd1, offset 0x3440
+	0x344f: 0x000c,
+	// Block 0xd2, offset 0x3480
+	0x348f: 0x000c, 0x3490: 0x000c, 0x3491: 0x000c,
+	0x3492: 0x000c,
+	// Block 0xd3, offset 0x34c0
+	0x34e2: 0x000a,
+	0x34e4: 0x000c,
+	// Block 0xd4, offset 0x3500
+	0x351d: 0x000c,
+	0x351e: 0x000c, 0x3520: 0x000b, 0x3521: 0x000b, 0x3522: 0x000b, 0x3523: 0x000b,
+	// Block 0xd5, offset 0x3540
+	0x3540: 0x000c, 0x3541: 0x000c, 0x3542: 0x000c, 0x3543: 0x000c, 0x3544: 0x000c, 0x3545: 0x000c,
+	0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x000c,
+	0x354c: 0x000c, 0x354d: 0x000c, 0x354e: 0x000c, 0x354f: 0x000c, 0x3550: 0x000c, 0x3551: 0x000c,
+	0x3552: 0x000c, 0x3553: 0x000c, 0x3554: 0x000c, 0x3555: 0x000c, 0x3556: 0x000c, 0x3557: 0x000c,
+	0x3558: 0x000c, 0x3559: 0x000c, 0x355a: 0x000c, 0x355b: 0x000c, 0x355c: 0x000c, 0x355d: 0x000c,
+	0x355e: 0x000c, 0x355f: 0x000c, 0x3560: 0x000c, 0x3561: 0x000c, 0x3562: 0x000c, 0x3563: 0x000c,
+	0x3564: 0x000c, 0x3565: 0x000c, 0x3566: 0x000c, 0x3567: 0x000c, 0x3568: 0x000c, 0x3569: 0x000c,
+	0x356a: 0x000c, 0x356b: 0x000c, 0x356c: 0x000c, 0x356d: 0x000c,
+	0x3570: 0x000c, 0x3571: 0x000c, 0x3572: 0x000c, 0x3573: 0x000c, 0x3574: 0x000c, 0x3575: 0x000c,
+	0x3576: 0x000c, 0x3577: 0x000c, 0x3578: 0x000c, 0x3579: 0x000c, 0x357a: 0x000c, 0x357b: 0x000c,
+	0x357c: 0x000c, 0x357d: 0x000c, 0x357e: 0x000c, 0x357f: 0x000c,
+	// Block 0xd6, offset 0x3580
+	0x3580: 0x000c, 0x3581: 0x000c, 0x3582: 0x000c, 0x3583: 0x000c, 0x3584: 0x000c, 0x3585: 0x000c,
+	0x3586: 0x000c,
+	// Block 0xd7, offset 0x35c0
+	0x35e7: 0x000c, 0x35e8: 0x000c, 0x35e9: 0x000c,
+	0x35f3: 0x000b, 0x35f4: 0x000b, 0x35f5: 0x000b,
+	0x35f6: 0x000b, 0x35f7: 0x000b, 0x35f8: 0x000b, 0x35f9: 0x000b, 0x35fa: 0x000b, 0x35fb: 0x000c,
+	0x35fc: 0x000c, 0x35fd: 0x000c, 0x35fe: 0x000c, 0x35ff: 0x000c,
+	// Block 0xd8, offset 0x3600
+	0x3600: 0x000c, 0x3601: 0x000c, 0x3602: 0x000c, 0x3605: 0x000c,
+	0x3606: 0x000c, 0x3607: 0x000c, 0x3608: 0x000c, 0x3609: 0x000c, 0x360a: 0x000c, 0x360b: 0x000c,
+	0x362a: 0x000c, 0x362b: 0x000c, 0x362c: 0x000c, 0x362d: 0x000c,
+	// Block 0xd9, offset 0x3640
+	0x3669: 0x000a,
+	0x366a: 0x000a,
+	// Block 0xda, offset 0x3680
+	0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000c, 0x3683: 0x000c, 0x3684: 0x000c, 0x3685: 0x000a,
+	// Block 0xdb, offset 0x36c0
+	0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a,
+	0x36c6: 0x000a, 0x36c7: 0x000a, 0x36c8: 0x000a, 0x36c9: 0x000a, 0x36ca: 0x000a, 0x36cb: 0x000a,
+	0x36cc: 0x000a, 0x36cd: 0x000a, 0x36ce: 0x000a, 0x36cf: 0x000a, 0x36d0: 0x000a, 0x36d1: 0x000a,
+	0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a,
+	// Block 0xdc, offset 0x3700
+	0x371b: 0x000a,
+	// Block 0xdd, offset 0x3740
+	0x3755: 0x000a,
+	// Block 0xde, offset 0x3780
+	0x378f: 0x000a,
+	// Block 0xdf, offset 0x37c0
+	0x37c9: 0x000a,
+	// Block 0xe0, offset 0x3800
+	0x3803: 0x000a,
+	0x380e: 0x0002, 0x380f: 0x0002, 0x3810: 0x0002, 0x3811: 0x0002,
+	0x3812: 0x0002, 0x3813: 0x0002, 0x3814: 0x0002, 0x3815: 0x0002, 0x3816: 0x0002, 0x3817: 0x0002,
+	0x3818: 0x0002, 0x3819: 0x0002, 0x381a: 0x0002, 0x381b: 0x0002, 0x381c: 0x0002, 0x381d: 0x0002,
+	0x381e: 0x0002, 0x381f: 0x0002, 0x3820: 0x0002, 0x3821: 0x0002, 0x3822: 0x0002, 0x3823: 0x0002,
+	0x3824: 0x0002, 0x3825: 0x0002, 0x3826: 0x0002, 0x3827: 0x0002, 0x3828: 0x0002, 0x3829: 0x0002,
+	0x382a: 0x0002, 0x382b: 0x0002, 0x382c: 0x0002, 0x382d: 0x0002, 0x382e: 0x0002, 0x382f: 0x0002,
+	0x3830: 0x0002, 0x3831: 0x0002, 0x3832: 0x0002, 0x3833: 0x0002, 0x3834: 0x0002, 0x3835: 0x0002,
+	0x3836: 0x0002, 0x3837: 0x0002, 0x3838: 0x0002, 0x3839: 0x0002, 0x383a: 0x0002, 0x383b: 0x0002,
+	0x383c: 0x0002, 0x383d: 0x0002, 0x383e: 0x0002, 0x383f: 0x0002,
+	// Block 0xe1, offset 0x3840
+	0x3840: 0x000c, 0x3841: 0x000c, 0x3842: 0x000c, 0x3843: 0x000c, 0x3844: 0x000c, 0x3845: 0x000c,
+	0x3846: 0x000c, 0x3847: 0x000c, 0x3848: 0x000c, 0x3849: 0x000c, 0x384a: 0x000c, 0x384b: 0x000c,
+	0x384c: 0x000c, 0x384d: 0x000c, 0x384e: 0x000c, 0x384f: 0x000c, 0x3850: 0x000c, 0x3851: 0x000c,
+	0x3852: 0x000c, 0x3853: 0x000c, 0x3854: 0x000c, 0x3855: 0x000c, 0x3856: 0x000c, 0x3857: 0x000c,
+	0x3858: 0x000c, 0x3859: 0x000c, 0x385a: 0x000c, 0x385b: 0x000c, 0x385c: 0x000c, 0x385d: 0x000c,
+	0x385e: 0x000c, 0x385f: 0x000c, 0x3860: 0x000c, 0x3861: 0x000c, 0x3862: 0x000c, 0x3863: 0x000c,
+	0x3864: 0x000c, 0x3865: 0x000c, 0x3866: 0x000c, 0x3867: 0x000c, 0x3868: 0x000c, 0x3869: 0x000c,
+	0x386a: 0x000c, 0x386b: 0x000c, 0x386c: 0x000c, 0x386d: 0x000c, 0x386e: 0x000c, 0x386f: 0x000c,
+	0x3870: 0x000c, 0x3871: 0x000c, 0x3872: 0x000c, 0x3873: 0x000c, 0x3874: 0x000c, 0x3875: 0x000c,
+	0x3876: 0x000c, 0x387b: 0x000c,
+	0x387c: 0x000c, 0x387d: 0x000c, 0x387e: 0x000c, 0x387f: 0x000c,
+	// Block 0xe2, offset 0x3880
+	0x3880: 0x000c, 0x3881: 0x000c, 0x3882: 0x000c, 0x3883: 0x000c, 0x3884: 0x000c, 0x3885: 0x000c,
+	0x3886: 0x000c, 0x3887: 0x000c, 0x3888: 0x000c, 0x3889: 0x000c, 0x388a: 0x000c, 0x388b: 0x000c,
+	0x388c: 0x000c, 0x388d: 0x000c, 0x388e: 0x000c, 0x388f: 0x000c, 0x3890: 0x000c, 0x3891: 0x000c,
+	0x3892: 0x000c, 0x3893: 0x000c, 0x3894: 0x000c, 0x3895: 0x000c, 0x3896: 0x000c, 0x3897: 0x000c,
+	0x3898: 0x000c, 0x3899: 0x000c, 0x389a: 0x000c, 0x389b: 0x000c, 0x389c: 0x000c, 0x389d: 0x000c,
+	0x389e: 0x000c, 0x389f: 0x000c, 0x38a0: 0x000c, 0x38a1: 0x000c, 0x38a2: 0x000c, 0x38a3: 0x000c,
+	0x38a4: 0x000c, 0x38a5: 0x000c, 0x38a6: 0x000c, 0x38a7: 0x000c, 0x38a8: 0x000c, 0x38a9: 0x000c,
+	0x38aa: 0x000c, 0x38ab: 0x000c, 0x38ac: 0x000c,
+	0x38b5: 0x000c,
+	// Block 0xe3, offset 0x38c0
+	0x38c4: 0x000c,
+	0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c,
+	0x38de: 0x000c, 0x38df: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c,
+	0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c,
+	0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c,
+	// Block 0xe4, offset 0x3900
+	0x3900: 0x000c, 0x3901: 0x000c, 0x3902: 0x000c, 0x3903: 0x000c, 0x3904: 0x000c, 0x3905: 0x000c,
+	0x3906: 0x000c, 0x3908: 0x000c, 0x3909: 0x000c, 0x390a: 0x000c, 0x390b: 0x000c,
+	0x390c: 0x000c, 0x390d: 0x000c, 0x390e: 0x000c, 0x390f: 0x000c, 0x3910: 0x000c, 0x3911: 0x000c,
+	0x3912: 0x000c, 0x3913: 0x000c, 0x3914: 0x000c, 0x3915: 0x000c, 0x3916: 0x000c, 0x3917: 0x000c,
+	0x3918: 0x000c, 0x391b: 0x000c, 0x391c: 0x000c, 0x391d: 0x000c,
+	0x391e: 0x000c, 0x391f: 0x000c, 0x3920: 0x000c, 0x3921: 0x000c, 0x3923: 0x000c,
+	0x3924: 0x000c, 0x3926: 0x000c, 0x3927: 0x000c, 0x3928: 0x000c, 0x3929: 0x000c,
+	0x392a: 0x000c,
+	// Block 0xe5, offset 0x3940
+	0x396e: 0x000c,
+	// Block 0xe6, offset 0x3980
+	0x39ac: 0x000c, 0x39ad: 0x000c, 0x39ae: 0x000c, 0x39af: 0x000c,
+	0x39bf: 0x0004,
+	// Block 0xe7, offset 0x39c0
+	0x39ec: 0x000c, 0x39ed: 0x000c, 0x39ee: 0x000c, 0x39ef: 0x000c,
+	// Block 0xe8, offset 0x3a00
+	0x3a00: 0x0001, 0x3a01: 0x0001, 0x3a02: 0x0001, 0x3a03: 0x0001, 0x3a04: 0x0001, 0x3a05: 0x0001,
+	0x3a06: 0x0001, 0x3a07: 0x0001, 0x3a08: 0x0001, 0x3a09: 0x0001, 0x3a0a: 0x0001, 0x3a0b: 0x0001,
+	0x3a0c: 0x0001, 0x3a0d: 0x0001, 0x3a0e: 0x0001, 0x3a0f: 0x0001, 0x3a10: 0x000c, 0x3a11: 0x000c,
+	0x3a12: 0x000c, 0x3a13: 0x000c, 0x3a14: 0x000c, 0x3a15: 0x000c, 0x3a16: 0x000c, 0x3a17: 0x0001,
+	0x3a18: 0x0001, 0x3a19: 0x0001, 0x3a1a: 0x0001, 0x3a1b: 0x0001, 0x3a1c: 0x0001, 0x3a1d: 0x0001,
+	0x3a1e: 0x0001, 0x3a1f: 0x0001, 0x3a20: 0x0001, 0x3a21: 0x0001, 0x3a22: 0x0001, 0x3a23: 0x0001,
+	0x3a24: 0x0001, 0x3a25: 0x0001, 0x3a26: 0x0001, 0x3a27: 0x0001, 0x3a28: 0x0001, 0x3a29: 0x0001,
+	0x3a2a: 0x0001, 0x3a2b: 0x0001, 0x3a2c: 0x0001, 0x3a2d: 0x0001, 0x3a2e: 0x0001, 0x3a2f: 0x0001,
+	0x3a30: 0x0001, 0x3a31: 0x0001, 0x3a32: 0x0001, 0x3a33: 0x0001, 0x3a34: 0x0001, 0x3a35: 0x0001,
+	0x3a36: 0x0001, 0x3a37: 0x0001, 0x3a38: 0x0001, 0x3a39: 0x0001, 0x3a3a: 0x0001, 0x3a3b: 0x0001,
+	0x3a3c: 0x0001, 0x3a3d: 0x0001, 0x3a3e: 0x0001, 0x3a3f: 0x0001,
+	// Block 0xe9, offset 0x3a40
+	0x3a40: 0x0001, 0x3a41: 0x0001, 0x3a42: 0x0001, 0x3a43: 0x0001, 0x3a44: 0x000c, 0x3a45: 0x000c,
+	0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x0001,
+	0x3a4c: 0x0001, 0x3a4d: 0x0001, 0x3a4e: 0x0001, 0x3a4f: 0x0001, 0x3a50: 0x0001, 0x3a51: 0x0001,
+	0x3a52: 0x0001, 0x3a53: 0x0001, 0x3a54: 0x0001, 0x3a55: 0x0001, 0x3a56: 0x0001, 0x3a57: 0x0001,
+	0x3a58: 0x0001, 0x3a59: 0x0001, 0x3a5a: 0x0001, 0x3a5b: 0x0001, 0x3a5c: 0x0001, 0x3a5d: 0x0001,
+	0x3a5e: 0x0001, 0x3a5f: 0x0001, 0x3a60: 0x0001, 0x3a61: 0x0001, 0x3a62: 0x0001, 0x3a63: 0x0001,
+	0x3a64: 0x0001, 0x3a65: 0x0001, 0x3a66: 0x0001, 0x3a67: 0x0001, 0x3a68: 0x0001, 0x3a69: 0x0001,
+	0x3a6a: 0x0001, 0x3a6b: 0x0001, 0x3a6c: 0x0001, 0x3a6d: 0x0001, 0x3a6e: 0x0001, 0x3a6f: 0x0001,
+	0x3a70: 0x0001, 0x3a71: 0x0001, 0x3a72: 0x0001, 0x3a73: 0x0001, 0x3a74: 0x0001, 0x3a75: 0x0001,
+	0x3a76: 0x0001, 0x3a77: 0x0001, 0x3a78: 0x0001, 0x3a79: 0x0001, 0x3a7a: 0x0001, 0x3a7b: 0x0001,
+	0x3a7c: 0x0001, 0x3a7d: 0x0001, 0x3a7e: 0x0001, 0x3a7f: 0x0001,
+	// Block 0xea, offset 0x3a80
+	0x3a80: 0x0001, 0x3a81: 0x0001, 0x3a82: 0x0001, 0x3a83: 0x0001, 0x3a84: 0x0001, 0x3a85: 0x0001,
+	0x3a86: 0x0001, 0x3a87: 0x0001, 0x3a88: 0x0001, 0x3a89: 0x0001, 0x3a8a: 0x0001, 0x3a8b: 0x0001,
+	0x3a8c: 0x0001, 0x3a8d: 0x0001, 0x3a8e: 0x0001, 0x3a8f: 0x0001, 0x3a90: 0x0001, 0x3a91: 0x0001,
+	0x3a92: 0x0001, 0x3a93: 0x0001, 0x3a94: 0x0001, 0x3a95: 0x0001, 0x3a96: 0x0001, 0x3a97: 0x0001,
+	0x3a98: 0x0001, 0x3a99: 0x0001, 0x3a9a: 0x0001, 0x3a9b: 0x0001, 0x3a9c: 0x0001, 0x3a9d: 0x0001,
+	0x3a9e: 0x0001, 0x3a9f: 0x0001, 0x3aa0: 0x0001, 0x3aa1: 0x0001, 0x3aa2: 0x0001, 0x3aa3: 0x0001,
+	0x3aa4: 0x0001, 0x3aa5: 0x0001, 0x3aa6: 0x0001, 0x3aa7: 0x0001, 0x3aa8: 0x0001, 0x3aa9: 0x0001,
+	0x3aaa: 0x0001, 0x3aab: 0x0001, 0x3aac: 0x0001, 0x3aad: 0x0001, 0x3aae: 0x0001, 0x3aaf: 0x0001,
+	0x3ab0: 0x0001, 0x3ab1: 0x000d, 0x3ab2: 0x000d, 0x3ab3: 0x000d, 0x3ab4: 0x000d, 0x3ab5: 0x000d,
+	0x3ab6: 0x000d, 0x3ab7: 0x000d, 0x3ab8: 0x000d, 0x3ab9: 0x000d, 0x3aba: 0x000d, 0x3abb: 0x000d,
+	0x3abc: 0x000d, 0x3abd: 0x000d, 0x3abe: 0x000d, 0x3abf: 0x000d,
+	// Block 0xeb, offset 0x3ac0
+	0x3ac0: 0x000d, 0x3ac1: 0x000d, 0x3ac2: 0x000d, 0x3ac3: 0x000d, 0x3ac4: 0x000d, 0x3ac5: 0x000d,
+	0x3ac6: 0x000d, 0x3ac7: 0x000d, 0x3ac8: 0x000d, 0x3ac9: 0x000d, 0x3aca: 0x000d, 0x3acb: 0x000d,
+	0x3acc: 0x000d, 0x3acd: 0x000d, 0x3ace: 0x000d, 0x3acf: 0x000d, 0x3ad0: 0x000d, 0x3ad1: 0x000d,
+	0x3ad2: 0x000d, 0x3ad3: 0x000d, 0x3ad4: 0x000d, 0x3ad5: 0x000d, 0x3ad6: 0x000d, 0x3ad7: 0x000d,
+	0x3ad8: 0x000d, 0x3ad9: 0x000d, 0x3ada: 0x000d, 0x3adb: 0x000d, 0x3adc: 0x000d, 0x3add: 0x000d,
+	0x3ade: 0x000d, 0x3adf: 0x000d, 0x3ae0: 0x000d, 0x3ae1: 0x000d, 0x3ae2: 0x000d, 0x3ae3: 0x000d,
+	0x3ae4: 0x000d, 0x3ae5: 0x000d, 0x3ae6: 0x000d, 0x3ae7: 0x000d, 0x3ae8: 0x000d, 0x3ae9: 0x000d,
+	0x3aea: 0x000d, 0x3aeb: 0x000d, 0x3aec: 0x000d, 0x3aed: 0x000d, 0x3aee: 0x000d, 0x3aef: 0x000d,
+	0x3af0: 0x000d, 0x3af1: 0x000d, 0x3af2: 0x000d, 0x3af3: 0x000d, 0x3af4: 0x000d, 0x3af5: 0x0001,
+	0x3af6: 0x0001, 0x3af7: 0x0001, 0x3af8: 0x0001, 0x3af9: 0x0001, 0x3afa: 0x0001, 0x3afb: 0x0001,
+	0x3afc: 0x0001, 0x3afd: 0x0001, 0x3afe: 0x0001, 0x3aff: 0x0001,
+	// Block 0xec, offset 0x3b00
+	0x3b00: 0x0001, 0x3b01: 0x000d, 0x3b02: 0x000d, 0x3b03: 0x000d, 0x3b04: 0x000d, 0x3b05: 0x000d,
+	0x3b06: 0x000d, 0x3b07: 0x000d, 0x3b08: 0x000d, 0x3b09: 0x000d, 0x3b0a: 0x000d, 0x3b0b: 0x000d,
+	0x3b0c: 0x000d, 0x3b0d: 0x000d, 0x3b0e: 0x000d, 0x3b0f: 0x000d, 0x3b10: 0x000d, 0x3b11: 0x000d,
+	0x3b12: 0x000d, 0x3b13: 0x000d, 0x3b14: 0x000d, 0x3b15: 0x000d, 0x3b16: 0x000d, 0x3b17: 0x000d,
+	0x3b18: 0x000d, 0x3b19: 0x000d, 0x3b1a: 0x000d, 0x3b1b: 0x000d, 0x3b1c: 0x000d, 0x3b1d: 0x000d,
+	0x3b1e: 0x000d, 0x3b1f: 0x000d, 0x3b20: 0x000d, 0x3b21: 0x000d, 0x3b22: 0x000d, 0x3b23: 0x000d,
+	0x3b24: 0x000d, 0x3b25: 0x000d, 0x3b26: 0x000d, 0x3b27: 0x000d, 0x3b28: 0x000d, 0x3b29: 0x000d,
+	0x3b2a: 0x000d, 0x3b2b: 0x000d, 0x3b2c: 0x000d, 0x3b2d: 0x000d, 0x3b2e: 0x000d, 0x3b2f: 0x000d,
+	0x3b30: 0x000d, 0x3b31: 0x000d, 0x3b32: 0x000d, 0x3b33: 0x000d, 0x3b34: 0x000d, 0x3b35: 0x000d,
+	0x3b36: 0x000d, 0x3b37: 0x000d, 0x3b38: 0x000d, 0x3b39: 0x000d, 0x3b3a: 0x000d, 0x3b3b: 0x000d,
+	0x3b3c: 0x000d, 0x3b3d: 0x000d, 0x3b3e: 0x0001, 0x3b3f: 0x0001,
+	// Block 0xed, offset 0x3b40
+	0x3b40: 0x000d, 0x3b41: 0x000d, 0x3b42: 0x000d, 0x3b43: 0x000d, 0x3b44: 0x000d, 0x3b45: 0x000d,
+	0x3b46: 0x000d, 0x3b47: 0x000d, 0x3b48: 0x000d, 0x3b49: 0x000d, 0x3b4a: 0x000d, 0x3b4b: 0x000d,
+	0x3b4c: 0x000d, 0x3b4d: 0x000d, 0x3b4e: 0x000d, 0x3b4f: 0x000d, 0x3b50: 0x000d, 0x3b51: 0x000d,
+	0x3b52: 0x000d, 0x3b53: 0x000d, 0x3b54: 0x000d, 0x3b55: 0x000d, 0x3b56: 0x000d, 0x3b57: 0x000d,
+	0x3b58: 0x000d, 0x3b59: 0x000d, 0x3b5a: 0x000d, 0x3b5b: 0x000d, 0x3b5c: 0x000d, 0x3b5d: 0x000d,
+	0x3b5e: 0x000d, 0x3b5f: 0x000d, 0x3b60: 0x000d, 0x3b61: 0x000d, 0x3b62: 0x000d, 0x3b63: 0x000d,
+	0x3b64: 0x000d, 0x3b65: 0x000d, 0x3b66: 0x000d, 0x3b67: 0x000d, 0x3b68: 0x000d, 0x3b69: 0x000d,
+	0x3b6a: 0x000d, 0x3b6b: 0x000d, 0x3b6c: 0x000d, 0x3b6d: 0x000d, 0x3b6e: 0x000d, 0x3b6f: 0x000d,
+	0x3b70: 0x000a, 0x3b71: 0x000a, 0x3b72: 0x000d, 0x3b73: 0x000d, 0x3b74: 0x000d, 0x3b75: 0x000d,
+	0x3b76: 0x000d, 0x3b77: 0x000d, 0x3b78: 0x000d, 0x3b79: 0x000d, 0x3b7a: 0x000d, 0x3b7b: 0x000d,
+	0x3b7c: 0x000d, 0x3b7d: 0x000d, 0x3b7e: 0x000d, 0x3b7f: 0x000d,
+	// Block 0xee, offset 0x3b80
+	0x3b80: 0x000a, 0x3b81: 0x000a, 0x3b82: 0x000a, 0x3b83: 0x000a, 0x3b84: 0x000a, 0x3b85: 0x000a,
+	0x3b86: 0x000a, 0x3b87: 0x000a, 0x3b88: 0x000a, 0x3b89: 0x000a, 0x3b8a: 0x000a, 0x3b8b: 0x000a,
+	0x3b8c: 0x000a, 0x3b8d: 0x000a, 0x3b8e: 0x000a, 0x3b8f: 0x000a, 0x3b90: 0x000a, 0x3b91: 0x000a,
+	0x3b92: 0x000a, 0x3b93: 0x000a, 0x3b94: 0x000a, 0x3b95: 0x000a, 0x3b96: 0x000a, 0x3b97: 0x000a,
+	0x3b98: 0x000a, 0x3b99: 0x000a, 0x3b9a: 0x000a, 0x3b9b: 0x000a, 0x3b9c: 0x000a, 0x3b9d: 0x000a,
+	0x3b9e: 0x000a, 0x3b9f: 0x000a, 0x3ba0: 0x000a, 0x3ba1: 0x000a, 0x3ba2: 0x000a, 0x3ba3: 0x000a,
+	0x3ba4: 0x000a, 0x3ba5: 0x000a, 0x3ba6: 0x000a, 0x3ba7: 0x000a, 0x3ba8: 0x000a, 0x3ba9: 0x000a,
+	0x3baa: 0x000a, 0x3bab: 0x000a,
+	0x3bb0: 0x000a, 0x3bb1: 0x000a, 0x3bb2: 0x000a, 0x3bb3: 0x000a, 0x3bb4: 0x000a, 0x3bb5: 0x000a,
+	0x3bb6: 0x000a, 0x3bb7: 0x000a, 0x3bb8: 0x000a, 0x3bb9: 0x000a, 0x3bba: 0x000a, 0x3bbb: 0x000a,
+	0x3bbc: 0x000a, 0x3bbd: 0x000a, 0x3bbe: 0x000a, 0x3bbf: 0x000a,
+	// Block 0xef, offset 0x3bc0
+	0x3bc0: 0x000a, 0x3bc1: 0x000a, 0x3bc2: 0x000a, 0x3bc3: 0x000a, 0x3bc4: 0x000a, 0x3bc5: 0x000a,
+	0x3bc6: 0x000a, 0x3bc7: 0x000a, 0x3bc8: 0x000a, 0x3bc9: 0x000a, 0x3bca: 0x000a, 0x3bcb: 0x000a,
+	0x3bcc: 0x000a, 0x3bcd: 0x000a, 0x3bce: 0x000a, 0x3bcf: 0x000a, 0x3bd0: 0x000a, 0x3bd1: 0x000a,
+	0x3bd2: 0x000a, 0x3bd3: 0x000a,
+	0x3be0: 0x000a, 0x3be1: 0x000a, 0x3be2: 0x000a, 0x3be3: 0x000a,
+	0x3be4: 0x000a, 0x3be5: 0x000a, 0x3be6: 0x000a, 0x3be7: 0x000a, 0x3be8: 0x000a, 0x3be9: 0x000a,
+	0x3bea: 0x000a, 0x3beb: 0x000a, 0x3bec: 0x000a, 0x3bed: 0x000a, 0x3bee: 0x000a,
+	0x3bf1: 0x000a, 0x3bf2: 0x000a, 0x3bf3: 0x000a, 0x3bf4: 0x000a, 0x3bf5: 0x000a,
+	0x3bf6: 0x000a, 0x3bf7: 0x000a, 0x3bf8: 0x000a, 0x3bf9: 0x000a, 0x3bfa: 0x000a, 0x3bfb: 0x000a,
+	0x3bfc: 0x000a, 0x3bfd: 0x000a, 0x3bfe: 0x000a, 0x3bff: 0x000a,
+	// Block 0xf0, offset 0x3c00
+	0x3c01: 0x000a, 0x3c02: 0x000a, 0x3c03: 0x000a, 0x3c04: 0x000a, 0x3c05: 0x000a,
+	0x3c06: 0x000a, 0x3c07: 0x000a, 0x3c08: 0x000a, 0x3c09: 0x000a, 0x3c0a: 0x000a, 0x3c0b: 0x000a,
+	0x3c0c: 0x000a, 0x3c0d: 0x000a, 0x3c0e: 0x000a, 0x3c0f: 0x000a, 0x3c11: 0x000a,
+	0x3c12: 0x000a, 0x3c13: 0x000a, 0x3c14: 0x000a, 0x3c15: 0x000a, 0x3c16: 0x000a, 0x3c17: 0x000a,
+	0x3c18: 0x000a, 0x3c19: 0x000a, 0x3c1a: 0x000a, 0x3c1b: 0x000a, 0x3c1c: 0x000a, 0x3c1d: 0x000a,
+	0x3c1e: 0x000a, 0x3c1f: 0x000a, 0x3c20: 0x000a, 0x3c21: 0x000a, 0x3c22: 0x000a, 0x3c23: 0x000a,
+	0x3c24: 0x000a, 0x3c25: 0x000a, 0x3c26: 0x000a, 0x3c27: 0x000a, 0x3c28: 0x000a, 0x3c29: 0x000a,
+	0x3c2a: 0x000a, 0x3c2b: 0x000a, 0x3c2c: 0x000a, 0x3c2d: 0x000a, 0x3c2e: 0x000a, 0x3c2f: 0x000a,
+	0x3c30: 0x000a, 0x3c31: 0x000a, 0x3c32: 0x000a, 0x3c33: 0x000a, 0x3c34: 0x000a, 0x3c35: 0x000a,
+	// Block 0xf1, offset 0x3c40
+	0x3c40: 0x0002, 0x3c41: 0x0002, 0x3c42: 0x0002, 0x3c43: 0x0002, 0x3c44: 0x0002, 0x3c45: 0x0002,
+	0x3c46: 0x0002, 0x3c47: 0x0002, 0x3c48: 0x0002, 0x3c49: 0x0002, 0x3c4a: 0x0002, 0x3c4b: 0x000a,
+	0x3c4c: 0x000a, 0x3c4d: 0x000a, 0x3c4e: 0x000a, 0x3c4f: 0x000a,
+	0x3c6f: 0x000a,
+	// Block 0xf2, offset 0x3c80
+	0x3caa: 0x000a, 0x3cab: 0x000a, 0x3cac: 0x000a, 0x3cad: 0x000a, 0x3cae: 0x000a, 0x3caf: 0x000a,
+	// Block 0xf3, offset 0x3cc0
+	0x3ced: 0x000a,
+	// Block 0xf4, offset 0x3d00
+	0x3d20: 0x000a, 0x3d21: 0x000a, 0x3d22: 0x000a, 0x3d23: 0x000a,
+	0x3d24: 0x000a, 0x3d25: 0x000a,
+	// Block 0xf5, offset 0x3d40
+	0x3d40: 0x000a, 0x3d41: 0x000a, 0x3d42: 0x000a, 0x3d43: 0x000a, 0x3d44: 0x000a, 0x3d45: 0x000a,
+	0x3d46: 0x000a, 0x3d47: 0x000a, 0x3d48: 0x000a, 0x3d49: 0x000a, 0x3d4a: 0x000a, 0x3d4b: 0x000a,
+	0x3d4c: 0x000a, 0x3d4d: 0x000a, 0x3d4e: 0x000a, 0x3d4f: 0x000a, 0x3d50: 0x000a, 0x3d51: 0x000a,
+	0x3d52: 0x000a, 0x3d53: 0x000a, 0x3d54: 0x000a, 0x3d55: 0x000a, 0x3d56: 0x000a, 0x3d57: 0x000a,
+	0x3d5c: 0x000a, 0x3d5d: 0x000a,
+	0x3d5e: 0x000a, 0x3d5f: 0x000a, 0x3d60: 0x000a, 0x3d61: 0x000a, 0x3d62: 0x000a, 0x3d63: 0x000a,
+	0x3d64: 0x000a, 0x3d65: 0x000a, 0x3d66: 0x000a, 0x3d67: 0x000a, 0x3d68: 0x000a, 0x3d69: 0x000a,
+	0x3d6a: 0x000a, 0x3d6b: 0x000a, 0x3d6c: 0x000a,
+	0x3d70: 0x000a, 0x3d71: 0x000a, 0x3d72: 0x000a, 0x3d73: 0x000a, 0x3d74: 0x000a, 0x3d75: 0x000a,
+	0x3d76: 0x000a, 0x3d77: 0x000a, 0x3d78: 0x000a, 0x3d79: 0x000a, 0x3d7a: 0x000a, 0x3d7b: 0x000a,
+	0x3d7c: 0x000a,
+	// Block 0xf6, offset 0x3d80
+	0x3d80: 0x000a, 0x3d81: 0x000a, 0x3d82: 0x000a, 0x3d83: 0x000a, 0x3d84: 0x000a, 0x3d85: 0x000a,
+	0x3d86: 0x000a, 0x3d87: 0x000a, 0x3d88: 0x000a, 0x3d89: 0x000a, 0x3d8a: 0x000a, 0x3d8b: 0x000a,
+	0x3d8c: 0x000a, 0x3d8d: 0x000a, 0x3d8e: 0x000a, 0x3d8f: 0x000a, 0x3d90: 0x000a, 0x3d91: 0x000a,
+	0x3d92: 0x000a, 0x3d93: 0x000a, 0x3d94: 0x000a, 0x3d95: 0x000a, 0x3d96: 0x000a, 0x3d97: 0x000a,
+	0x3d98: 0x000a, 0x3d99: 0x000a, 0x3d9a: 0x000a, 0x3d9b: 0x000a, 0x3d9c: 0x000a, 0x3d9d: 0x000a,
+	0x3d9e: 0x000a, 0x3d9f: 0x000a, 0x3da0: 0x000a, 0x3da1: 0x000a, 0x3da2: 0x000a, 0x3da3: 0x000a,
+	0x3da4: 0x000a, 0x3da5: 0x000a, 0x3da6: 0x000a, 0x3da7: 0x000a, 0x3da8: 0x000a, 0x3da9: 0x000a,
+	0x3daa: 0x000a, 0x3dab: 0x000a, 0x3dac: 0x000a, 0x3dad: 0x000a, 0x3dae: 0x000a, 0x3daf: 0x000a,
+	0x3db0: 0x000a, 0x3db1: 0x000a, 0x3db2: 0x000a, 0x3db3: 0x000a, 0x3db4: 0x000a, 0x3db5: 0x000a,
+	0x3db6: 0x000a, 0x3dbb: 0x000a,
+	0x3dbc: 0x000a, 0x3dbd: 0x000a, 0x3dbe: 0x000a, 0x3dbf: 0x000a,
+	// Block 0xf7, offset 0x3dc0
+	0x3dc0: 0x000a, 0x3dc1: 0x000a, 0x3dc2: 0x000a, 0x3dc3: 0x000a, 0x3dc4: 0x000a, 0x3dc5: 0x000a,
+	0x3dc6: 0x000a, 0x3dc7: 0x000a, 0x3dc8: 0x000a, 0x3dc9: 0x000a, 0x3dca: 0x000a, 0x3dcb: 0x000a,
+	0x3dcc: 0x000a, 0x3dcd: 0x000a, 0x3dce: 0x000a, 0x3dcf: 0x000a, 0x3dd0: 0x000a, 0x3dd1: 0x000a,
+	0x3dd2: 0x000a, 0x3dd3: 0x000a, 0x3dd4: 0x000a, 0x3dd5: 0x000a, 0x3dd6: 0x000a, 0x3dd7: 0x000a,
+	0x3dd8: 0x000a, 0x3dd9: 0x000a,
+	0x3de0: 0x000a, 0x3de1: 0x000a, 0x3de2: 0x000a, 0x3de3: 0x000a,
+	0x3de4: 0x000a, 0x3de5: 0x000a, 0x3de6: 0x000a, 0x3de7: 0x000a, 0x3de8: 0x000a, 0x3de9: 0x000a,
+	0x3dea: 0x000a, 0x3deb: 0x000a,
+	0x3df0: 0x000a,
+	// Block 0xf8, offset 0x3e00
+	0x3e00: 0x000a, 0x3e01: 0x000a, 0x3e02: 0x000a, 0x3e03: 0x000a, 0x3e04: 0x000a, 0x3e05: 0x000a,
+	0x3e06: 0x000a, 0x3e07: 0x000a, 0x3e08: 0x000a, 0x3e09: 0x000a, 0x3e0a: 0x000a, 0x3e0b: 0x000a,
+	0x3e10: 0x000a, 0x3e11: 0x000a,
+	0x3e12: 0x000a, 0x3e13: 0x000a, 0x3e14: 0x000a, 0x3e15: 0x000a, 0x3e16: 0x000a, 0x3e17: 0x000a,
+	0x3e18: 0x000a, 0x3e19: 0x000a, 0x3e1a: 0x000a, 0x3e1b: 0x000a, 0x3e1c: 0x000a, 0x3e1d: 0x000a,
+	0x3e1e: 0x000a, 0x3e1f: 0x000a, 0x3e20: 0x000a, 0x3e21: 0x000a, 0x3e22: 0x000a, 0x3e23: 0x000a,
+	0x3e24: 0x000a, 0x3e25: 0x000a, 0x3e26: 0x000a, 0x3e27: 0x000a, 0x3e28: 0x000a, 0x3e29: 0x000a,
+	0x3e2a: 0x000a, 0x3e2b: 0x000a, 0x3e2c: 0x000a, 0x3e2d: 0x000a, 0x3e2e: 0x000a, 0x3e2f: 0x000a,
+	0x3e30: 0x000a, 0x3e31: 0x000a, 0x3e32: 0x000a, 0x3e33: 0x000a, 0x3e34: 0x000a, 0x3e35: 0x000a,
+	0x3e36: 0x000a, 0x3e37: 0x000a, 0x3e38: 0x000a, 0x3e39: 0x000a, 0x3e3a: 0x000a, 0x3e3b: 0x000a,
+	0x3e3c: 0x000a, 0x3e3d: 0x000a, 0x3e3e: 0x000a, 0x3e3f: 0x000a,
+	// Block 0xf9, offset 0x3e40
+	0x3e40: 0x000a, 0x3e41: 0x000a, 0x3e42: 0x000a, 0x3e43: 0x000a, 0x3e44: 0x000a, 0x3e45: 0x000a,
+	0x3e46: 0x000a, 0x3e47: 0x000a,
+	0x3e50: 0x000a, 0x3e51: 0x000a,
+	0x3e52: 0x000a, 0x3e53: 0x000a, 0x3e54: 0x000a, 0x3e55: 0x000a, 0x3e56: 0x000a, 0x3e57: 0x000a,
+	0x3e58: 0x000a, 0x3e59: 0x000a,
+	0x3e60: 0x000a, 0x3e61: 0x000a, 0x3e62: 0x000a, 0x3e63: 0x000a,
+	0x3e64: 0x000a, 0x3e65: 0x000a, 0x3e66: 0x000a, 0x3e67: 0x000a, 0x3e68: 0x000a, 0x3e69: 0x000a,
+	0x3e6a: 0x000a, 0x3e6b: 0x000a, 0x3e6c: 0x000a, 0x3e6d: 0x000a, 0x3e6e: 0x000a, 0x3e6f: 0x000a,
+	0x3e70: 0x000a, 0x3e71: 0x000a, 0x3e72: 0x000a, 0x3e73: 0x000a, 0x3e74: 0x000a, 0x3e75: 0x000a,
+	0x3e76: 0x000a, 0x3e77: 0x000a, 0x3e78: 0x000a, 0x3e79: 0x000a, 0x3e7a: 0x000a, 0x3e7b: 0x000a,
+	0x3e7c: 0x000a, 0x3e7d: 0x000a, 0x3e7e: 0x000a, 0x3e7f: 0x000a,
+	// Block 0xfa, offset 0x3e80
+	0x3e80: 0x000a, 0x3e81: 0x000a, 0x3e82: 0x000a, 0x3e83: 0x000a, 0x3e84: 0x000a, 0x3e85: 0x000a,
+	0x3e86: 0x000a, 0x3e87: 0x000a,
+	0x3e90: 0x000a, 0x3e91: 0x000a,
+	0x3e92: 0x000a, 0x3e93: 0x000a, 0x3e94: 0x000a, 0x3e95: 0x000a, 0x3e96: 0x000a, 0x3e97: 0x000a,
+	0x3e98: 0x000a, 0x3e99: 0x000a, 0x3e9a: 0x000a, 0x3e9b: 0x000a, 0x3e9c: 0x000a, 0x3e9d: 0x000a,
+	0x3e9e: 0x000a, 0x3e9f: 0x000a, 0x3ea0: 0x000a, 0x3ea1: 0x000a, 0x3ea2: 0x000a, 0x3ea3: 0x000a,
+	0x3ea4: 0x000a, 0x3ea5: 0x000a, 0x3ea6: 0x000a, 0x3ea7: 0x000a, 0x3ea8: 0x000a, 0x3ea9: 0x000a,
+	0x3eaa: 0x000a, 0x3eab: 0x000a, 0x3eac: 0x000a, 0x3ead: 0x000a,
+	0x3eb0: 0x000a, 0x3eb1: 0x000a,
+	// Block 0xfb, offset 0x3ec0
+	0x3ec0: 0x000a, 0x3ec1: 0x000a, 0x3ec2: 0x000a, 0x3ec3: 0x000a, 0x3ec4: 0x000a, 0x3ec5: 0x000a,
+	0x3ec6: 0x000a, 0x3ec7: 0x000a, 0x3ec8: 0x000a, 0x3ec9: 0x000a, 0x3eca: 0x000a, 0x3ecb: 0x000a,
+	0x3ecc: 0x000a, 0x3ecd: 0x000a, 0x3ece: 0x000a, 0x3ecf: 0x000a, 0x3ed0: 0x000a, 0x3ed1: 0x000a,
+	0x3ed2: 0x000a, 0x3ed3: 0x000a,
+	0x3ee0: 0x000a, 0x3ee1: 0x000a, 0x3ee2: 0x000a, 0x3ee3: 0x000a,
+	0x3ee4: 0x000a, 0x3ee5: 0x000a, 0x3ee6: 0x000a, 0x3ee7: 0x000a, 0x3ee8: 0x000a, 0x3ee9: 0x000a,
+	0x3eea: 0x000a, 0x3eeb: 0x000a, 0x3eec: 0x000a, 0x3eed: 0x000a,
+	0x3ef0: 0x000a, 0x3ef1: 0x000a, 0x3ef2: 0x000a, 0x3ef3: 0x000a, 0x3ef4: 0x000a, 0x3ef5: 0x000a,
+	0x3ef6: 0x000a, 0x3ef7: 0x000a, 0x3ef8: 0x000a, 0x3ef9: 0x000a, 0x3efa: 0x000a, 0x3efb: 0x000a,
+	0x3efc: 0x000a,
+	// Block 0xfc, offset 0x3f00
+	0x3f00: 0x000a, 0x3f01: 0x000a, 0x3f02: 0x000a, 0x3f03: 0x000a, 0x3f04: 0x000a, 0x3f05: 0x000a,
+	0x3f06: 0x000a, 0x3f07: 0x000a, 0x3f08: 0x000a,
+	0x3f10: 0x000a, 0x3f11: 0x000a,
+	0x3f12: 0x000a, 0x3f13: 0x000a, 0x3f14: 0x000a, 0x3f15: 0x000a, 0x3f16: 0x000a, 0x3f17: 0x000a,
+	0x3f18: 0x000a, 0x3f19: 0x000a, 0x3f1a: 0x000a, 0x3f1b: 0x000a, 0x3f1c: 0x000a, 0x3f1d: 0x000a,
+	0x3f1e: 0x000a, 0x3f1f: 0x000a, 0x3f20: 0x000a, 0x3f21: 0x000a, 0x3f22: 0x000a, 0x3f23: 0x000a,
+	0x3f24: 0x000a, 0x3f25: 0x000a, 0x3f26: 0x000a, 0x3f27: 0x000a, 0x3f28: 0x000a, 0x3f29: 0x000a,
+	0x3f2a: 0x000a, 0x3f2b: 0x000a, 0x3f2c: 0x000a, 0x3f2d: 0x000a, 0x3f2e: 0x000a, 0x3f2f: 0x000a,
+	0x3f30: 0x000a, 0x3f31: 0x000a, 0x3f32: 0x000a, 0x3f33: 0x000a, 0x3f34: 0x000a, 0x3f35: 0x000a,
+	0x3f36: 0x000a, 0x3f37: 0x000a, 0x3f38: 0x000a, 0x3f39: 0x000a, 0x3f3a: 0x000a, 0x3f3b: 0x000a,
+	0x3f3c: 0x000a, 0x3f3d: 0x000a, 0x3f3f: 0x000a,
+	// Block 0xfd, offset 0x3f40
+	0x3f40: 0x000a, 0x3f41: 0x000a, 0x3f42: 0x000a, 0x3f43: 0x000a, 0x3f44: 0x000a, 0x3f45: 0x000a,
+	0x3f4e: 0x000a, 0x3f4f: 0x000a, 0x3f50: 0x000a, 0x3f51: 0x000a,
+	0x3f52: 0x000a, 0x3f53: 0x000a, 0x3f54: 0x000a, 0x3f55: 0x000a, 0x3f56: 0x000a, 0x3f57: 0x000a,
+	0x3f58: 0x000a, 0x3f59: 0x000a, 0x3f5a: 0x000a, 0x3f5b: 0x000a,
+	0x3f60: 0x000a, 0x3f61: 0x000a, 0x3f62: 0x000a, 0x3f63: 0x000a,
+	0x3f64: 0x000a, 0x3f65: 0x000a, 0x3f66: 0x000a, 0x3f67: 0x000a, 0x3f68: 0x000a,
+	0x3f70: 0x000a, 0x3f71: 0x000a, 0x3f72: 0x000a, 0x3f73: 0x000a, 0x3f74: 0x000a, 0x3f75: 0x000a,
+	0x3f76: 0x000a, 0x3f77: 0x000a, 0x3f78: 0x000a,
+	// Block 0xfe, offset 0x3f80
+	0x3f80: 0x000a, 0x3f81: 0x000a, 0x3f82: 0x000a, 0x3f83: 0x000a, 0x3f84: 0x000a, 0x3f85: 0x000a,
+	0x3f86: 0x000a, 0x3f87: 0x000a, 0x3f88: 0x000a, 0x3f89: 0x000a, 0x3f8a: 0x000a, 0x3f8b: 0x000a,
+	0x3f8c: 0x000a, 0x3f8d: 0x000a, 0x3f8e: 0x000a, 0x3f8f: 0x000a, 0x3f90: 0x000a, 0x3f91: 0x000a,
+	0x3f92: 0x000a, 0x3f94: 0x000a, 0x3f95: 0x000a, 0x3f96: 0x000a, 0x3f97: 0x000a,
+	0x3f98: 0x000a, 0x3f99: 0x000a, 0x3f9a: 0x000a, 0x3f9b: 0x000a, 0x3f9c: 0x000a, 0x3f9d: 0x000a,
+	0x3f9e: 0x000a, 0x3f9f: 0x000a, 0x3fa0: 0x000a, 0x3fa1: 0x000a, 0x3fa2: 0x000a, 0x3fa3: 0x000a,
+	0x3fa4: 0x000a, 0x3fa5: 0x000a, 0x3fa6: 0x000a, 0x3fa7: 0x000a, 0x3fa8: 0x000a, 0x3fa9: 0x000a,
+	0x3faa: 0x000a, 0x3fab: 0x000a, 0x3fac: 0x000a, 0x3fad: 0x000a, 0x3fae: 0x000a, 0x3faf: 0x000a,
+	0x3fb0: 0x000a, 0x3fb1: 0x000a, 0x3fb2: 0x000a, 0x3fb3: 0x000a, 0x3fb4: 0x000a, 0x3fb5: 0x000a,
+	0x3fb6: 0x000a, 0x3fb7: 0x000a, 0x3fb8: 0x000a, 0x3fb9: 0x000a, 0x3fba: 0x000a, 0x3fbb: 0x000a,
+	0x3fbc: 0x000a, 0x3fbd: 0x000a, 0x3fbe: 0x000a, 0x3fbf: 0x000a,
+	// Block 0xff, offset 0x3fc0
+	0x3fc0: 0x000a, 0x3fc1: 0x000a, 0x3fc2: 0x000a, 0x3fc3: 0x000a, 0x3fc4: 0x000a, 0x3fc5: 0x000a,
+	0x3fc6: 0x000a, 0x3fc7: 0x000a, 0x3fc8: 0x000a, 0x3fc9: 0x000a, 0x3fca: 0x000a,
+	0x3ff0: 0x0002, 0x3ff1: 0x0002, 0x3ff2: 0x0002, 0x3ff3: 0x0002, 0x3ff4: 0x0002, 0x3ff5: 0x0002,
+	0x3ff6: 0x0002, 0x3ff7: 0x0002, 0x3ff8: 0x0002, 0x3ff9: 0x0002,
+	// Block 0x100, offset 0x4000
+	0x403e: 0x000b, 0x403f: 0x000b,
+	// Block 0x101, offset 0x4040
+	0x4040: 0x000b, 0x4041: 0x000b, 0x4042: 0x000b, 0x4043: 0x000b, 0x4044: 0x000b, 0x4045: 0x000b,
+	0x4046: 0x000b, 0x4047: 0x000b, 0x4048: 0x000b, 0x4049: 0x000b, 0x404a: 0x000b, 0x404b: 0x000b,
+	0x404c: 0x000b, 0x404d: 0x000b, 0x404e: 0x000b, 0x404f: 0x000b, 0x4050: 0x000b, 0x4051: 0x000b,
+	0x4052: 0x000b, 0x4053: 0x000b, 0x4054: 0x000b, 0x4055: 0x000b, 0x4056: 0x000b, 0x4057: 0x000b,
+	0x4058: 0x000b, 0x4059: 0x000b, 0x405a: 0x000b, 0x405b: 0x000b, 0x405c: 0x000b, 0x405d: 0x000b,
+	0x405e: 0x000b, 0x405f: 0x000b, 0x4060: 0x000b, 0x4061: 0x000b, 0x4062: 0x000b, 0x4063: 0x000b,
+	0x4064: 0x000b, 0x4065: 0x000b, 0x4066: 0x000b, 0x4067: 0x000b, 0x4068: 0x000b, 0x4069: 0x000b,
+	0x406a: 0x000b, 0x406b: 0x000b, 0x406c: 0x000b, 0x406d: 0x000b, 0x406e: 0x000b, 0x406f: 0x000b,
+	0x4070: 0x000b, 0x4071: 0x000b, 0x4072: 0x000b, 0x4073: 0x000b, 0x4074: 0x000b, 0x4075: 0x000b,
+	0x4076: 0x000b, 0x4077: 0x000b, 0x4078: 0x000b, 0x4079: 0x000b, 0x407a: 0x000b, 0x407b: 0x000b,
+	0x407c: 0x000b, 0x407d: 0x000b, 0x407e: 0x000b, 0x407f: 0x000b,
+	// Block 0x102, offset 0x4080
+	0x4080: 0x000c, 0x4081: 0x000c, 0x4082: 0x000c, 0x4083: 0x000c, 0x4084: 0x000c, 0x4085: 0x000c,
+	0x4086: 0x000c, 0x4087: 0x000c, 0x4088: 0x000c, 0x4089: 0x000c, 0x408a: 0x000c, 0x408b: 0x000c,
+	0x408c: 0x000c, 0x408d: 0x000c, 0x408e: 0x000c, 0x408f: 0x000c, 0x4090: 0x000c, 0x4091: 0x000c,
+	0x4092: 0x000c, 0x4093: 0x000c, 0x4094: 0x000c, 0x4095: 0x000c, 0x4096: 0x000c, 0x4097: 0x000c,
+	0x4098: 0x000c, 0x4099: 0x000c, 0x409a: 0x000c, 0x409b: 0x000c, 0x409c: 0x000c, 0x409d: 0x000c,
+	0x409e: 0x000c, 0x409f: 0x000c, 0x40a0: 0x000c, 0x40a1: 0x000c, 0x40a2: 0x000c, 0x40a3: 0x000c,
+	0x40a4: 0x000c, 0x40a5: 0x000c, 0x40a6: 0x000c, 0x40a7: 0x000c, 0x40a8: 0x000c, 0x40a9: 0x000c,
+	0x40aa: 0x000c, 0x40ab: 0x000c, 0x40ac: 0x000c, 0x40ad: 0x000c, 0x40ae: 0x000c, 0x40af: 0x000c,
+	0x40b0: 0x000b, 0x40b1: 0x000b, 0x40b2: 0x000b, 0x40b3: 0x000b, 0x40b4: 0x000b, 0x40b5: 0x000b,
+	0x40b6: 0x000b, 0x40b7: 0x000b, 0x40b8: 0x000b, 0x40b9: 0x000b, 0x40ba: 0x000b, 0x40bb: 0x000b,
+	0x40bc: 0x000b, 0x40bd: 0x000b, 0x40be: 0x000b, 0x40bf: 0x000b,
+}
+
+// bidiIndex: 26 blocks, 1664 entries, 3328 bytes
+// Block 0 is the zero block.
+var bidiIndex = [1664]uint16{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x01, 0xc3: 0x02,
+	0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08,
+	0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b,
+	0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06,
+	0xea: 0x07, 0xef: 0x08,
+	0xf0: 0x13, 0xf1: 0x14, 0xf2: 0x14, 0xf3: 0x16, 0xf4: 0x17,
+	// Block 0x4, offset 0x100
+	0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b,
+	0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22,
+	0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x136: 0x28, 0x137: 0x29,
+	0x138: 0x2a, 0x139: 0x2b, 0x13a: 0x2c, 0x13b: 0x2d, 0x13c: 0x2e, 0x13d: 0x2f, 0x13e: 0x30, 0x13f: 0x31,
+	// Block 0x5, offset 0x140
+	0x140: 0x32, 0x141: 0x33, 0x142: 0x34,
+	0x14d: 0x35, 0x14e: 0x36,
+	0x150: 0x37,
+	0x15a: 0x38, 0x15c: 0x39, 0x15d: 0x3a, 0x15e: 0x3b, 0x15f: 0x3c,
+	0x160: 0x3d, 0x162: 0x3e, 0x164: 0x3f, 0x165: 0x40, 0x167: 0x41,
+	0x168: 0x42, 0x169: 0x43, 0x16a: 0x44, 0x16b: 0x45, 0x16c: 0x46, 0x16d: 0x47, 0x16e: 0x48, 0x16f: 0x49,
+	0x170: 0x4a, 0x173: 0x4b, 0x177: 0x05,
+	0x17e: 0x4c, 0x17f: 0x4d,
+	// Block 0x6, offset 0x180
+	0x180: 0x4e, 0x181: 0x4f, 0x182: 0x50, 0x183: 0x51, 0x184: 0x52, 0x185: 0x53, 0x186: 0x54, 0x187: 0x55,
+	0x188: 0x56, 0x189: 0x55, 0x18a: 0x55, 0x18b: 0x55, 0x18c: 0x57, 0x18d: 0x58, 0x18e: 0x59, 0x18f: 0x55,
+	0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x55, 0x195: 0x55, 0x196: 0x55, 0x197: 0x55,
+	0x198: 0x55, 0x199: 0x55, 0x19a: 0x5e, 0x19b: 0x55, 0x19c: 0x55, 0x19d: 0x5f, 0x19e: 0x55, 0x19f: 0x60,
+	0x1a4: 0x55, 0x1a5: 0x55, 0x1a6: 0x61, 0x1a7: 0x62,
+	0x1a8: 0x55, 0x1a9: 0x55, 0x1aa: 0x55, 0x1ab: 0x55, 0x1ac: 0x55, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x55,
+	0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67,
+	0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x55, 0x1bd: 0x55, 0x1be: 0x55, 0x1bf: 0x6c,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70,
+	0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76,
+	// Block 0x8, offset 0x200
+	0x237: 0x55,
+	// Block 0x9, offset 0x240
+	0x252: 0x77, 0x253: 0x78,
+	0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e,
+	0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85,
+	0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26d: 0x8a, 0x26f: 0x8b,
+	// Block 0xa, offset 0x280
+	0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e,
+	0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x8f, 0x2b6: 0x0e, 0x2b7: 0x90,
+	0x2b8: 0x91, 0x2b9: 0x92, 0x2ba: 0x0e, 0x2bb: 0x93, 0x2bc: 0x94, 0x2bd: 0x95, 0x2bf: 0x96,
+	// Block 0xb, offset 0x2c0
+	0x2c4: 0x97, 0x2c5: 0x55, 0x2c6: 0x98, 0x2c7: 0x99,
+	0x2cb: 0x9a, 0x2cd: 0x9b,
+	0x2e0: 0x9c, 0x2e1: 0x9c, 0x2e2: 0x9c, 0x2e3: 0x9c, 0x2e4: 0x9d, 0x2e5: 0x9c, 0x2e6: 0x9c, 0x2e7: 0x9c,
+	0x2e8: 0x9e, 0x2e9: 0x9c, 0x2ea: 0x9c, 0x2eb: 0x9f, 0x2ec: 0xa0, 0x2ed: 0x9c, 0x2ee: 0x9c, 0x2ef: 0x9c,
+	0x2f0: 0x9c, 0x2f1: 0x9c, 0x2f2: 0x9c, 0x2f3: 0x9c, 0x2f4: 0xa1, 0x2f5: 0x9c, 0x2f6: 0x9c, 0x2f7: 0x9c,
+	0x2f8: 0x9c, 0x2f9: 0xa2, 0x2fa: 0xa3, 0x2fb: 0xa4, 0x2fc: 0xa5, 0x2fd: 0xa6, 0x2fe: 0xa7, 0x2ff: 0x9c,
+	// Block 0xc, offset 0x300
+	0x300: 0xa8, 0x301: 0xa9, 0x302: 0xaa, 0x303: 0x21, 0x304: 0xab, 0x305: 0xac, 0x306: 0xad, 0x307: 0xae,
+	0x308: 0xaf, 0x309: 0x28, 0x30b: 0xb0, 0x30c: 0x26, 0x30d: 0xb1,
+	0x310: 0xb2, 0x311: 0xb3, 0x312: 0xb4, 0x313: 0xb5, 0x316: 0xb6, 0x317: 0xb7,
+	0x318: 0xb8, 0x319: 0xb9, 0x31a: 0xba, 0x31c: 0xbb,
+	0x320: 0xbc, 0x324: 0xbd, 0x325: 0xbe, 0x327: 0xbf,
+	0x328: 0xc0, 0x329: 0xc1, 0x32a: 0xc2,
+	0x330: 0xc3, 0x332: 0xc4, 0x334: 0xc5, 0x335: 0xc6, 0x336: 0xc7,
+	0x33b: 0xc8, 0x33c: 0xc9, 0x33d: 0xca, 0x33f: 0xcb,
+	// Block 0xd, offset 0x340
+	0x351: 0xcc,
+	// Block 0xe, offset 0x380
+	0x3ab: 0xcd, 0x3ac: 0xce,
+	0x3bd: 0xcf, 0x3be: 0xd0, 0x3bf: 0xd1,
+	// Block 0xf, offset 0x3c0
+	0x3f2: 0xd2,
+	// Block 0x10, offset 0x400
+	0x43c: 0xd3, 0x43d: 0xd4,
+	// Block 0x11, offset 0x440
+	0x445: 0xd5, 0x446: 0xd6, 0x447: 0xd7,
+	0x448: 0x55, 0x449: 0xd8, 0x44c: 0x55, 0x44d: 0xd9,
+	0x45b: 0xda, 0x45c: 0xdb, 0x45d: 0xdc, 0x45e: 0xdd, 0x45f: 0xde,
+	0x468: 0xdf, 0x469: 0xe0, 0x46a: 0xe1,
+	// Block 0x12, offset 0x480
+	0x480: 0xe2, 0x482: 0xcf, 0x484: 0xce,
+	0x48a: 0xe3, 0x48b: 0xe4,
+	0x493: 0xe5,
+	0x4a0: 0x9c, 0x4a1: 0x9c, 0x4a2: 0x9c, 0x4a3: 0xe6, 0x4a4: 0x9c, 0x4a5: 0xe7, 0x4a6: 0x9c, 0x4a7: 0x9c,
+	0x4a8: 0x9c, 0x4a9: 0x9c, 0x4aa: 0x9c, 0x4ab: 0x9c, 0x4ac: 0x9c, 0x4ad: 0x9c, 0x4ae: 0x9c, 0x4af: 0x9c,
+	0x4b0: 0x9c, 0x4b1: 0xe8, 0x4b2: 0xe9, 0x4b3: 0x9c, 0x4b4: 0xea, 0x4b5: 0x9c, 0x4b6: 0x9c, 0x4b7: 0x9c,
+	0x4b8: 0x0e, 0x4b9: 0x0e, 0x4ba: 0x0e, 0x4bb: 0xeb, 0x4bc: 0x9c, 0x4bd: 0x9c, 0x4be: 0x9c, 0x4bf: 0x9c,
+	// Block 0x13, offset 0x4c0
+	0x4c0: 0xec, 0x4c1: 0x55, 0x4c2: 0xed, 0x4c3: 0xee, 0x4c4: 0xef, 0x4c5: 0xf0, 0x4c6: 0xf1,
+	0x4c9: 0xf2, 0x4cc: 0x55, 0x4cd: 0x55, 0x4ce: 0x55, 0x4cf: 0x55,
+	0x4d0: 0x55, 0x4d1: 0x55, 0x4d2: 0x55, 0x4d3: 0x55, 0x4d4: 0x55, 0x4d5: 0x55, 0x4d6: 0x55, 0x4d7: 0x55,
+	0x4d8: 0x55, 0x4d9: 0x55, 0x4da: 0x55, 0x4db: 0xf3, 0x4dc: 0x55, 0x4dd: 0xf4, 0x4de: 0x55, 0x4df: 0xf5,
+	0x4e0: 0xf6, 0x4e1: 0xf7, 0x4e2: 0xf8, 0x4e4: 0x55, 0x4e5: 0x55, 0x4e6: 0x55, 0x4e7: 0x55,
+	0x4e8: 0x55, 0x4e9: 0xf9, 0x4ea: 0xfa, 0x4eb: 0xfb, 0x4ec: 0x55, 0x4ed: 0x55, 0x4ee: 0xfc, 0x4ef: 0xfd,
+	0x4ff: 0xfe,
+	// Block 0x14, offset 0x500
+	0x53f: 0xfe,
+	// Block 0x15, offset 0x540
+	0x550: 0x09, 0x551: 0x0a, 0x553: 0x0b, 0x556: 0x0c,
+	0x55b: 0x0d, 0x55c: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+	0x56f: 0x12,
+	0x57f: 0x12,
+	// Block 0x16, offset 0x580
+	0x58f: 0x12,
+	0x59f: 0x12,
+	0x5af: 0x12,
+	0x5bf: 0x12,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0xff, 0x5c1: 0xff, 0x5c2: 0xff, 0x5c3: 0xff, 0x5c4: 0x05, 0x5c5: 0x05, 0x5c6: 0x05, 0x5c7: 0x100,
+	0x5c8: 0xff, 0x5c9: 0xff, 0x5ca: 0xff, 0x5cb: 0xff, 0x5cc: 0xff, 0x5cd: 0xff, 0x5ce: 0xff, 0x5cf: 0xff,
+	0x5d0: 0xff, 0x5d1: 0xff, 0x5d2: 0xff, 0x5d3: 0xff, 0x5d4: 0xff, 0x5d5: 0xff, 0x5d6: 0xff, 0x5d7: 0xff,
+	0x5d8: 0xff, 0x5d9: 0xff, 0x5da: 0xff, 0x5db: 0xff, 0x5dc: 0xff, 0x5dd: 0xff, 0x5de: 0xff, 0x5df: 0xff,
+	0x5e0: 0xff, 0x5e1: 0xff, 0x5e2: 0xff, 0x5e3: 0xff, 0x5e4: 0xff, 0x5e5: 0xff, 0x5e6: 0xff, 0x5e7: 0xff,
+	0x5e8: 0xff, 0x5e9: 0xff, 0x5ea: 0xff, 0x5eb: 0xff, 0x5ec: 0xff, 0x5ed: 0xff, 0x5ee: 0xff, 0x5ef: 0xff,
+	0x5f0: 0xff, 0x5f1: 0xff, 0x5f2: 0xff, 0x5f3: 0xff, 0x5f4: 0xff, 0x5f5: 0xff, 0x5f6: 0xff, 0x5f7: 0xff,
+	0x5f8: 0xff, 0x5f9: 0xff, 0x5fa: 0xff, 0x5fb: 0xff, 0x5fc: 0xff, 0x5fd: 0xff, 0x5fe: 0xff, 0x5ff: 0xff,
+	// Block 0x18, offset 0x600
+	0x60f: 0x12,
+	0x61f: 0x12,
+	0x620: 0x15,
+	0x62f: 0x12,
+	0x63f: 0x12,
+	// Block 0x19, offset 0x640
+	0x64f: 0x12,
+}
+
+// Total table size 19960 bytes (19KiB); checksum: F50EF68C
diff --git a/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go
index f517fdb202a..c164d379175 100644
--- a/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go
+++ b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build !go1.10
-// +build !go1.10
 
 package bidi
 
diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go
index d69ccb4f976..487335d14d3 100644
--- a/vendor/golang.org/x/text/unicode/norm/forminfo.go
+++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go
@@ -13,7 +13,7 @@ import "encoding/binary"
 // a rune to a uint16. The values take two forms.  For v >= 0x8000:
 //   bits
 //   15:    1 (inverse of NFD_QC bit of qcInfo)
-//   13..7: qcInfo (see below). isYesD is always true (no decompostion).
+//   13..7: qcInfo (see below). isYesD is always true (no decomposition).
 //    6..0: ccc (compressed CCC value).
 // For v < 0x8000, the respective rune has a decomposition and v is an index
 // into a byte array of UTF-8 decomposition sequences and additional info and
diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
index f5a0788277f..1af161c7563 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.10 && !go1.13
-// +build go1.10,!go1.13
 
 package norm
 
diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
index cb7239c4377..eb73ecc3738 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.13 && !go1.14
-// +build go1.13,!go1.14
 
 package norm
 
diff --git a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go
index 11b27330017..276cb8d8c04 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables12.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build go1.14 && !go1.16
-// +build go1.14,!go1.16
 
 package norm
 
diff --git a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go
index 9115ef257e8..0cceffd731b 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables13.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
-//go:build go1.16
-// +build go1.16
+//go:build go1.16 && !go1.21
 
 package norm
 
diff --git a/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go
new file mode 100644
index 00000000000..b0819e42d09
--- /dev/null
+++ b/vendor/golang.org/x/text/unicode/norm/tables15.0.0.go
@@ -0,0 +1,7907 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+//go:build go1.21
+
+package norm
+
+import "sync"
+
+const (
+	// Version is the Unicode edition from which the tables are derived.
+	Version = "15.0.0"
+
+	// MaxTransformChunkSize indicates the maximum number of bytes that Transform
+	// may need to write atomically for any Form. Making a destination buffer at
+	// least this size ensures that Transform can always make progress and that
+	// the user does not need to grow the buffer on an ErrShortDst.
+	MaxTransformChunkSize = 35 + maxNonStarters*4
+)
+
+var ccc = [56]uint8{
+	0, 1, 6, 7, 8, 9, 10, 11,
+	12, 13, 14, 15, 16, 17, 18, 19,
+	20, 21, 22, 23, 24, 25, 26, 27,
+	28, 29, 30, 31, 32, 33, 34, 35,
+	36, 84, 91, 103, 107, 118, 122, 129,
+	130, 132, 202, 214, 216, 218, 220, 222,
+	224, 226, 228, 230, 232, 233, 234, 240,
+}
+
+const (
+	firstMulti            = 0x199A
+	firstCCC              = 0x2DD5
+	endMulti              = 0x30A1
+	firstLeadingCCC       = 0x4AEF
+	firstCCCZeroExcept    = 0x4BB9
+	firstStarterWithNLead = 0x4BE0
+	lastDecomp            = 0x4BE2
+	maxDecomp             = 0x8000
+)
+
+// decomps: 19426 bytes
+var decomps = [...]byte{
+	// Bytes 0 - 3f
+	0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41,
+	0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41,
+	0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41,
+	0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41,
+	0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41,
+	0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41,
+	0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41,
+	0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41,
+	// Bytes 40 - 7f
+	0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41,
+	0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41,
+	0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41,
+	0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41,
+	0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41,
+	0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41,
+	0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41,
+	0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41,
+	// Bytes 80 - bf
+	0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41,
+	0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41,
+	0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41,
+	0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41,
+	0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41,
+	0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41,
+	0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41,
+	0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42,
+	// Bytes c0 - ff
+	0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5,
+	0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2,
+	0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xA6, 0x42,
+	0xC3, 0xB0, 0x42, 0xC3, 0xB8, 0x42, 0xC4, 0xA6,
+	0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, 0x42, 0xC5,
+	0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, 0x8E, 0x42,
+	0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, 0xC7, 0x80,
+	0x42, 0xC7, 0x81, 0x42, 0xC7, 0x82, 0x42, 0xC8,
+	// Bytes 100 - 13f
+	0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, 0x42,
+	0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, 0x93,
+	0x42, 0xC9, 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9,
+	0x96, 0x42, 0xC9, 0x97, 0x42, 0xC9, 0x98, 0x42,
+	0xC9, 0x99, 0x42, 0xC9, 0x9B, 0x42, 0xC9, 0x9C,
+	0x42, 0xC9, 0x9E, 0x42, 0xC9, 0x9F, 0x42, 0xC9,
+	0xA0, 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA2, 0x42,
+	0xC9, 0xA3, 0x42, 0xC9, 0xA4, 0x42, 0xC9, 0xA5,
+	// Bytes 140 - 17f
+	0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA7, 0x42, 0xC9,
+	0xA8, 0x42, 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42,
+	0xC9, 0xAB, 0x42, 0xC9, 0xAC, 0x42, 0xC9, 0xAD,
+	0x42, 0xC9, 0xAE, 0x42, 0xC9, 0xAF, 0x42, 0xC9,
+	0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42,
+	0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5,
+	0x42, 0xC9, 0xB6, 0x42, 0xC9, 0xB7, 0x42, 0xC9,
+	0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, 0xBA, 0x42,
+	// Bytes 180 - 1bf
+	0xC9, 0xBB, 0x42, 0xC9, 0xBD, 0x42, 0xC9, 0xBE,
+	0x42, 0xCA, 0x80, 0x42, 0xCA, 0x81, 0x42, 0xCA,
+	0x82, 0x42, 0xCA, 0x83, 0x42, 0xCA, 0x84, 0x42,
+	0xCA, 0x88, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A,
+	0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA,
+	0x8D, 0x42, 0xCA, 0x8E, 0x42, 0xCA, 0x8F, 0x42,
+	0xCA, 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92,
+	0x42, 0xCA, 0x95, 0x42, 0xCA, 0x98, 0x42, 0xCA,
+	// Bytes 1c0 - 1ff
+	0x99, 0x42, 0xCA, 0x9B, 0x42, 0xCA, 0x9C, 0x42,
+	0xCA, 0x9D, 0x42, 0xCA, 0x9F, 0x42, 0xCA, 0xA1,
+	0x42, 0xCA, 0xA2, 0x42, 0xCA, 0xA3, 0x42, 0xCA,
+	0xA4, 0x42, 0xCA, 0xA5, 0x42, 0xCA, 0xA6, 0x42,
+	0xCA, 0xA7, 0x42, 0xCA, 0xA8, 0x42, 0xCA, 0xA9,
+	0x42, 0xCA, 0xAA, 0x42, 0xCA, 0xAB, 0x42, 0xCA,
+	0xB9, 0x42, 0xCB, 0x90, 0x42, 0xCB, 0x91, 0x42,
+	0xCE, 0x91, 0x42, 0xCE, 0x92, 0x42, 0xCE, 0x93,
+	// Bytes 200 - 23f
+	0x42, 0xCE, 0x94, 0x42, 0xCE, 0x95, 0x42, 0xCE,
+	0x96, 0x42, 0xCE, 0x97, 0x42, 0xCE, 0x98, 0x42,
+	0xCE, 0x99, 0x42, 0xCE, 0x9A, 0x42, 0xCE, 0x9B,
+	0x42, 0xCE, 0x9C, 0x42, 0xCE, 0x9D, 0x42, 0xCE,
+	0x9E, 0x42, 0xCE, 0x9F, 0x42, 0xCE, 0xA0, 0x42,
+	0xCE, 0xA1, 0x42, 0xCE, 0xA3, 0x42, 0xCE, 0xA4,
+	0x42, 0xCE, 0xA5, 0x42, 0xCE, 0xA6, 0x42, 0xCE,
+	0xA7, 0x42, 0xCE, 0xA8, 0x42, 0xCE, 0xA9, 0x42,
+	// Bytes 240 - 27f
+	0xCE, 0xB1, 0x42, 0xCE, 0xB2, 0x42, 0xCE, 0xB3,
+	0x42, 0xCE, 0xB4, 0x42, 0xCE, 0xB5, 0x42, 0xCE,
+	0xB6, 0x42, 0xCE, 0xB7, 0x42, 0xCE, 0xB8, 0x42,
+	0xCE, 0xB9, 0x42, 0xCE, 0xBA, 0x42, 0xCE, 0xBB,
+	0x42, 0xCE, 0xBC, 0x42, 0xCE, 0xBD, 0x42, 0xCE,
+	0xBE, 0x42, 0xCE, 0xBF, 0x42, 0xCF, 0x80, 0x42,
+	0xCF, 0x81, 0x42, 0xCF, 0x82, 0x42, 0xCF, 0x83,
+	0x42, 0xCF, 0x84, 0x42, 0xCF, 0x85, 0x42, 0xCF,
+	// Bytes 280 - 2bf
+	0x86, 0x42, 0xCF, 0x87, 0x42, 0xCF, 0x88, 0x42,
+	0xCF, 0x89, 0x42, 0xCF, 0x9C, 0x42, 0xCF, 0x9D,
+	0x42, 0xD0, 0xB0, 0x42, 0xD0, 0xB1, 0x42, 0xD0,
+	0xB2, 0x42, 0xD0, 0xB3, 0x42, 0xD0, 0xB4, 0x42,
+	0xD0, 0xB5, 0x42, 0xD0, 0xB6, 0x42, 0xD0, 0xB7,
+	0x42, 0xD0, 0xB8, 0x42, 0xD0, 0xBA, 0x42, 0xD0,
+	0xBB, 0x42, 0xD0, 0xBC, 0x42, 0xD0, 0xBD, 0x42,
+	0xD0, 0xBE, 0x42, 0xD0, 0xBF, 0x42, 0xD1, 0x80,
+	// Bytes 2c0 - 2ff
+	0x42, 0xD1, 0x81, 0x42, 0xD1, 0x82, 0x42, 0xD1,
+	0x83, 0x42, 0xD1, 0x84, 0x42, 0xD1, 0x85, 0x42,
+	0xD1, 0x86, 0x42, 0xD1, 0x87, 0x42, 0xD1, 0x88,
+	0x42, 0xD1, 0x8A, 0x42, 0xD1, 0x8B, 0x42, 0xD1,
+	0x8C, 0x42, 0xD1, 0x8D, 0x42, 0xD1, 0x8E, 0x42,
+	0xD1, 0x95, 0x42, 0xD1, 0x96, 0x42, 0xD1, 0x98,
+	0x42, 0xD1, 0x9F, 0x42, 0xD2, 0x91, 0x42, 0xD2,
+	0xAB, 0x42, 0xD2, 0xAF, 0x42, 0xD2, 0xB1, 0x42,
+	// Bytes 300 - 33f
+	0xD3, 0x8F, 0x42, 0xD3, 0x99, 0x42, 0xD3, 0xA9,
+	0x42, 0xD7, 0x90, 0x42, 0xD7, 0x91, 0x42, 0xD7,
+	0x92, 0x42, 0xD7, 0x93, 0x42, 0xD7, 0x94, 0x42,
+	0xD7, 0x9B, 0x42, 0xD7, 0x9C, 0x42, 0xD7, 0x9D,
+	0x42, 0xD7, 0xA2, 0x42, 0xD7, 0xA8, 0x42, 0xD7,
+	0xAA, 0x42, 0xD8, 0xA1, 0x42, 0xD8, 0xA7, 0x42,
+	0xD8, 0xA8, 0x42, 0xD8, 0xA9, 0x42, 0xD8, 0xAA,
+	0x42, 0xD8, 0xAB, 0x42, 0xD8, 0xAC, 0x42, 0xD8,
+	// Bytes 340 - 37f
+	0xAD, 0x42, 0xD8, 0xAE, 0x42, 0xD8, 0xAF, 0x42,
+	0xD8, 0xB0, 0x42, 0xD8, 0xB1, 0x42, 0xD8, 0xB2,
+	0x42, 0xD8, 0xB3, 0x42, 0xD8, 0xB4, 0x42, 0xD8,
+	0xB5, 0x42, 0xD8, 0xB6, 0x42, 0xD8, 0xB7, 0x42,
+	0xD8, 0xB8, 0x42, 0xD8, 0xB9, 0x42, 0xD8, 0xBA,
+	0x42, 0xD9, 0x81, 0x42, 0xD9, 0x82, 0x42, 0xD9,
+	0x83, 0x42, 0xD9, 0x84, 0x42, 0xD9, 0x85, 0x42,
+	0xD9, 0x86, 0x42, 0xD9, 0x87, 0x42, 0xD9, 0x88,
+	// Bytes 380 - 3bf
+	0x42, 0xD9, 0x89, 0x42, 0xD9, 0x8A, 0x42, 0xD9,
+	0xAE, 0x42, 0xD9, 0xAF, 0x42, 0xD9, 0xB1, 0x42,
+	0xD9, 0xB9, 0x42, 0xD9, 0xBA, 0x42, 0xD9, 0xBB,
+	0x42, 0xD9, 0xBE, 0x42, 0xD9, 0xBF, 0x42, 0xDA,
+	0x80, 0x42, 0xDA, 0x83, 0x42, 0xDA, 0x84, 0x42,
+	0xDA, 0x86, 0x42, 0xDA, 0x87, 0x42, 0xDA, 0x88,
+	0x42, 0xDA, 0x8C, 0x42, 0xDA, 0x8D, 0x42, 0xDA,
+	0x8E, 0x42, 0xDA, 0x91, 0x42, 0xDA, 0x98, 0x42,
+	// Bytes 3c0 - 3ff
+	0xDA, 0xA1, 0x42, 0xDA, 0xA4, 0x42, 0xDA, 0xA6,
+	0x42, 0xDA, 0xA9, 0x42, 0xDA, 0xAD, 0x42, 0xDA,
+	0xAF, 0x42, 0xDA, 0xB1, 0x42, 0xDA, 0xB3, 0x42,
+	0xDA, 0xBA, 0x42, 0xDA, 0xBB, 0x42, 0xDA, 0xBE,
+	0x42, 0xDB, 0x81, 0x42, 0xDB, 0x85, 0x42, 0xDB,
+	0x86, 0x42, 0xDB, 0x87, 0x42, 0xDB, 0x88, 0x42,
+	0xDB, 0x89, 0x42, 0xDB, 0x8B, 0x42, 0xDB, 0x8C,
+	0x42, 0xDB, 0x90, 0x42, 0xDB, 0x92, 0x43, 0xE0,
+	// Bytes 400 - 43f
+	0xBC, 0x8B, 0x43, 0xE1, 0x83, 0x9C, 0x43, 0xE1,
+	0x84, 0x80, 0x43, 0xE1, 0x84, 0x81, 0x43, 0xE1,
+	0x84, 0x82, 0x43, 0xE1, 0x84, 0x83, 0x43, 0xE1,
+	0x84, 0x84, 0x43, 0xE1, 0x84, 0x85, 0x43, 0xE1,
+	0x84, 0x86, 0x43, 0xE1, 0x84, 0x87, 0x43, 0xE1,
+	0x84, 0x88, 0x43, 0xE1, 0x84, 0x89, 0x43, 0xE1,
+	0x84, 0x8A, 0x43, 0xE1, 0x84, 0x8B, 0x43, 0xE1,
+	0x84, 0x8C, 0x43, 0xE1, 0x84, 0x8D, 0x43, 0xE1,
+	// Bytes 440 - 47f
+	0x84, 0x8E, 0x43, 0xE1, 0x84, 0x8F, 0x43, 0xE1,
+	0x84, 0x90, 0x43, 0xE1, 0x84, 0x91, 0x43, 0xE1,
+	0x84, 0x92, 0x43, 0xE1, 0x84, 0x94, 0x43, 0xE1,
+	0x84, 0x95, 0x43, 0xE1, 0x84, 0x9A, 0x43, 0xE1,
+	0x84, 0x9C, 0x43, 0xE1, 0x84, 0x9D, 0x43, 0xE1,
+	0x84, 0x9E, 0x43, 0xE1, 0x84, 0xA0, 0x43, 0xE1,
+	0x84, 0xA1, 0x43, 0xE1, 0x84, 0xA2, 0x43, 0xE1,
+	0x84, 0xA3, 0x43, 0xE1, 0x84, 0xA7, 0x43, 0xE1,
+	// Bytes 480 - 4bf
+	0x84, 0xA9, 0x43, 0xE1, 0x84, 0xAB, 0x43, 0xE1,
+	0x84, 0xAC, 0x43, 0xE1, 0x84, 0xAD, 0x43, 0xE1,
+	0x84, 0xAE, 0x43, 0xE1, 0x84, 0xAF, 0x43, 0xE1,
+	0x84, 0xB2, 0x43, 0xE1, 0x84, 0xB6, 0x43, 0xE1,
+	0x85, 0x80, 0x43, 0xE1, 0x85, 0x87, 0x43, 0xE1,
+	0x85, 0x8C, 0x43, 0xE1, 0x85, 0x97, 0x43, 0xE1,
+	0x85, 0x98, 0x43, 0xE1, 0x85, 0x99, 0x43, 0xE1,
+	0x85, 0xA0, 0x43, 0xE1, 0x86, 0x84, 0x43, 0xE1,
+	// Bytes 4c0 - 4ff
+	0x86, 0x85, 0x43, 0xE1, 0x86, 0x88, 0x43, 0xE1,
+	0x86, 0x91, 0x43, 0xE1, 0x86, 0x92, 0x43, 0xE1,
+	0x86, 0x94, 0x43, 0xE1, 0x86, 0x9E, 0x43, 0xE1,
+	0x86, 0xA1, 0x43, 0xE1, 0x87, 0x87, 0x43, 0xE1,
+	0x87, 0x88, 0x43, 0xE1, 0x87, 0x8C, 0x43, 0xE1,
+	0x87, 0x8E, 0x43, 0xE1, 0x87, 0x93, 0x43, 0xE1,
+	0x87, 0x97, 0x43, 0xE1, 0x87, 0x99, 0x43, 0xE1,
+	0x87, 0x9D, 0x43, 0xE1, 0x87, 0x9F, 0x43, 0xE1,
+	// Bytes 500 - 53f
+	0x87, 0xB1, 0x43, 0xE1, 0x87, 0xB2, 0x43, 0xE1,
+	0xB4, 0x82, 0x43, 0xE1, 0xB4, 0x96, 0x43, 0xE1,
+	0xB4, 0x97, 0x43, 0xE1, 0xB4, 0x9C, 0x43, 0xE1,
+	0xB4, 0x9D, 0x43, 0xE1, 0xB4, 0xA5, 0x43, 0xE1,
+	0xB5, 0xBB, 0x43, 0xE1, 0xB6, 0x85, 0x43, 0xE1,
+	0xB6, 0x91, 0x43, 0xE2, 0x80, 0x82, 0x43, 0xE2,
+	0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, 0xE2,
+	0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, 0xE2,
+	// Bytes 540 - 57f
+	0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, 0xE2,
+	0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, 0xE2,
+	0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, 0xE2,
+	0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, 0xE2,
+	0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, 0xE2,
+	0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, 0xE2,
+	0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, 0xE2,
+	0xB1, 0xB1, 0x43, 0xE2, 0xB5, 0xA1, 0x43, 0xE3,
+	// Bytes 580 - 5bf
+	0x80, 0x81, 0x43, 0xE3, 0x80, 0x82, 0x43, 0xE3,
+	0x80, 0x88, 0x43, 0xE3, 0x80, 0x89, 0x43, 0xE3,
+	0x80, 0x8A, 0x43, 0xE3, 0x80, 0x8B, 0x43, 0xE3,
+	0x80, 0x8C, 0x43, 0xE3, 0x80, 0x8D, 0x43, 0xE3,
+	0x80, 0x8E, 0x43, 0xE3, 0x80, 0x8F, 0x43, 0xE3,
+	0x80, 0x90, 0x43, 0xE3, 0x80, 0x91, 0x43, 0xE3,
+	0x80, 0x92, 0x43, 0xE3, 0x80, 0x94, 0x43, 0xE3,
+	0x80, 0x95, 0x43, 0xE3, 0x80, 0x96, 0x43, 0xE3,
+	// Bytes 5c0 - 5ff
+	0x80, 0x97, 0x43, 0xE3, 0x82, 0xA1, 0x43, 0xE3,
+	0x82, 0xA2, 0x43, 0xE3, 0x82, 0xA3, 0x43, 0xE3,
+	0x82, 0xA4, 0x43, 0xE3, 0x82, 0xA5, 0x43, 0xE3,
+	0x82, 0xA6, 0x43, 0xE3, 0x82, 0xA7, 0x43, 0xE3,
+	0x82, 0xA8, 0x43, 0xE3, 0x82, 0xA9, 0x43, 0xE3,
+	0x82, 0xAA, 0x43, 0xE3, 0x82, 0xAB, 0x43, 0xE3,
+	0x82, 0xAD, 0x43, 0xE3, 0x82, 0xAF, 0x43, 0xE3,
+	0x82, 0xB1, 0x43, 0xE3, 0x82, 0xB3, 0x43, 0xE3,
+	// Bytes 600 - 63f
+	0x82, 0xB5, 0x43, 0xE3, 0x82, 0xB7, 0x43, 0xE3,
+	0x82, 0xB9, 0x43, 0xE3, 0x82, 0xBB, 0x43, 0xE3,
+	0x82, 0xBD, 0x43, 0xE3, 0x82, 0xBF, 0x43, 0xE3,
+	0x83, 0x81, 0x43, 0xE3, 0x83, 0x83, 0x43, 0xE3,
+	0x83, 0x84, 0x43, 0xE3, 0x83, 0x86, 0x43, 0xE3,
+	0x83, 0x88, 0x43, 0xE3, 0x83, 0x8A, 0x43, 0xE3,
+	0x83, 0x8B, 0x43, 0xE3, 0x83, 0x8C, 0x43, 0xE3,
+	0x83, 0x8D, 0x43, 0xE3, 0x83, 0x8E, 0x43, 0xE3,
+	// Bytes 640 - 67f
+	0x83, 0x8F, 0x43, 0xE3, 0x83, 0x92, 0x43, 0xE3,
+	0x83, 0x95, 0x43, 0xE3, 0x83, 0x98, 0x43, 0xE3,
+	0x83, 0x9B, 0x43, 0xE3, 0x83, 0x9E, 0x43, 0xE3,
+	0x83, 0x9F, 0x43, 0xE3, 0x83, 0xA0, 0x43, 0xE3,
+	0x83, 0xA1, 0x43, 0xE3, 0x83, 0xA2, 0x43, 0xE3,
+	0x83, 0xA3, 0x43, 0xE3, 0x83, 0xA4, 0x43, 0xE3,
+	0x83, 0xA5, 0x43, 0xE3, 0x83, 0xA6, 0x43, 0xE3,
+	0x83, 0xA7, 0x43, 0xE3, 0x83, 0xA8, 0x43, 0xE3,
+	// Bytes 680 - 6bf
+	0x83, 0xA9, 0x43, 0xE3, 0x83, 0xAA, 0x43, 0xE3,
+	0x83, 0xAB, 0x43, 0xE3, 0x83, 0xAC, 0x43, 0xE3,
+	0x83, 0xAD, 0x43, 0xE3, 0x83, 0xAF, 0x43, 0xE3,
+	0x83, 0xB0, 0x43, 0xE3, 0x83, 0xB1, 0x43, 0xE3,
+	0x83, 0xB2, 0x43, 0xE3, 0x83, 0xB3, 0x43, 0xE3,
+	0x83, 0xBB, 0x43, 0xE3, 0x83, 0xBC, 0x43, 0xE3,
+	0x92, 0x9E, 0x43, 0xE3, 0x92, 0xB9, 0x43, 0xE3,
+	0x92, 0xBB, 0x43, 0xE3, 0x93, 0x9F, 0x43, 0xE3,
+	// Bytes 6c0 - 6ff
+	0x94, 0x95, 0x43, 0xE3, 0x9B, 0xAE, 0x43, 0xE3,
+	0x9B, 0xBC, 0x43, 0xE3, 0x9E, 0x81, 0x43, 0xE3,
+	0xA0, 0xAF, 0x43, 0xE3, 0xA1, 0xA2, 0x43, 0xE3,
+	0xA1, 0xBC, 0x43, 0xE3, 0xA3, 0x87, 0x43, 0xE3,
+	0xA3, 0xA3, 0x43, 0xE3, 0xA4, 0x9C, 0x43, 0xE3,
+	0xA4, 0xBA, 0x43, 0xE3, 0xA8, 0xAE, 0x43, 0xE3,
+	0xA9, 0xAC, 0x43, 0xE3, 0xAB, 0xA4, 0x43, 0xE3,
+	0xAC, 0x88, 0x43, 0xE3, 0xAC, 0x99, 0x43, 0xE3,
+	// Bytes 700 - 73f
+	0xAD, 0x89, 0x43, 0xE3, 0xAE, 0x9D, 0x43, 0xE3,
+	0xB0, 0x98, 0x43, 0xE3, 0xB1, 0x8E, 0x43, 0xE3,
+	0xB4, 0xB3, 0x43, 0xE3, 0xB6, 0x96, 0x43, 0xE3,
+	0xBA, 0xAC, 0x43, 0xE3, 0xBA, 0xB8, 0x43, 0xE3,
+	0xBC, 0x9B, 0x43, 0xE3, 0xBF, 0xBC, 0x43, 0xE4,
+	0x80, 0x88, 0x43, 0xE4, 0x80, 0x98, 0x43, 0xE4,
+	0x80, 0xB9, 0x43, 0xE4, 0x81, 0x86, 0x43, 0xE4,
+	0x82, 0x96, 0x43, 0xE4, 0x83, 0xA3, 0x43, 0xE4,
+	// Bytes 740 - 77f
+	0x84, 0xAF, 0x43, 0xE4, 0x88, 0x82, 0x43, 0xE4,
+	0x88, 0xA7, 0x43, 0xE4, 0x8A, 0xA0, 0x43, 0xE4,
+	0x8C, 0x81, 0x43, 0xE4, 0x8C, 0xB4, 0x43, 0xE4,
+	0x8D, 0x99, 0x43, 0xE4, 0x8F, 0x95, 0x43, 0xE4,
+	0x8F, 0x99, 0x43, 0xE4, 0x90, 0x8B, 0x43, 0xE4,
+	0x91, 0xAB, 0x43, 0xE4, 0x94, 0xAB, 0x43, 0xE4,
+	0x95, 0x9D, 0x43, 0xE4, 0x95, 0xA1, 0x43, 0xE4,
+	0x95, 0xAB, 0x43, 0xE4, 0x97, 0x97, 0x43, 0xE4,
+	// Bytes 780 - 7bf
+	0x97, 0xB9, 0x43, 0xE4, 0x98, 0xB5, 0x43, 0xE4,
+	0x9A, 0xBE, 0x43, 0xE4, 0x9B, 0x87, 0x43, 0xE4,
+	0xA6, 0x95, 0x43, 0xE4, 0xA7, 0xA6, 0x43, 0xE4,
+	0xA9, 0xAE, 0x43, 0xE4, 0xA9, 0xB6, 0x43, 0xE4,
+	0xAA, 0xB2, 0x43, 0xE4, 0xAC, 0xB3, 0x43, 0xE4,
+	0xAF, 0x8E, 0x43, 0xE4, 0xB3, 0x8E, 0x43, 0xE4,
+	0xB3, 0xAD, 0x43, 0xE4, 0xB3, 0xB8, 0x43, 0xE4,
+	0xB5, 0x96, 0x43, 0xE4, 0xB8, 0x80, 0x43, 0xE4,
+	// Bytes 7c0 - 7ff
+	0xB8, 0x81, 0x43, 0xE4, 0xB8, 0x83, 0x43, 0xE4,
+	0xB8, 0x89, 0x43, 0xE4, 0xB8, 0x8A, 0x43, 0xE4,
+	0xB8, 0x8B, 0x43, 0xE4, 0xB8, 0x8D, 0x43, 0xE4,
+	0xB8, 0x99, 0x43, 0xE4, 0xB8, 0xA6, 0x43, 0xE4,
+	0xB8, 0xA8, 0x43, 0xE4, 0xB8, 0xAD, 0x43, 0xE4,
+	0xB8, 0xB2, 0x43, 0xE4, 0xB8, 0xB6, 0x43, 0xE4,
+	0xB8, 0xB8, 0x43, 0xE4, 0xB8, 0xB9, 0x43, 0xE4,
+	0xB8, 0xBD, 0x43, 0xE4, 0xB8, 0xBF, 0x43, 0xE4,
+	// Bytes 800 - 83f
+	0xB9, 0x81, 0x43, 0xE4, 0xB9, 0x99, 0x43, 0xE4,
+	0xB9, 0x9D, 0x43, 0xE4, 0xBA, 0x82, 0x43, 0xE4,
+	0xBA, 0x85, 0x43, 0xE4, 0xBA, 0x86, 0x43, 0xE4,
+	0xBA, 0x8C, 0x43, 0xE4, 0xBA, 0x94, 0x43, 0xE4,
+	0xBA, 0xA0, 0x43, 0xE4, 0xBA, 0xA4, 0x43, 0xE4,
+	0xBA, 0xAE, 0x43, 0xE4, 0xBA, 0xBA, 0x43, 0xE4,
+	0xBB, 0x80, 0x43, 0xE4, 0xBB, 0x8C, 0x43, 0xE4,
+	0xBB, 0xA4, 0x43, 0xE4, 0xBC, 0x81, 0x43, 0xE4,
+	// Bytes 840 - 87f
+	0xBC, 0x91, 0x43, 0xE4, 0xBD, 0xA0, 0x43, 0xE4,
+	0xBE, 0x80, 0x43, 0xE4, 0xBE, 0x86, 0x43, 0xE4,
+	0xBE, 0x8B, 0x43, 0xE4, 0xBE, 0xAE, 0x43, 0xE4,
+	0xBE, 0xBB, 0x43, 0xE4, 0xBE, 0xBF, 0x43, 0xE5,
+	0x80, 0x82, 0x43, 0xE5, 0x80, 0xAB, 0x43, 0xE5,
+	0x81, 0xBA, 0x43, 0xE5, 0x82, 0x99, 0x43, 0xE5,
+	0x83, 0x8F, 0x43, 0xE5, 0x83, 0x9A, 0x43, 0xE5,
+	0x83, 0xA7, 0x43, 0xE5, 0x84, 0xAA, 0x43, 0xE5,
+	// Bytes 880 - 8bf
+	0x84, 0xBF, 0x43, 0xE5, 0x85, 0x80, 0x43, 0xE5,
+	0x85, 0x85, 0x43, 0xE5, 0x85, 0x8D, 0x43, 0xE5,
+	0x85, 0x94, 0x43, 0xE5, 0x85, 0xA4, 0x43, 0xE5,
+	0x85, 0xA5, 0x43, 0xE5, 0x85, 0xA7, 0x43, 0xE5,
+	0x85, 0xA8, 0x43, 0xE5, 0x85, 0xA9, 0x43, 0xE5,
+	0x85, 0xAB, 0x43, 0xE5, 0x85, 0xAD, 0x43, 0xE5,
+	0x85, 0xB7, 0x43, 0xE5, 0x86, 0x80, 0x43, 0xE5,
+	0x86, 0x82, 0x43, 0xE5, 0x86, 0x8D, 0x43, 0xE5,
+	// Bytes 8c0 - 8ff
+	0x86, 0x92, 0x43, 0xE5, 0x86, 0x95, 0x43, 0xE5,
+	0x86, 0x96, 0x43, 0xE5, 0x86, 0x97, 0x43, 0xE5,
+	0x86, 0x99, 0x43, 0xE5, 0x86, 0xA4, 0x43, 0xE5,
+	0x86, 0xAB, 0x43, 0xE5, 0x86, 0xAC, 0x43, 0xE5,
+	0x86, 0xB5, 0x43, 0xE5, 0x86, 0xB7, 0x43, 0xE5,
+	0x87, 0x89, 0x43, 0xE5, 0x87, 0x8C, 0x43, 0xE5,
+	0x87, 0x9C, 0x43, 0xE5, 0x87, 0x9E, 0x43, 0xE5,
+	0x87, 0xA0, 0x43, 0xE5, 0x87, 0xB5, 0x43, 0xE5,
+	// Bytes 900 - 93f
+	0x88, 0x80, 0x43, 0xE5, 0x88, 0x83, 0x43, 0xE5,
+	0x88, 0x87, 0x43, 0xE5, 0x88, 0x97, 0x43, 0xE5,
+	0x88, 0x9D, 0x43, 0xE5, 0x88, 0xA9, 0x43, 0xE5,
+	0x88, 0xBA, 0x43, 0xE5, 0x88, 0xBB, 0x43, 0xE5,
+	0x89, 0x86, 0x43, 0xE5, 0x89, 0x8D, 0x43, 0xE5,
+	0x89, 0xB2, 0x43, 0xE5, 0x89, 0xB7, 0x43, 0xE5,
+	0x8A, 0x89, 0x43, 0xE5, 0x8A, 0x9B, 0x43, 0xE5,
+	0x8A, 0xA3, 0x43, 0xE5, 0x8A, 0xB3, 0x43, 0xE5,
+	// Bytes 940 - 97f
+	0x8A, 0xB4, 0x43, 0xE5, 0x8B, 0x87, 0x43, 0xE5,
+	0x8B, 0x89, 0x43, 0xE5, 0x8B, 0x92, 0x43, 0xE5,
+	0x8B, 0x9E, 0x43, 0xE5, 0x8B, 0xA4, 0x43, 0xE5,
+	0x8B, 0xB5, 0x43, 0xE5, 0x8B, 0xB9, 0x43, 0xE5,
+	0x8B, 0xBA, 0x43, 0xE5, 0x8C, 0x85, 0x43, 0xE5,
+	0x8C, 0x86, 0x43, 0xE5, 0x8C, 0x95, 0x43, 0xE5,
+	0x8C, 0x97, 0x43, 0xE5, 0x8C, 0x9A, 0x43, 0xE5,
+	0x8C, 0xB8, 0x43, 0xE5, 0x8C, 0xBB, 0x43, 0xE5,
+	// Bytes 980 - 9bf
+	0x8C, 0xBF, 0x43, 0xE5, 0x8D, 0x81, 0x43, 0xE5,
+	0x8D, 0x84, 0x43, 0xE5, 0x8D, 0x85, 0x43, 0xE5,
+	0x8D, 0x89, 0x43, 0xE5, 0x8D, 0x91, 0x43, 0xE5,
+	0x8D, 0x94, 0x43, 0xE5, 0x8D, 0x9A, 0x43, 0xE5,
+	0x8D, 0x9C, 0x43, 0xE5, 0x8D, 0xA9, 0x43, 0xE5,
+	0x8D, 0xB0, 0x43, 0xE5, 0x8D, 0xB3, 0x43, 0xE5,
+	0x8D, 0xB5, 0x43, 0xE5, 0x8D, 0xBD, 0x43, 0xE5,
+	0x8D, 0xBF, 0x43, 0xE5, 0x8E, 0x82, 0x43, 0xE5,
+	// Bytes 9c0 - 9ff
+	0x8E, 0xB6, 0x43, 0xE5, 0x8F, 0x83, 0x43, 0xE5,
+	0x8F, 0x88, 0x43, 0xE5, 0x8F, 0x8A, 0x43, 0xE5,
+	0x8F, 0x8C, 0x43, 0xE5, 0x8F, 0x9F, 0x43, 0xE5,
+	0x8F, 0xA3, 0x43, 0xE5, 0x8F, 0xA5, 0x43, 0xE5,
+	0x8F, 0xAB, 0x43, 0xE5, 0x8F, 0xAF, 0x43, 0xE5,
+	0x8F, 0xB1, 0x43, 0xE5, 0x8F, 0xB3, 0x43, 0xE5,
+	0x90, 0x86, 0x43, 0xE5, 0x90, 0x88, 0x43, 0xE5,
+	0x90, 0x8D, 0x43, 0xE5, 0x90, 0x8F, 0x43, 0xE5,
+	// Bytes a00 - a3f
+	0x90, 0x9D, 0x43, 0xE5, 0x90, 0xB8, 0x43, 0xE5,
+	0x90, 0xB9, 0x43, 0xE5, 0x91, 0x82, 0x43, 0xE5,
+	0x91, 0x88, 0x43, 0xE5, 0x91, 0xA8, 0x43, 0xE5,
+	0x92, 0x9E, 0x43, 0xE5, 0x92, 0xA2, 0x43, 0xE5,
+	0x92, 0xBD, 0x43, 0xE5, 0x93, 0xB6, 0x43, 0xE5,
+	0x94, 0x90, 0x43, 0xE5, 0x95, 0x8F, 0x43, 0xE5,
+	0x95, 0x93, 0x43, 0xE5, 0x95, 0x95, 0x43, 0xE5,
+	0x95, 0xA3, 0x43, 0xE5, 0x96, 0x84, 0x43, 0xE5,
+	// Bytes a40 - a7f
+	0x96, 0x87, 0x43, 0xE5, 0x96, 0x99, 0x43, 0xE5,
+	0x96, 0x9D, 0x43, 0xE5, 0x96, 0xAB, 0x43, 0xE5,
+	0x96, 0xB3, 0x43, 0xE5, 0x96, 0xB6, 0x43, 0xE5,
+	0x97, 0x80, 0x43, 0xE5, 0x97, 0x82, 0x43, 0xE5,
+	0x97, 0xA2, 0x43, 0xE5, 0x98, 0x86, 0x43, 0xE5,
+	0x99, 0x91, 0x43, 0xE5, 0x99, 0xA8, 0x43, 0xE5,
+	0x99, 0xB4, 0x43, 0xE5, 0x9B, 0x97, 0x43, 0xE5,
+	0x9B, 0x9B, 0x43, 0xE5, 0x9B, 0xB9, 0x43, 0xE5,
+	// Bytes a80 - abf
+	0x9C, 0x96, 0x43, 0xE5, 0x9C, 0x97, 0x43, 0xE5,
+	0x9C, 0x9F, 0x43, 0xE5, 0x9C, 0xB0, 0x43, 0xE5,
+	0x9E, 0x8B, 0x43, 0xE5, 0x9F, 0x8E, 0x43, 0xE5,
+	0x9F, 0xB4, 0x43, 0xE5, 0xA0, 0x8D, 0x43, 0xE5,
+	0xA0, 0xB1, 0x43, 0xE5, 0xA0, 0xB2, 0x43, 0xE5,
+	0xA1, 0x80, 0x43, 0xE5, 0xA1, 0x9A, 0x43, 0xE5,
+	0xA1, 0x9E, 0x43, 0xE5, 0xA2, 0xA8, 0x43, 0xE5,
+	0xA2, 0xAC, 0x43, 0xE5, 0xA2, 0xB3, 0x43, 0xE5,
+	// Bytes ac0 - aff
+	0xA3, 0x98, 0x43, 0xE5, 0xA3, 0x9F, 0x43, 0xE5,
+	0xA3, 0xAB, 0x43, 0xE5, 0xA3, 0xAE, 0x43, 0xE5,
+	0xA3, 0xB0, 0x43, 0xE5, 0xA3, 0xB2, 0x43, 0xE5,
+	0xA3, 0xB7, 0x43, 0xE5, 0xA4, 0x82, 0x43, 0xE5,
+	0xA4, 0x86, 0x43, 0xE5, 0xA4, 0x8A, 0x43, 0xE5,
+	0xA4, 0x95, 0x43, 0xE5, 0xA4, 0x9A, 0x43, 0xE5,
+	0xA4, 0x9C, 0x43, 0xE5, 0xA4, 0xA2, 0x43, 0xE5,
+	0xA4, 0xA7, 0x43, 0xE5, 0xA4, 0xA9, 0x43, 0xE5,
+	// Bytes b00 - b3f
+	0xA5, 0x84, 0x43, 0xE5, 0xA5, 0x88, 0x43, 0xE5,
+	0xA5, 0x91, 0x43, 0xE5, 0xA5, 0x94, 0x43, 0xE5,
+	0xA5, 0xA2, 0x43, 0xE5, 0xA5, 0xB3, 0x43, 0xE5,
+	0xA7, 0x98, 0x43, 0xE5, 0xA7, 0xAC, 0x43, 0xE5,
+	0xA8, 0x9B, 0x43, 0xE5, 0xA8, 0xA7, 0x43, 0xE5,
+	0xA9, 0xA2, 0x43, 0xE5, 0xA9, 0xA6, 0x43, 0xE5,
+	0xAA, 0xB5, 0x43, 0xE5, 0xAC, 0x88, 0x43, 0xE5,
+	0xAC, 0xA8, 0x43, 0xE5, 0xAC, 0xBE, 0x43, 0xE5,
+	// Bytes b40 - b7f
+	0xAD, 0x90, 0x43, 0xE5, 0xAD, 0x97, 0x43, 0xE5,
+	0xAD, 0xA6, 0x43, 0xE5, 0xAE, 0x80, 0x43, 0xE5,
+	0xAE, 0x85, 0x43, 0xE5, 0xAE, 0x97, 0x43, 0xE5,
+	0xAF, 0x83, 0x43, 0xE5, 0xAF, 0x98, 0x43, 0xE5,
+	0xAF, 0xA7, 0x43, 0xE5, 0xAF, 0xAE, 0x43, 0xE5,
+	0xAF, 0xB3, 0x43, 0xE5, 0xAF, 0xB8, 0x43, 0xE5,
+	0xAF, 0xBF, 0x43, 0xE5, 0xB0, 0x86, 0x43, 0xE5,
+	0xB0, 0x8F, 0x43, 0xE5, 0xB0, 0xA2, 0x43, 0xE5,
+	// Bytes b80 - bbf
+	0xB0, 0xB8, 0x43, 0xE5, 0xB0, 0xBF, 0x43, 0xE5,
+	0xB1, 0xA0, 0x43, 0xE5, 0xB1, 0xA2, 0x43, 0xE5,
+	0xB1, 0xA4, 0x43, 0xE5, 0xB1, 0xA5, 0x43, 0xE5,
+	0xB1, 0xAE, 0x43, 0xE5, 0xB1, 0xB1, 0x43, 0xE5,
+	0xB2, 0x8D, 0x43, 0xE5, 0xB3, 0x80, 0x43, 0xE5,
+	0xB4, 0x99, 0x43, 0xE5, 0xB5, 0x83, 0x43, 0xE5,
+	0xB5, 0x90, 0x43, 0xE5, 0xB5, 0xAB, 0x43, 0xE5,
+	0xB5, 0xAE, 0x43, 0xE5, 0xB5, 0xBC, 0x43, 0xE5,
+	// Bytes bc0 - bff
+	0xB6, 0xB2, 0x43, 0xE5, 0xB6, 0xBA, 0x43, 0xE5,
+	0xB7, 0x9B, 0x43, 0xE5, 0xB7, 0xA1, 0x43, 0xE5,
+	0xB7, 0xA2, 0x43, 0xE5, 0xB7, 0xA5, 0x43, 0xE5,
+	0xB7, 0xA6, 0x43, 0xE5, 0xB7, 0xB1, 0x43, 0xE5,
+	0xB7, 0xBD, 0x43, 0xE5, 0xB7, 0xBE, 0x43, 0xE5,
+	0xB8, 0xA8, 0x43, 0xE5, 0xB8, 0xBD, 0x43, 0xE5,
+	0xB9, 0xA9, 0x43, 0xE5, 0xB9, 0xB2, 0x43, 0xE5,
+	0xB9, 0xB4, 0x43, 0xE5, 0xB9, 0xBA, 0x43, 0xE5,
+	// Bytes c00 - c3f
+	0xB9, 0xBC, 0x43, 0xE5, 0xB9, 0xBF, 0x43, 0xE5,
+	0xBA, 0xA6, 0x43, 0xE5, 0xBA, 0xB0, 0x43, 0xE5,
+	0xBA, 0xB3, 0x43, 0xE5, 0xBA, 0xB6, 0x43, 0xE5,
+	0xBB, 0x89, 0x43, 0xE5, 0xBB, 0x8A, 0x43, 0xE5,
+	0xBB, 0x92, 0x43, 0xE5, 0xBB, 0x93, 0x43, 0xE5,
+	0xBB, 0x99, 0x43, 0xE5, 0xBB, 0xAC, 0x43, 0xE5,
+	0xBB, 0xB4, 0x43, 0xE5, 0xBB, 0xBE, 0x43, 0xE5,
+	0xBC, 0x84, 0x43, 0xE5, 0xBC, 0x8B, 0x43, 0xE5,
+	// Bytes c40 - c7f
+	0xBC, 0x93, 0x43, 0xE5, 0xBC, 0xA2, 0x43, 0xE5,
+	0xBD, 0x90, 0x43, 0xE5, 0xBD, 0x93, 0x43, 0xE5,
+	0xBD, 0xA1, 0x43, 0xE5, 0xBD, 0xA2, 0x43, 0xE5,
+	0xBD, 0xA9, 0x43, 0xE5, 0xBD, 0xAB, 0x43, 0xE5,
+	0xBD, 0xB3, 0x43, 0xE5, 0xBE, 0x8B, 0x43, 0xE5,
+	0xBE, 0x8C, 0x43, 0xE5, 0xBE, 0x97, 0x43, 0xE5,
+	0xBE, 0x9A, 0x43, 0xE5, 0xBE, 0xA9, 0x43, 0xE5,
+	0xBE, 0xAD, 0x43, 0xE5, 0xBF, 0x83, 0x43, 0xE5,
+	// Bytes c80 - cbf
+	0xBF, 0x8D, 0x43, 0xE5, 0xBF, 0x97, 0x43, 0xE5,
+	0xBF, 0xB5, 0x43, 0xE5, 0xBF, 0xB9, 0x43, 0xE6,
+	0x80, 0x92, 0x43, 0xE6, 0x80, 0x9C, 0x43, 0xE6,
+	0x81, 0xB5, 0x43, 0xE6, 0x82, 0x81, 0x43, 0xE6,
+	0x82, 0x94, 0x43, 0xE6, 0x83, 0x87, 0x43, 0xE6,
+	0x83, 0x98, 0x43, 0xE6, 0x83, 0xA1, 0x43, 0xE6,
+	0x84, 0x88, 0x43, 0xE6, 0x85, 0x84, 0x43, 0xE6,
+	0x85, 0x88, 0x43, 0xE6, 0x85, 0x8C, 0x43, 0xE6,
+	// Bytes cc0 - cff
+	0x85, 0x8E, 0x43, 0xE6, 0x85, 0xA0, 0x43, 0xE6,
+	0x85, 0xA8, 0x43, 0xE6, 0x85, 0xBA, 0x43, 0xE6,
+	0x86, 0x8E, 0x43, 0xE6, 0x86, 0x90, 0x43, 0xE6,
+	0x86, 0xA4, 0x43, 0xE6, 0x86, 0xAF, 0x43, 0xE6,
+	0x86, 0xB2, 0x43, 0xE6, 0x87, 0x9E, 0x43, 0xE6,
+	0x87, 0xB2, 0x43, 0xE6, 0x87, 0xB6, 0x43, 0xE6,
+	0x88, 0x80, 0x43, 0xE6, 0x88, 0x88, 0x43, 0xE6,
+	0x88, 0x90, 0x43, 0xE6, 0x88, 0x9B, 0x43, 0xE6,
+	// Bytes d00 - d3f
+	0x88, 0xAE, 0x43, 0xE6, 0x88, 0xB4, 0x43, 0xE6,
+	0x88, 0xB6, 0x43, 0xE6, 0x89, 0x8B, 0x43, 0xE6,
+	0x89, 0x93, 0x43, 0xE6, 0x89, 0x9D, 0x43, 0xE6,
+	0x8A, 0x95, 0x43, 0xE6, 0x8A, 0xB1, 0x43, 0xE6,
+	0x8B, 0x89, 0x43, 0xE6, 0x8B, 0x8F, 0x43, 0xE6,
+	0x8B, 0x93, 0x43, 0xE6, 0x8B, 0x94, 0x43, 0xE6,
+	0x8B, 0xBC, 0x43, 0xE6, 0x8B, 0xBE, 0x43, 0xE6,
+	0x8C, 0x87, 0x43, 0xE6, 0x8C, 0xBD, 0x43, 0xE6,
+	// Bytes d40 - d7f
+	0x8D, 0x90, 0x43, 0xE6, 0x8D, 0x95, 0x43, 0xE6,
+	0x8D, 0xA8, 0x43, 0xE6, 0x8D, 0xBB, 0x43, 0xE6,
+	0x8E, 0x83, 0x43, 0xE6, 0x8E, 0xA0, 0x43, 0xE6,
+	0x8E, 0xA9, 0x43, 0xE6, 0x8F, 0x84, 0x43, 0xE6,
+	0x8F, 0x85, 0x43, 0xE6, 0x8F, 0xA4, 0x43, 0xE6,
+	0x90, 0x9C, 0x43, 0xE6, 0x90, 0xA2, 0x43, 0xE6,
+	0x91, 0x92, 0x43, 0xE6, 0x91, 0xA9, 0x43, 0xE6,
+	0x91, 0xB7, 0x43, 0xE6, 0x91, 0xBE, 0x43, 0xE6,
+	// Bytes d80 - dbf
+	0x92, 0x9A, 0x43, 0xE6, 0x92, 0x9D, 0x43, 0xE6,
+	0x93, 0x84, 0x43, 0xE6, 0x94, 0xAF, 0x43, 0xE6,
+	0x94, 0xB4, 0x43, 0xE6, 0x95, 0x8F, 0x43, 0xE6,
+	0x95, 0x96, 0x43, 0xE6, 0x95, 0xAC, 0x43, 0xE6,
+	0x95, 0xB8, 0x43, 0xE6, 0x96, 0x87, 0x43, 0xE6,
+	0x96, 0x97, 0x43, 0xE6, 0x96, 0x99, 0x43, 0xE6,
+	0x96, 0xA4, 0x43, 0xE6, 0x96, 0xB0, 0x43, 0xE6,
+	0x96, 0xB9, 0x43, 0xE6, 0x97, 0x85, 0x43, 0xE6,
+	// Bytes dc0 - dff
+	0x97, 0xA0, 0x43, 0xE6, 0x97, 0xA2, 0x43, 0xE6,
+	0x97, 0xA3, 0x43, 0xE6, 0x97, 0xA5, 0x43, 0xE6,
+	0x98, 0x93, 0x43, 0xE6, 0x98, 0xA0, 0x43, 0xE6,
+	0x99, 0x89, 0x43, 0xE6, 0x99, 0xB4, 0x43, 0xE6,
+	0x9A, 0x88, 0x43, 0xE6, 0x9A, 0x91, 0x43, 0xE6,
+	0x9A, 0x9C, 0x43, 0xE6, 0x9A, 0xB4, 0x43, 0xE6,
+	0x9B, 0x86, 0x43, 0xE6, 0x9B, 0xB0, 0x43, 0xE6,
+	0x9B, 0xB4, 0x43, 0xE6, 0x9B, 0xB8, 0x43, 0xE6,
+	// Bytes e00 - e3f
+	0x9C, 0x80, 0x43, 0xE6, 0x9C, 0x88, 0x43, 0xE6,
+	0x9C, 0x89, 0x43, 0xE6, 0x9C, 0x97, 0x43, 0xE6,
+	0x9C, 0x9B, 0x43, 0xE6, 0x9C, 0xA1, 0x43, 0xE6,
+	0x9C, 0xA8, 0x43, 0xE6, 0x9D, 0x8E, 0x43, 0xE6,
+	0x9D, 0x93, 0x43, 0xE6, 0x9D, 0x96, 0x43, 0xE6,
+	0x9D, 0x9E, 0x43, 0xE6, 0x9D, 0xBB, 0x43, 0xE6,
+	0x9E, 0x85, 0x43, 0xE6, 0x9E, 0x97, 0x43, 0xE6,
+	0x9F, 0xB3, 0x43, 0xE6, 0x9F, 0xBA, 0x43, 0xE6,
+	// Bytes e40 - e7f
+	0xA0, 0x97, 0x43, 0xE6, 0xA0, 0x9F, 0x43, 0xE6,
+	0xA0, 0xAA, 0x43, 0xE6, 0xA1, 0x92, 0x43, 0xE6,
+	0xA2, 0x81, 0x43, 0xE6, 0xA2, 0x85, 0x43, 0xE6,
+	0xA2, 0x8E, 0x43, 0xE6, 0xA2, 0xA8, 0x43, 0xE6,
+	0xA4, 0x94, 0x43, 0xE6, 0xA5, 0x82, 0x43, 0xE6,
+	0xA6, 0xA3, 0x43, 0xE6, 0xA7, 0xAA, 0x43, 0xE6,
+	0xA8, 0x82, 0x43, 0xE6, 0xA8, 0x93, 0x43, 0xE6,
+	0xAA, 0xA8, 0x43, 0xE6, 0xAB, 0x93, 0x43, 0xE6,
+	// Bytes e80 - ebf
+	0xAB, 0x9B, 0x43, 0xE6, 0xAC, 0x84, 0x43, 0xE6,
+	0xAC, 0xA0, 0x43, 0xE6, 0xAC, 0xA1, 0x43, 0xE6,
+	0xAD, 0x94, 0x43, 0xE6, 0xAD, 0xA2, 0x43, 0xE6,
+	0xAD, 0xA3, 0x43, 0xE6, 0xAD, 0xB2, 0x43, 0xE6,
+	0xAD, 0xB7, 0x43, 0xE6, 0xAD, 0xB9, 0x43, 0xE6,
+	0xAE, 0x9F, 0x43, 0xE6, 0xAE, 0xAE, 0x43, 0xE6,
+	0xAE, 0xB3, 0x43, 0xE6, 0xAE, 0xBA, 0x43, 0xE6,
+	0xAE, 0xBB, 0x43, 0xE6, 0xAF, 0x8B, 0x43, 0xE6,
+	// Bytes ec0 - eff
+	0xAF, 0x8D, 0x43, 0xE6, 0xAF, 0x94, 0x43, 0xE6,
+	0xAF, 0x9B, 0x43, 0xE6, 0xB0, 0x8F, 0x43, 0xE6,
+	0xB0, 0x94, 0x43, 0xE6, 0xB0, 0xB4, 0x43, 0xE6,
+	0xB1, 0x8E, 0x43, 0xE6, 0xB1, 0xA7, 0x43, 0xE6,
+	0xB2, 0x88, 0x43, 0xE6, 0xB2, 0xBF, 0x43, 0xE6,
+	0xB3, 0x8C, 0x43, 0xE6, 0xB3, 0x8D, 0x43, 0xE6,
+	0xB3, 0xA5, 0x43, 0xE6, 0xB3, 0xA8, 0x43, 0xE6,
+	0xB4, 0x96, 0x43, 0xE6, 0xB4, 0x9B, 0x43, 0xE6,
+	// Bytes f00 - f3f
+	0xB4, 0x9E, 0x43, 0xE6, 0xB4, 0xB4, 0x43, 0xE6,
+	0xB4, 0xBE, 0x43, 0xE6, 0xB5, 0x81, 0x43, 0xE6,
+	0xB5, 0xA9, 0x43, 0xE6, 0xB5, 0xAA, 0x43, 0xE6,
+	0xB5, 0xB7, 0x43, 0xE6, 0xB5, 0xB8, 0x43, 0xE6,
+	0xB6, 0x85, 0x43, 0xE6, 0xB7, 0x8B, 0x43, 0xE6,
+	0xB7, 0x9A, 0x43, 0xE6, 0xB7, 0xAA, 0x43, 0xE6,
+	0xB7, 0xB9, 0x43, 0xE6, 0xB8, 0x9A, 0x43, 0xE6,
+	0xB8, 0xAF, 0x43, 0xE6, 0xB9, 0xAE, 0x43, 0xE6,
+	// Bytes f40 - f7f
+	0xBA, 0x80, 0x43, 0xE6, 0xBA, 0x9C, 0x43, 0xE6,
+	0xBA, 0xBA, 0x43, 0xE6, 0xBB, 0x87, 0x43, 0xE6,
+	0xBB, 0x8B, 0x43, 0xE6, 0xBB, 0x91, 0x43, 0xE6,
+	0xBB, 0x9B, 0x43, 0xE6, 0xBC, 0x8F, 0x43, 0xE6,
+	0xBC, 0x94, 0x43, 0xE6, 0xBC, 0xA2, 0x43, 0xE6,
+	0xBC, 0xA3, 0x43, 0xE6, 0xBD, 0xAE, 0x43, 0xE6,
+	0xBF, 0x86, 0x43, 0xE6, 0xBF, 0xAB, 0x43, 0xE6,
+	0xBF, 0xBE, 0x43, 0xE7, 0x80, 0x9B, 0x43, 0xE7,
+	// Bytes f80 - fbf
+	0x80, 0x9E, 0x43, 0xE7, 0x80, 0xB9, 0x43, 0xE7,
+	0x81, 0x8A, 0x43, 0xE7, 0x81, 0xAB, 0x43, 0xE7,
+	0x81, 0xB0, 0x43, 0xE7, 0x81, 0xB7, 0x43, 0xE7,
+	0x81, 0xBD, 0x43, 0xE7, 0x82, 0x99, 0x43, 0xE7,
+	0x82, 0xAD, 0x43, 0xE7, 0x83, 0x88, 0x43, 0xE7,
+	0x83, 0x99, 0x43, 0xE7, 0x84, 0xA1, 0x43, 0xE7,
+	0x85, 0x85, 0x43, 0xE7, 0x85, 0x89, 0x43, 0xE7,
+	0x85, 0xAE, 0x43, 0xE7, 0x86, 0x9C, 0x43, 0xE7,
+	// Bytes fc0 - fff
+	0x87, 0x8E, 0x43, 0xE7, 0x87, 0x90, 0x43, 0xE7,
+	0x88, 0x90, 0x43, 0xE7, 0x88, 0x9B, 0x43, 0xE7,
+	0x88, 0xA8, 0x43, 0xE7, 0x88, 0xAA, 0x43, 0xE7,
+	0x88, 0xAB, 0x43, 0xE7, 0x88, 0xB5, 0x43, 0xE7,
+	0x88, 0xB6, 0x43, 0xE7, 0x88, 0xBB, 0x43, 0xE7,
+	0x88, 0xBF, 0x43, 0xE7, 0x89, 0x87, 0x43, 0xE7,
+	0x89, 0x90, 0x43, 0xE7, 0x89, 0x99, 0x43, 0xE7,
+	0x89, 0x9B, 0x43, 0xE7, 0x89, 0xA2, 0x43, 0xE7,
+	// Bytes 1000 - 103f
+	0x89, 0xB9, 0x43, 0xE7, 0x8A, 0x80, 0x43, 0xE7,
+	0x8A, 0x95, 0x43, 0xE7, 0x8A, 0xAC, 0x43, 0xE7,
+	0x8A, 0xAF, 0x43, 0xE7, 0x8B, 0x80, 0x43, 0xE7,
+	0x8B, 0xBC, 0x43, 0xE7, 0x8C, 0xAA, 0x43, 0xE7,
+	0x8D, 0xB5, 0x43, 0xE7, 0x8D, 0xBA, 0x43, 0xE7,
+	0x8E, 0x84, 0x43, 0xE7, 0x8E, 0x87, 0x43, 0xE7,
+	0x8E, 0x89, 0x43, 0xE7, 0x8E, 0x8B, 0x43, 0xE7,
+	0x8E, 0xA5, 0x43, 0xE7, 0x8E, 0xB2, 0x43, 0xE7,
+	// Bytes 1040 - 107f
+	0x8F, 0x9E, 0x43, 0xE7, 0x90, 0x86, 0x43, 0xE7,
+	0x90, 0x89, 0x43, 0xE7, 0x90, 0xA2, 0x43, 0xE7,
+	0x91, 0x87, 0x43, 0xE7, 0x91, 0x9C, 0x43, 0xE7,
+	0x91, 0xA9, 0x43, 0xE7, 0x91, 0xB1, 0x43, 0xE7,
+	0x92, 0x85, 0x43, 0xE7, 0x92, 0x89, 0x43, 0xE7,
+	0x92, 0x98, 0x43, 0xE7, 0x93, 0x8A, 0x43, 0xE7,
+	0x93, 0x9C, 0x43, 0xE7, 0x93, 0xA6, 0x43, 0xE7,
+	0x94, 0x86, 0x43, 0xE7, 0x94, 0x98, 0x43, 0xE7,
+	// Bytes 1080 - 10bf
+	0x94, 0x9F, 0x43, 0xE7, 0x94, 0xA4, 0x43, 0xE7,
+	0x94, 0xA8, 0x43, 0xE7, 0x94, 0xB0, 0x43, 0xE7,
+	0x94, 0xB2, 0x43, 0xE7, 0x94, 0xB3, 0x43, 0xE7,
+	0x94, 0xB7, 0x43, 0xE7, 0x94, 0xBB, 0x43, 0xE7,
+	0x94, 0xBE, 0x43, 0xE7, 0x95, 0x99, 0x43, 0xE7,
+	0x95, 0xA5, 0x43, 0xE7, 0x95, 0xB0, 0x43, 0xE7,
+	0x96, 0x8B, 0x43, 0xE7, 0x96, 0x92, 0x43, 0xE7,
+	0x97, 0xA2, 0x43, 0xE7, 0x98, 0x90, 0x43, 0xE7,
+	// Bytes 10c0 - 10ff
+	0x98, 0x9D, 0x43, 0xE7, 0x98, 0x9F, 0x43, 0xE7,
+	0x99, 0x82, 0x43, 0xE7, 0x99, 0xA9, 0x43, 0xE7,
+	0x99, 0xB6, 0x43, 0xE7, 0x99, 0xBD, 0x43, 0xE7,
+	0x9A, 0xAE, 0x43, 0xE7, 0x9A, 0xBF, 0x43, 0xE7,
+	0x9B, 0x8A, 0x43, 0xE7, 0x9B, 0x9B, 0x43, 0xE7,
+	0x9B, 0xA3, 0x43, 0xE7, 0x9B, 0xA7, 0x43, 0xE7,
+	0x9B, 0xAE, 0x43, 0xE7, 0x9B, 0xB4, 0x43, 0xE7,
+	0x9C, 0x81, 0x43, 0xE7, 0x9C, 0x9E, 0x43, 0xE7,
+	// Bytes 1100 - 113f
+	0x9C, 0x9F, 0x43, 0xE7, 0x9D, 0x80, 0x43, 0xE7,
+	0x9D, 0x8A, 0x43, 0xE7, 0x9E, 0x8B, 0x43, 0xE7,
+	0x9E, 0xA7, 0x43, 0xE7, 0x9F, 0x9B, 0x43, 0xE7,
+	0x9F, 0xA2, 0x43, 0xE7, 0x9F, 0xB3, 0x43, 0xE7,
+	0xA1, 0x8E, 0x43, 0xE7, 0xA1, 0xAB, 0x43, 0xE7,
+	0xA2, 0x8C, 0x43, 0xE7, 0xA2, 0x91, 0x43, 0xE7,
+	0xA3, 0x8A, 0x43, 0xE7, 0xA3, 0x8C, 0x43, 0xE7,
+	0xA3, 0xBB, 0x43, 0xE7, 0xA4, 0xAA, 0x43, 0xE7,
+	// Bytes 1140 - 117f
+	0xA4, 0xBA, 0x43, 0xE7, 0xA4, 0xBC, 0x43, 0xE7,
+	0xA4, 0xBE, 0x43, 0xE7, 0xA5, 0x88, 0x43, 0xE7,
+	0xA5, 0x89, 0x43, 0xE7, 0xA5, 0x90, 0x43, 0xE7,
+	0xA5, 0x96, 0x43, 0xE7, 0xA5, 0x9D, 0x43, 0xE7,
+	0xA5, 0x9E, 0x43, 0xE7, 0xA5, 0xA5, 0x43, 0xE7,
+	0xA5, 0xBF, 0x43, 0xE7, 0xA6, 0x81, 0x43, 0xE7,
+	0xA6, 0x8D, 0x43, 0xE7, 0xA6, 0x8E, 0x43, 0xE7,
+	0xA6, 0x8F, 0x43, 0xE7, 0xA6, 0xAE, 0x43, 0xE7,
+	// Bytes 1180 - 11bf
+	0xA6, 0xB8, 0x43, 0xE7, 0xA6, 0xBE, 0x43, 0xE7,
+	0xA7, 0x8A, 0x43, 0xE7, 0xA7, 0x98, 0x43, 0xE7,
+	0xA7, 0xAB, 0x43, 0xE7, 0xA8, 0x9C, 0x43, 0xE7,
+	0xA9, 0x80, 0x43, 0xE7, 0xA9, 0x8A, 0x43, 0xE7,
+	0xA9, 0x8F, 0x43, 0xE7, 0xA9, 0xB4, 0x43, 0xE7,
+	0xA9, 0xBA, 0x43, 0xE7, 0xAA, 0x81, 0x43, 0xE7,
+	0xAA, 0xB1, 0x43, 0xE7, 0xAB, 0x8B, 0x43, 0xE7,
+	0xAB, 0xAE, 0x43, 0xE7, 0xAB, 0xB9, 0x43, 0xE7,
+	// Bytes 11c0 - 11ff
+	0xAC, 0xA0, 0x43, 0xE7, 0xAE, 0x8F, 0x43, 0xE7,
+	0xAF, 0x80, 0x43, 0xE7, 0xAF, 0x86, 0x43, 0xE7,
+	0xAF, 0x89, 0x43, 0xE7, 0xB0, 0xBE, 0x43, 0xE7,
+	0xB1, 0xA0, 0x43, 0xE7, 0xB1, 0xB3, 0x43, 0xE7,
+	0xB1, 0xBB, 0x43, 0xE7, 0xB2, 0x92, 0x43, 0xE7,
+	0xB2, 0xBE, 0x43, 0xE7, 0xB3, 0x92, 0x43, 0xE7,
+	0xB3, 0x96, 0x43, 0xE7, 0xB3, 0xA3, 0x43, 0xE7,
+	0xB3, 0xA7, 0x43, 0xE7, 0xB3, 0xA8, 0x43, 0xE7,
+	// Bytes 1200 - 123f
+	0xB3, 0xB8, 0x43, 0xE7, 0xB4, 0x80, 0x43, 0xE7,
+	0xB4, 0x90, 0x43, 0xE7, 0xB4, 0xA2, 0x43, 0xE7,
+	0xB4, 0xAF, 0x43, 0xE7, 0xB5, 0x82, 0x43, 0xE7,
+	0xB5, 0x9B, 0x43, 0xE7, 0xB5, 0xA3, 0x43, 0xE7,
+	0xB6, 0xA0, 0x43, 0xE7, 0xB6, 0xBE, 0x43, 0xE7,
+	0xB7, 0x87, 0x43, 0xE7, 0xB7, 0xB4, 0x43, 0xE7,
+	0xB8, 0x82, 0x43, 0xE7, 0xB8, 0x89, 0x43, 0xE7,
+	0xB8, 0xB7, 0x43, 0xE7, 0xB9, 0x81, 0x43, 0xE7,
+	// Bytes 1240 - 127f
+	0xB9, 0x85, 0x43, 0xE7, 0xBC, 0xB6, 0x43, 0xE7,
+	0xBC, 0xBE, 0x43, 0xE7, 0xBD, 0x91, 0x43, 0xE7,
+	0xBD, 0xB2, 0x43, 0xE7, 0xBD, 0xB9, 0x43, 0xE7,
+	0xBD, 0xBA, 0x43, 0xE7, 0xBE, 0x85, 0x43, 0xE7,
+	0xBE, 0x8A, 0x43, 0xE7, 0xBE, 0x95, 0x43, 0xE7,
+	0xBE, 0x9A, 0x43, 0xE7, 0xBE, 0xBD, 0x43, 0xE7,
+	0xBF, 0xBA, 0x43, 0xE8, 0x80, 0x81, 0x43, 0xE8,
+	0x80, 0x85, 0x43, 0xE8, 0x80, 0x8C, 0x43, 0xE8,
+	// Bytes 1280 - 12bf
+	0x80, 0x92, 0x43, 0xE8, 0x80, 0xB3, 0x43, 0xE8,
+	0x81, 0x86, 0x43, 0xE8, 0x81, 0xA0, 0x43, 0xE8,
+	0x81, 0xAF, 0x43, 0xE8, 0x81, 0xB0, 0x43, 0xE8,
+	0x81, 0xBE, 0x43, 0xE8, 0x81, 0xBF, 0x43, 0xE8,
+	0x82, 0x89, 0x43, 0xE8, 0x82, 0x8B, 0x43, 0xE8,
+	0x82, 0xAD, 0x43, 0xE8, 0x82, 0xB2, 0x43, 0xE8,
+	0x84, 0x83, 0x43, 0xE8, 0x84, 0xBE, 0x43, 0xE8,
+	0x87, 0x98, 0x43, 0xE8, 0x87, 0xA3, 0x43, 0xE8,
+	// Bytes 12c0 - 12ff
+	0x87, 0xA8, 0x43, 0xE8, 0x87, 0xAA, 0x43, 0xE8,
+	0x87, 0xAD, 0x43, 0xE8, 0x87, 0xB3, 0x43, 0xE8,
+	0x87, 0xBC, 0x43, 0xE8, 0x88, 0x81, 0x43, 0xE8,
+	0x88, 0x84, 0x43, 0xE8, 0x88, 0x8C, 0x43, 0xE8,
+	0x88, 0x98, 0x43, 0xE8, 0x88, 0x9B, 0x43, 0xE8,
+	0x88, 0x9F, 0x43, 0xE8, 0x89, 0xAE, 0x43, 0xE8,
+	0x89, 0xAF, 0x43, 0xE8, 0x89, 0xB2, 0x43, 0xE8,
+	0x89, 0xB8, 0x43, 0xE8, 0x89, 0xB9, 0x43, 0xE8,
+	// Bytes 1300 - 133f
+	0x8A, 0x8B, 0x43, 0xE8, 0x8A, 0x91, 0x43, 0xE8,
+	0x8A, 0x9D, 0x43, 0xE8, 0x8A, 0xB1, 0x43, 0xE8,
+	0x8A, 0xB3, 0x43, 0xE8, 0x8A, 0xBD, 0x43, 0xE8,
+	0x8B, 0xA5, 0x43, 0xE8, 0x8B, 0xA6, 0x43, 0xE8,
+	0x8C, 0x9D, 0x43, 0xE8, 0x8C, 0xA3, 0x43, 0xE8,
+	0x8C, 0xB6, 0x43, 0xE8, 0x8D, 0x92, 0x43, 0xE8,
+	0x8D, 0x93, 0x43, 0xE8, 0x8D, 0xA3, 0x43, 0xE8,
+	0x8E, 0xAD, 0x43, 0xE8, 0x8E, 0xBD, 0x43, 0xE8,
+	// Bytes 1340 - 137f
+	0x8F, 0x89, 0x43, 0xE8, 0x8F, 0x8A, 0x43, 0xE8,
+	0x8F, 0x8C, 0x43, 0xE8, 0x8F, 0x9C, 0x43, 0xE8,
+	0x8F, 0xA7, 0x43, 0xE8, 0x8F, 0xAF, 0x43, 0xE8,
+	0x8F, 0xB1, 0x43, 0xE8, 0x90, 0xBD, 0x43, 0xE8,
+	0x91, 0x89, 0x43, 0xE8, 0x91, 0x97, 0x43, 0xE8,
+	0x93, 0xAE, 0x43, 0xE8, 0x93, 0xB1, 0x43, 0xE8,
+	0x93, 0xB3, 0x43, 0xE8, 0x93, 0xBC, 0x43, 0xE8,
+	0x94, 0x96, 0x43, 0xE8, 0x95, 0xA4, 0x43, 0xE8,
+	// Bytes 1380 - 13bf
+	0x97, 0x8D, 0x43, 0xE8, 0x97, 0xBA, 0x43, 0xE8,
+	0x98, 0x86, 0x43, 0xE8, 0x98, 0x92, 0x43, 0xE8,
+	0x98, 0xAD, 0x43, 0xE8, 0x98, 0xBF, 0x43, 0xE8,
+	0x99, 0x8D, 0x43, 0xE8, 0x99, 0x90, 0x43, 0xE8,
+	0x99, 0x9C, 0x43, 0xE8, 0x99, 0xA7, 0x43, 0xE8,
+	0x99, 0xA9, 0x43, 0xE8, 0x99, 0xAB, 0x43, 0xE8,
+	0x9A, 0x88, 0x43, 0xE8, 0x9A, 0xA9, 0x43, 0xE8,
+	0x9B, 0xA2, 0x43, 0xE8, 0x9C, 0x8E, 0x43, 0xE8,
+	// Bytes 13c0 - 13ff
+	0x9C, 0xA8, 0x43, 0xE8, 0x9D, 0xAB, 0x43, 0xE8,
+	0x9D, 0xB9, 0x43, 0xE8, 0x9E, 0x86, 0x43, 0xE8,
+	0x9E, 0xBA, 0x43, 0xE8, 0x9F, 0xA1, 0x43, 0xE8,
+	0xA0, 0x81, 0x43, 0xE8, 0xA0, 0x9F, 0x43, 0xE8,
+	0xA1, 0x80, 0x43, 0xE8, 0xA1, 0x8C, 0x43, 0xE8,
+	0xA1, 0xA0, 0x43, 0xE8, 0xA1, 0xA3, 0x43, 0xE8,
+	0xA3, 0x82, 0x43, 0xE8, 0xA3, 0x8F, 0x43, 0xE8,
+	0xA3, 0x97, 0x43, 0xE8, 0xA3, 0x9E, 0x43, 0xE8,
+	// Bytes 1400 - 143f
+	0xA3, 0xA1, 0x43, 0xE8, 0xA3, 0xB8, 0x43, 0xE8,
+	0xA3, 0xBA, 0x43, 0xE8, 0xA4, 0x90, 0x43, 0xE8,
+	0xA5, 0x81, 0x43, 0xE8, 0xA5, 0xA4, 0x43, 0xE8,
+	0xA5, 0xBE, 0x43, 0xE8, 0xA6, 0x86, 0x43, 0xE8,
+	0xA6, 0x8B, 0x43, 0xE8, 0xA6, 0x96, 0x43, 0xE8,
+	0xA7, 0x92, 0x43, 0xE8, 0xA7, 0xA3, 0x43, 0xE8,
+	0xA8, 0x80, 0x43, 0xE8, 0xAA, 0xA0, 0x43, 0xE8,
+	0xAA, 0xAA, 0x43, 0xE8, 0xAA, 0xBF, 0x43, 0xE8,
+	// Bytes 1440 - 147f
+	0xAB, 0x8B, 0x43, 0xE8, 0xAB, 0x92, 0x43, 0xE8,
+	0xAB, 0x96, 0x43, 0xE8, 0xAB, 0xAD, 0x43, 0xE8,
+	0xAB, 0xB8, 0x43, 0xE8, 0xAB, 0xBE, 0x43, 0xE8,
+	0xAC, 0x81, 0x43, 0xE8, 0xAC, 0xB9, 0x43, 0xE8,
+	0xAD, 0x98, 0x43, 0xE8, 0xAE, 0x80, 0x43, 0xE8,
+	0xAE, 0x8A, 0x43, 0xE8, 0xB0, 0xB7, 0x43, 0xE8,
+	0xB1, 0x86, 0x43, 0xE8, 0xB1, 0x88, 0x43, 0xE8,
+	0xB1, 0x95, 0x43, 0xE8, 0xB1, 0xB8, 0x43, 0xE8,
+	// Bytes 1480 - 14bf
+	0xB2, 0x9D, 0x43, 0xE8, 0xB2, 0xA1, 0x43, 0xE8,
+	0xB2, 0xA9, 0x43, 0xE8, 0xB2, 0xAB, 0x43, 0xE8,
+	0xB3, 0x81, 0x43, 0xE8, 0xB3, 0x82, 0x43, 0xE8,
+	0xB3, 0x87, 0x43, 0xE8, 0xB3, 0x88, 0x43, 0xE8,
+	0xB3, 0x93, 0x43, 0xE8, 0xB4, 0x88, 0x43, 0xE8,
+	0xB4, 0x9B, 0x43, 0xE8, 0xB5, 0xA4, 0x43, 0xE8,
+	0xB5, 0xB0, 0x43, 0xE8, 0xB5, 0xB7, 0x43, 0xE8,
+	0xB6, 0xB3, 0x43, 0xE8, 0xB6, 0xBC, 0x43, 0xE8,
+	// Bytes 14c0 - 14ff
+	0xB7, 0x8B, 0x43, 0xE8, 0xB7, 0xAF, 0x43, 0xE8,
+	0xB7, 0xB0, 0x43, 0xE8, 0xBA, 0xAB, 0x43, 0xE8,
+	0xBB, 0x8A, 0x43, 0xE8, 0xBB, 0x94, 0x43, 0xE8,
+	0xBC, 0xA6, 0x43, 0xE8, 0xBC, 0xAA, 0x43, 0xE8,
+	0xBC, 0xB8, 0x43, 0xE8, 0xBC, 0xBB, 0x43, 0xE8,
+	0xBD, 0xA2, 0x43, 0xE8, 0xBE, 0x9B, 0x43, 0xE8,
+	0xBE, 0x9E, 0x43, 0xE8, 0xBE, 0xB0, 0x43, 0xE8,
+	0xBE, 0xB5, 0x43, 0xE8, 0xBE, 0xB6, 0x43, 0xE9,
+	// Bytes 1500 - 153f
+	0x80, 0xA3, 0x43, 0xE9, 0x80, 0xB8, 0x43, 0xE9,
+	0x81, 0x8A, 0x43, 0xE9, 0x81, 0xA9, 0x43, 0xE9,
+	0x81, 0xB2, 0x43, 0xE9, 0x81, 0xBC, 0x43, 0xE9,
+	0x82, 0x8F, 0x43, 0xE9, 0x82, 0x91, 0x43, 0xE9,
+	0x82, 0x94, 0x43, 0xE9, 0x83, 0x8E, 0x43, 0xE9,
+	0x83, 0x9E, 0x43, 0xE9, 0x83, 0xB1, 0x43, 0xE9,
+	0x83, 0xBD, 0x43, 0xE9, 0x84, 0x91, 0x43, 0xE9,
+	0x84, 0x9B, 0x43, 0xE9, 0x85, 0x89, 0x43, 0xE9,
+	// Bytes 1540 - 157f
+	0x85, 0x8D, 0x43, 0xE9, 0x85, 0xAA, 0x43, 0xE9,
+	0x86, 0x99, 0x43, 0xE9, 0x86, 0xB4, 0x43, 0xE9,
+	0x87, 0x86, 0x43, 0xE9, 0x87, 0x8C, 0x43, 0xE9,
+	0x87, 0x8F, 0x43, 0xE9, 0x87, 0x91, 0x43, 0xE9,
+	0x88, 0xB4, 0x43, 0xE9, 0x88, 0xB8, 0x43, 0xE9,
+	0x89, 0xB6, 0x43, 0xE9, 0x89, 0xBC, 0x43, 0xE9,
+	0x8B, 0x97, 0x43, 0xE9, 0x8B, 0x98, 0x43, 0xE9,
+	0x8C, 0x84, 0x43, 0xE9, 0x8D, 0x8A, 0x43, 0xE9,
+	// Bytes 1580 - 15bf
+	0x8F, 0xB9, 0x43, 0xE9, 0x90, 0x95, 0x43, 0xE9,
+	0x95, 0xB7, 0x43, 0xE9, 0x96, 0x80, 0x43, 0xE9,
+	0x96, 0x8B, 0x43, 0xE9, 0x96, 0xAD, 0x43, 0xE9,
+	0x96, 0xB7, 0x43, 0xE9, 0x98, 0x9C, 0x43, 0xE9,
+	0x98, 0xAE, 0x43, 0xE9, 0x99, 0x8B, 0x43, 0xE9,
+	0x99, 0x8D, 0x43, 0xE9, 0x99, 0xB5, 0x43, 0xE9,
+	0x99, 0xB8, 0x43, 0xE9, 0x99, 0xBC, 0x43, 0xE9,
+	0x9A, 0x86, 0x43, 0xE9, 0x9A, 0xA3, 0x43, 0xE9,
+	// Bytes 15c0 - 15ff
+	0x9A, 0xB6, 0x43, 0xE9, 0x9A, 0xB7, 0x43, 0xE9,
+	0x9A, 0xB8, 0x43, 0xE9, 0x9A, 0xB9, 0x43, 0xE9,
+	0x9B, 0x83, 0x43, 0xE9, 0x9B, 0xA2, 0x43, 0xE9,
+	0x9B, 0xA3, 0x43, 0xE9, 0x9B, 0xA8, 0x43, 0xE9,
+	0x9B, 0xB6, 0x43, 0xE9, 0x9B, 0xB7, 0x43, 0xE9,
+	0x9C, 0xA3, 0x43, 0xE9, 0x9C, 0xB2, 0x43, 0xE9,
+	0x9D, 0x88, 0x43, 0xE9, 0x9D, 0x91, 0x43, 0xE9,
+	0x9D, 0x96, 0x43, 0xE9, 0x9D, 0x9E, 0x43, 0xE9,
+	// Bytes 1600 - 163f
+	0x9D, 0xA2, 0x43, 0xE9, 0x9D, 0xA9, 0x43, 0xE9,
+	0x9F, 0x8B, 0x43, 0xE9, 0x9F, 0x9B, 0x43, 0xE9,
+	0x9F, 0xA0, 0x43, 0xE9, 0x9F, 0xAD, 0x43, 0xE9,
+	0x9F, 0xB3, 0x43, 0xE9, 0x9F, 0xBF, 0x43, 0xE9,
+	0xA0, 0x81, 0x43, 0xE9, 0xA0, 0x85, 0x43, 0xE9,
+	0xA0, 0x8B, 0x43, 0xE9, 0xA0, 0x98, 0x43, 0xE9,
+	0xA0, 0xA9, 0x43, 0xE9, 0xA0, 0xBB, 0x43, 0xE9,
+	0xA1, 0x9E, 0x43, 0xE9, 0xA2, 0xA8, 0x43, 0xE9,
+	// Bytes 1640 - 167f
+	0xA3, 0x9B, 0x43, 0xE9, 0xA3, 0x9F, 0x43, 0xE9,
+	0xA3, 0xA2, 0x43, 0xE9, 0xA3, 0xAF, 0x43, 0xE9,
+	0xA3, 0xBC, 0x43, 0xE9, 0xA4, 0xA8, 0x43, 0xE9,
+	0xA4, 0xA9, 0x43, 0xE9, 0xA6, 0x96, 0x43, 0xE9,
+	0xA6, 0x99, 0x43, 0xE9, 0xA6, 0xA7, 0x43, 0xE9,
+	0xA6, 0xAC, 0x43, 0xE9, 0xA7, 0x82, 0x43, 0xE9,
+	0xA7, 0xB1, 0x43, 0xE9, 0xA7, 0xBE, 0x43, 0xE9,
+	0xA9, 0xAA, 0x43, 0xE9, 0xAA, 0xA8, 0x43, 0xE9,
+	// Bytes 1680 - 16bf
+	0xAB, 0x98, 0x43, 0xE9, 0xAB, 0x9F, 0x43, 0xE9,
+	0xAC, 0x92, 0x43, 0xE9, 0xAC, 0xA5, 0x43, 0xE9,
+	0xAC, 0xAF, 0x43, 0xE9, 0xAC, 0xB2, 0x43, 0xE9,
+	0xAC, 0xBC, 0x43, 0xE9, 0xAD, 0x9A, 0x43, 0xE9,
+	0xAD, 0xAF, 0x43, 0xE9, 0xB1, 0x80, 0x43, 0xE9,
+	0xB1, 0x97, 0x43, 0xE9, 0xB3, 0xA5, 0x43, 0xE9,
+	0xB3, 0xBD, 0x43, 0xE9, 0xB5, 0xA7, 0x43, 0xE9,
+	0xB6, 0xB4, 0x43, 0xE9, 0xB7, 0xBA, 0x43, 0xE9,
+	// Bytes 16c0 - 16ff
+	0xB8, 0x9E, 0x43, 0xE9, 0xB9, 0xB5, 0x43, 0xE9,
+	0xB9, 0xBF, 0x43, 0xE9, 0xBA, 0x97, 0x43, 0xE9,
+	0xBA, 0x9F, 0x43, 0xE9, 0xBA, 0xA5, 0x43, 0xE9,
+	0xBA, 0xBB, 0x43, 0xE9, 0xBB, 0x83, 0x43, 0xE9,
+	0xBB, 0x8D, 0x43, 0xE9, 0xBB, 0x8E, 0x43, 0xE9,
+	0xBB, 0x91, 0x43, 0xE9, 0xBB, 0xB9, 0x43, 0xE9,
+	0xBB, 0xBD, 0x43, 0xE9, 0xBB, 0xBE, 0x43, 0xE9,
+	0xBC, 0x85, 0x43, 0xE9, 0xBC, 0x8E, 0x43, 0xE9,
+	// Bytes 1700 - 173f
+	0xBC, 0x8F, 0x43, 0xE9, 0xBC, 0x93, 0x43, 0xE9,
+	0xBC, 0x96, 0x43, 0xE9, 0xBC, 0xA0, 0x43, 0xE9,
+	0xBC, 0xBB, 0x43, 0xE9, 0xBD, 0x83, 0x43, 0xE9,
+	0xBD, 0x8A, 0x43, 0xE9, 0xBD, 0x92, 0x43, 0xE9,
+	0xBE, 0x8D, 0x43, 0xE9, 0xBE, 0x8E, 0x43, 0xE9,
+	0xBE, 0x9C, 0x43, 0xE9, 0xBE, 0x9F, 0x43, 0xE9,
+	0xBE, 0xA0, 0x43, 0xEA, 0x99, 0x91, 0x43, 0xEA,
+	0x9A, 0x89, 0x43, 0xEA, 0x9C, 0xA7, 0x43, 0xEA,
+	// Bytes 1740 - 177f
+	0x9D, 0xAF, 0x43, 0xEA, 0x9E, 0x8E, 0x43, 0xEA,
+	0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x43, 0xEA,
+	0xAD, 0xA6, 0x43, 0xEA, 0xAD, 0xA7, 0x44, 0xF0,
+	0x9D, 0xBC, 0x84, 0x44, 0xF0, 0x9D, 0xBC, 0x85,
+	0x44, 0xF0, 0x9D, 0xBC, 0x86, 0x44, 0xF0, 0x9D,
+	0xBC, 0x88, 0x44, 0xF0, 0x9D, 0xBC, 0x8A, 0x44,
+	0xF0, 0x9D, 0xBC, 0x9E, 0x44, 0xF0, 0xA0, 0x84,
+	0xA2, 0x44, 0xF0, 0xA0, 0x94, 0x9C, 0x44, 0xF0,
+	// Bytes 1780 - 17bf
+	0xA0, 0x94, 0xA5, 0x44, 0xF0, 0xA0, 0x95, 0x8B,
+	0x44, 0xF0, 0xA0, 0x98, 0xBA, 0x44, 0xF0, 0xA0,
+	0xA0, 0x84, 0x44, 0xF0, 0xA0, 0xA3, 0x9E, 0x44,
+	0xF0, 0xA0, 0xA8, 0xAC, 0x44, 0xF0, 0xA0, 0xAD,
+	0xA3, 0x44, 0xF0, 0xA1, 0x93, 0xA4, 0x44, 0xF0,
+	0xA1, 0x9A, 0xA8, 0x44, 0xF0, 0xA1, 0x9B, 0xAA,
+	0x44, 0xF0, 0xA1, 0xA7, 0x88, 0x44, 0xF0, 0xA1,
+	0xAC, 0x98, 0x44, 0xF0, 0xA1, 0xB4, 0x8B, 0x44,
+	// Bytes 17c0 - 17ff
+	0xF0, 0xA1, 0xB7, 0xA4, 0x44, 0xF0, 0xA1, 0xB7,
+	0xA6, 0x44, 0xF0, 0xA2, 0x86, 0x83, 0x44, 0xF0,
+	0xA2, 0x86, 0x9F, 0x44, 0xF0, 0xA2, 0x8C, 0xB1,
+	0x44, 0xF0, 0xA2, 0x9B, 0x94, 0x44, 0xF0, 0xA2,
+	0xA1, 0x84, 0x44, 0xF0, 0xA2, 0xA1, 0x8A, 0x44,
+	0xF0, 0xA2, 0xAC, 0x8C, 0x44, 0xF0, 0xA2, 0xAF,
+	0xB1, 0x44, 0xF0, 0xA3, 0x80, 0x8A, 0x44, 0xF0,
+	0xA3, 0x8A, 0xB8, 0x44, 0xF0, 0xA3, 0x8D, 0x9F,
+	// Bytes 1800 - 183f
+	0x44, 0xF0, 0xA3, 0x8E, 0x93, 0x44, 0xF0, 0xA3,
+	0x8E, 0x9C, 0x44, 0xF0, 0xA3, 0x8F, 0x83, 0x44,
+	0xF0, 0xA3, 0x8F, 0x95, 0x44, 0xF0, 0xA3, 0x91,
+	0xAD, 0x44, 0xF0, 0xA3, 0x9A, 0xA3, 0x44, 0xF0,
+	0xA3, 0xA2, 0xA7, 0x44, 0xF0, 0xA3, 0xAA, 0x8D,
+	0x44, 0xF0, 0xA3, 0xAB, 0xBA, 0x44, 0xF0, 0xA3,
+	0xB2, 0xBC, 0x44, 0xF0, 0xA3, 0xB4, 0x9E, 0x44,
+	0xF0, 0xA3, 0xBB, 0x91, 0x44, 0xF0, 0xA3, 0xBD,
+	// Bytes 1840 - 187f
+	0x9E, 0x44, 0xF0, 0xA3, 0xBE, 0x8E, 0x44, 0xF0,
+	0xA4, 0x89, 0xA3, 0x44, 0xF0, 0xA4, 0x8B, 0xAE,
+	0x44, 0xF0, 0xA4, 0x8E, 0xAB, 0x44, 0xF0, 0xA4,
+	0x98, 0x88, 0x44, 0xF0, 0xA4, 0x9C, 0xB5, 0x44,
+	0xF0, 0xA4, 0xA0, 0x94, 0x44, 0xF0, 0xA4, 0xB0,
+	0xB6, 0x44, 0xF0, 0xA4, 0xB2, 0x92, 0x44, 0xF0,
+	0xA4, 0xBE, 0xA1, 0x44, 0xF0, 0xA4, 0xBE, 0xB8,
+	0x44, 0xF0, 0xA5, 0x81, 0x84, 0x44, 0xF0, 0xA5,
+	// Bytes 1880 - 18bf
+	0x83, 0xB2, 0x44, 0xF0, 0xA5, 0x83, 0xB3, 0x44,
+	0xF0, 0xA5, 0x84, 0x99, 0x44, 0xF0, 0xA5, 0x84,
+	0xB3, 0x44, 0xF0, 0xA5, 0x89, 0x89, 0x44, 0xF0,
+	0xA5, 0x90, 0x9D, 0x44, 0xF0, 0xA5, 0x98, 0xA6,
+	0x44, 0xF0, 0xA5, 0x9A, 0x9A, 0x44, 0xF0, 0xA5,
+	0x9B, 0x85, 0x44, 0xF0, 0xA5, 0xA5, 0xBC, 0x44,
+	0xF0, 0xA5, 0xAA, 0xA7, 0x44, 0xF0, 0xA5, 0xAE,
+	0xAB, 0x44, 0xF0, 0xA5, 0xB2, 0x80, 0x44, 0xF0,
+	// Bytes 18c0 - 18ff
+	0xA5, 0xB3, 0x90, 0x44, 0xF0, 0xA5, 0xBE, 0x86,
+	0x44, 0xF0, 0xA6, 0x87, 0x9A, 0x44, 0xF0, 0xA6,
+	0x88, 0xA8, 0x44, 0xF0, 0xA6, 0x89, 0x87, 0x44,
+	0xF0, 0xA6, 0x8B, 0x99, 0x44, 0xF0, 0xA6, 0x8C,
+	0xBE, 0x44, 0xF0, 0xA6, 0x93, 0x9A, 0x44, 0xF0,
+	0xA6, 0x94, 0xA3, 0x44, 0xF0, 0xA6, 0x96, 0xA8,
+	0x44, 0xF0, 0xA6, 0x9E, 0xA7, 0x44, 0xF0, 0xA6,
+	0x9E, 0xB5, 0x44, 0xF0, 0xA6, 0xAC, 0xBC, 0x44,
+	// Bytes 1900 - 193f
+	0xF0, 0xA6, 0xB0, 0xB6, 0x44, 0xF0, 0xA6, 0xB3,
+	0x95, 0x44, 0xF0, 0xA6, 0xB5, 0xAB, 0x44, 0xF0,
+	0xA6, 0xBC, 0xAC, 0x44, 0xF0, 0xA6, 0xBE, 0xB1,
+	0x44, 0xF0, 0xA7, 0x83, 0x92, 0x44, 0xF0, 0xA7,
+	0x8F, 0x8A, 0x44, 0xF0, 0xA7, 0x99, 0xA7, 0x44,
+	0xF0, 0xA7, 0xA2, 0xAE, 0x44, 0xF0, 0xA7, 0xA5,
+	0xA6, 0x44, 0xF0, 0xA7, 0xB2, 0xA8, 0x44, 0xF0,
+	0xA7, 0xBB, 0x93, 0x44, 0xF0, 0xA7, 0xBC, 0xAF,
+	// Bytes 1940 - 197f
+	0x44, 0xF0, 0xA8, 0x97, 0x92, 0x44, 0xF0, 0xA8,
+	0x97, 0xAD, 0x44, 0xF0, 0xA8, 0x9C, 0xAE, 0x44,
+	0xF0, 0xA8, 0xAF, 0xBA, 0x44, 0xF0, 0xA8, 0xB5,
+	0xB7, 0x44, 0xF0, 0xA9, 0x85, 0x85, 0x44, 0xF0,
+	0xA9, 0x87, 0x9F, 0x44, 0xF0, 0xA9, 0x88, 0x9A,
+	0x44, 0xF0, 0xA9, 0x90, 0x8A, 0x44, 0xF0, 0xA9,
+	0x92, 0x96, 0x44, 0xF0, 0xA9, 0x96, 0xB6, 0x44,
+	0xF0, 0xA9, 0xAC, 0xB0, 0x44, 0xF0, 0xAA, 0x83,
+	// Bytes 1980 - 19bf
+	0x8E, 0x44, 0xF0, 0xAA, 0x84, 0x85, 0x44, 0xF0,
+	0xAA, 0x88, 0x8E, 0x44, 0xF0, 0xAA, 0x8A, 0x91,
+	0x44, 0xF0, 0xAA, 0x8E, 0x92, 0x44, 0xF0, 0xAA,
+	0x98, 0x80, 0x42, 0x21, 0x21, 0x42, 0x21, 0x3F,
+	0x42, 0x2E, 0x2E, 0x42, 0x30, 0x2C, 0x42, 0x30,
+	0x2E, 0x42, 0x31, 0x2C, 0x42, 0x31, 0x2E, 0x42,
+	0x31, 0x30, 0x42, 0x31, 0x31, 0x42, 0x31, 0x32,
+	0x42, 0x31, 0x33, 0x42, 0x31, 0x34, 0x42, 0x31,
+	// Bytes 19c0 - 19ff
+	0x35, 0x42, 0x31, 0x36, 0x42, 0x31, 0x37, 0x42,
+	0x31, 0x38, 0x42, 0x31, 0x39, 0x42, 0x32, 0x2C,
+	0x42, 0x32, 0x2E, 0x42, 0x32, 0x30, 0x42, 0x32,
+	0x31, 0x42, 0x32, 0x32, 0x42, 0x32, 0x33, 0x42,
+	0x32, 0x34, 0x42, 0x32, 0x35, 0x42, 0x32, 0x36,
+	0x42, 0x32, 0x37, 0x42, 0x32, 0x38, 0x42, 0x32,
+	0x39, 0x42, 0x33, 0x2C, 0x42, 0x33, 0x2E, 0x42,
+	0x33, 0x30, 0x42, 0x33, 0x31, 0x42, 0x33, 0x32,
+	// Bytes 1a00 - 1a3f
+	0x42, 0x33, 0x33, 0x42, 0x33, 0x34, 0x42, 0x33,
+	0x35, 0x42, 0x33, 0x36, 0x42, 0x33, 0x37, 0x42,
+	0x33, 0x38, 0x42, 0x33, 0x39, 0x42, 0x34, 0x2C,
+	0x42, 0x34, 0x2E, 0x42, 0x34, 0x30, 0x42, 0x34,
+	0x31, 0x42, 0x34, 0x32, 0x42, 0x34, 0x33, 0x42,
+	0x34, 0x34, 0x42, 0x34, 0x35, 0x42, 0x34, 0x36,
+	0x42, 0x34, 0x37, 0x42, 0x34, 0x38, 0x42, 0x34,
+	0x39, 0x42, 0x35, 0x2C, 0x42, 0x35, 0x2E, 0x42,
+	// Bytes 1a40 - 1a7f
+	0x35, 0x30, 0x42, 0x36, 0x2C, 0x42, 0x36, 0x2E,
+	0x42, 0x37, 0x2C, 0x42, 0x37, 0x2E, 0x42, 0x38,
+	0x2C, 0x42, 0x38, 0x2E, 0x42, 0x39, 0x2C, 0x42,
+	0x39, 0x2E, 0x42, 0x3D, 0x3D, 0x42, 0x3F, 0x21,
+	0x42, 0x3F, 0x3F, 0x42, 0x41, 0x55, 0x42, 0x42,
+	0x71, 0x42, 0x43, 0x44, 0x42, 0x44, 0x4A, 0x42,
+	0x44, 0x5A, 0x42, 0x44, 0x7A, 0x42, 0x47, 0x42,
+	0x42, 0x47, 0x79, 0x42, 0x48, 0x50, 0x42, 0x48,
+	// Bytes 1a80 - 1abf
+	0x56, 0x42, 0x48, 0x67, 0x42, 0x48, 0x7A, 0x42,
+	0x49, 0x49, 0x42, 0x49, 0x4A, 0x42, 0x49, 0x55,
+	0x42, 0x49, 0x56, 0x42, 0x49, 0x58, 0x42, 0x4B,
+	0x42, 0x42, 0x4B, 0x4B, 0x42, 0x4B, 0x4D, 0x42,
+	0x4C, 0x4A, 0x42, 0x4C, 0x6A, 0x42, 0x4D, 0x42,
+	0x42, 0x4D, 0x43, 0x42, 0x4D, 0x44, 0x42, 0x4D,
+	0x52, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42,
+	0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F,
+	// Bytes 1ac0 - 1aff
+	0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50,
+	0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42,
+	0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76,
+	0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57,
+	0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42,
+	0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64,
+	0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64,
+	0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42,
+	// Bytes 1b00 - 1b3f
+	0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66,
+	0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66,
+	0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42,
+	0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76,
+	0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B,
+	0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42,
+	0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74,
+	0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C,
+	// Bytes 1b40 - 1b7f
+	0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42,
+	0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56,
+	0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D,
+	0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42,
+	0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46,
+	0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E,
+	0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42,
+	0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46,
+	// Bytes 1b80 - 1bbf
+	0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70,
+	0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42,
+	0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69,
+	0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29,
+	0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29,
+	0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29,
+	0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29,
+	0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29,
+	// Bytes 1bc0 - 1bff
+	0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29,
+	0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29,
+	0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29,
+	0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29,
+	0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29,
+	0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29,
+	0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29,
+	0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29,
+	// Bytes 1c00 - 1c3f
+	0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29,
+	0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29,
+	0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29,
+	0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29,
+	0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29,
+	0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29,
+	0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29,
+	0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29,
+	// Bytes 1c40 - 1c7f
+	0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29,
+	0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29,
+	0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29,
+	0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29,
+	0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29,
+	0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29,
+	0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29,
+	0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29,
+	// Bytes 1c80 - 1cbf
+	0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29,
+	0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E,
+	0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E,
+	0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E,
+	0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E,
+	0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E,
+	0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E,
+	0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D,
+	// Bytes 1cc0 - 1cff
+	0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E,
+	0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A,
+	0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49,
+	0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7,
+	0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61,
+	0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D,
+	0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45,
+	0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A,
+	// Bytes 1d00 - 1d3f
+	0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49,
+	0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73,
+	0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72,
+	0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75,
+	0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32,
+	0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32,
+	0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67,
+	0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C,
+	// Bytes 1d40 - 1d7f
+	0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61,
+	0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A,
+	0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32,
+	0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9,
+	0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7,
+	0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32,
+	0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C,
+	0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69,
+	// Bytes 1d80 - 1dbf
+	0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43,
+	0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E,
+	0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46,
+	0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57,
+	0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C,
+	0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73,
+	0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31,
+	0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44,
+	// Bytes 1dc0 - 1dff
+	0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34,
+	0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28,
+	0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29,
+	0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31,
+	0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44,
+	0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81,
+	0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31,
+	0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9,
+	// Bytes 1e00 - 1e3f
+	0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6,
+	0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44,
+	0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C,
+	0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34,
+	0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88,
+	0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6,
+	0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44,
+	0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97,
+	// Bytes 1e40 - 1e7f
+	0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36,
+	0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5,
+	0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7,
+	0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44,
+	0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82,
+	0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39,
+	0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9,
+	0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E,
+	// Bytes 1e80 - 1ebf
+	0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44,
+	0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69,
+	0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5,
+	0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB,
+	0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4,
+	0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44,
+	0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9,
+	0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8,
+	// Bytes 1ec0 - 1eff
+	0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE,
+	0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8,
+	0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44,
+	0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9,
+	0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8,
+	0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC,
+	0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA,
+	0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44,
+	// Bytes 1f00 - 1f3f
+	0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9,
+	0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8,
+	0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89,
+	0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB,
+	0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44,
+	0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9,
+	0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8,
+	0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89,
+	// Bytes 1f40 - 1f7f
+	0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC,
+	0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44,
+	0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9,
+	0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8,
+	0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89,
+	0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE,
+	0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44,
+	0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9,
+	// Bytes 1f80 - 1fbf
+	0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8,
+	0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD,
+	0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3,
+	0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44,
+	0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9,
+	0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8,
+	0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD,
+	0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4,
+	// Bytes 1fc0 - 1fff
+	0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44,
+	0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9,
+	0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8,
+	0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE,
+	0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5,
+	0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44,
+	0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8,
+	0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8,
+	// Bytes 2000 - 203f
+	0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1,
+	0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6,
+	0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44,
+	0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9,
+	0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8,
+	0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85,
+	0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9,
+	0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44,
+	// Bytes 2040 - 207f
+	0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8,
+	0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8,
+	0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A,
+	0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81,
+	0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44,
+	0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9,
+	0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9,
+	0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85,
+	// Bytes 2080 - 20bf
+	0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82,
+	0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44,
+	0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8,
+	0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9,
+	0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85,
+	0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83,
+	0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44,
+	0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8,
+	// Bytes 20c0 - 20ff
+	0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9,
+	0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87,
+	0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84,
+	0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44,
+	0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8,
+	0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9,
+	0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89,
+	0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86,
+	// Bytes 2100 - 213f
+	0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44,
+	0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8,
+	0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9,
+	0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86,
+	0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86,
+	0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44,
+	0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9,
+	0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9,
+	// Bytes 2140 - 217f
+	0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4,
+	0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A,
+	0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44,
+	0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8,
+	0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9,
+	0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87,
+	0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A,
+	0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44,
+	// Bytes 2180 - 21bf
+	0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84,
+	0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29,
+	0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28,
+	0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29,
+	0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28,
+	0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29,
+	// Bytes 21c0 - 21ff
+	0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28,
+	0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84,
+	0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29,
+	0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28,
+	0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8,
+	0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29,
+	0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28,
+	0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB,
+	// Bytes 2200 - 223f
+	0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29,
+	0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28,
+	0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85,
+	0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29,
+	0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28,
+	0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90,
+	0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29,
+	0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28,
+	// Bytes 2240 - 227f
+	0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD,
+	0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29,
+	0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28,
+	0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C,
+	0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29,
+	0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28,
+	0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89,
+	0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29,
+	// Bytes 2280 - 22bf
+	0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28,
+	0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5,
+	0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29,
+	0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28,
+	0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3,
+	0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29,
+	0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31,
+	0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6,
+	// Bytes 22c0 - 22ff
+	0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7,
+	0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5,
+	0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31,
+	0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	// Bytes 2300 - 233f
+	0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9,
+	0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31,
+	0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6,
+	0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9,
+	// Bytes 2340 - 237f
+	0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31,
+	0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81,
+	0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35,
+	0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31,
+	0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81,
+	0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39,
+	0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6,
+	// Bytes 2380 - 23bf
+	0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9,
+	0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9,
+	0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5,
+	0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32,
+	// Bytes 23c0 - 23ff
+	0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6,
+	0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33,
+	0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+	0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6,
+	0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34,
+	0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33,
+	0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81,
+	0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36,
+	// Bytes 2400 - 243f
+	0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37,
+	0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88,
+	0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D,
+	0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31,
+	0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2,
+	0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88,
+	0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9,
+	// Bytes 2440 - 247f
+	0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85,
+	0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46,
+	0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+	0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA,
+	0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8,
+	0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE,
+	0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9,
+	0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC,
+	// Bytes 2480 - 24bf
+	0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46,
+	0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8,
+	0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8,
+	0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8,
+	0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89,
+	0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+	// Bytes 24c0 - 24ff
+	0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8,
+	0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8,
+	0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC,
+	0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8,
+	0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89,
+	0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46,
+	0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8,
+	// Bytes 2500 - 253f
+	0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3,
+	0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8,
+	0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD,
+	0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9,
+	0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE,
+	0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+	0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8,
+	0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5,
+	// Bytes 2540 - 257f
+	0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9,
+	0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85,
+	0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9,
+	0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A,
+	0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46,
+	0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8,
+	0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8,
+	// Bytes 2580 - 25bf
+	0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85,
+	0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9,
+	0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A,
+	0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46,
+	0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8,
+	0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81,
+	0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9,
+	0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84,
+	// Bytes 25c0 - 25ff
+	0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8,
+	0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85,
+	0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46,
+	0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+	0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84,
+	0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8,
+	0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC,
+	0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9,
+	// Bytes 2600 - 263f
+	0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89,
+	0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46,
+	0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9,
+	0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84,
+	0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8,
+	0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC,
+	0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9,
+	0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A,
+	// Bytes 2640 - 267f
+	0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46,
+	0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9,
+	0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85,
+	0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8,
+	0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE,
+	0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9,
+	0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD,
+	0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46,
+	// Bytes 2680 - 26bf
+	0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9,
+	0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86,
+	0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8,
+	0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD,
+	0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9,
+	0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A,
+	0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46,
+	0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9,
+	// Bytes 26c0 - 26ff
+	0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A,
+	0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9,
+	0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85,
+	0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8,
+	0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC,
+	0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46,
+	0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9,
+	0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A,
+	// Bytes 2700 - 273f
+	0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9,
+	0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+	0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9,
+	0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88,
+	0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46,
+	0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9,
+	0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A,
+	0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9,
+	// Bytes 2740 - 277f
+	0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94,
+	0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB,
+	0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2,
+	0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46,
+	0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0,
+	0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD,
+	0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82,
+	0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0,
+	// Bytes 2780 - 27bf
+	0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE,
+	0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7,
+	0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46,
+	0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0,
+	0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE,
+	0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1,
+	0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0,
+	0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE,
+	// Bytes 27c0 - 27ff
+	0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2,
+	0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46,
+	0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2,
+	0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81,
+	0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88,
+	0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3,
+	0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82,
+	0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88,
+	// Bytes 2800 - 283f
+	0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46,
+	0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3,
+	0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83,
+	0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA,
+	0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3,
+	0x83, 0xA0, 0x46, 0xE4, 0xBB, 0xA4, 0xE5, 0x92,
+	0x8C, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, 0xA3,
+	0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, 0x46,
+	// Bytes 2840 - 287f
+	0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, 0xE6,
+	0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, 0x61,
+	0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, 0x80,
+	0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, 0xE1,
+	0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28,
+	0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, 0x48,
+	0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x29,
+	0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1,
+	// Bytes 2880 - 28bf
+	0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, 0x85,
+	0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, 0xE1,
+	0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x89,
+	0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84,
+	0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1,
+	0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28,
+	0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, 0x48,
+	0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x29,
+	// Bytes 28c0 - 28ff
+	0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1,
+	0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, 0x85,
+	0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, 0xE1,
+	0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x92,
+	0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, 0x64,
+	0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, 0xA7,
+	0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, 0xD8,
+	0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, 0x48,
+	// Bytes 2900 - 293f
+	0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, 0x84,
+	0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, 0xD9,
+	0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, 0xB9,
+	0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, 0xD9,
+	0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, 0xAD,
+	0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, 0xD8,
+	0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, 0x80,
+	0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0x49,
+	// Bytes 2940 - 297f
+	0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, 0x80,
+	0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB,
+	0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, 0xE2,
+	0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, 0x80,
+	0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, 0x49,
+	0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, 0x80,
+	0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, 0x9D,
+	0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5,
+	// Bytes 2980 - 29bf
+	0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80,
+	0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, 0x49,
+	0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, 0x80,
+	0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, 0xAC,
+	0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE7,
+	0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80,
+	0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, 0x49,
+	0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	// Bytes 29c0 - 29ff
+	0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3,
+	0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, 0xE3,
+	0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x82,
+	0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, 0x49,
+	0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0xA4,
+	0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, 0xE3,
+	0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, 0x82,
+	// Bytes 2a00 - 2a3f
+	0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, 0x49,
+	0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83,
+	0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3,
+	0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, 0xE3,
+	0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, 0x83,
+	0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49,
+	0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, 0x83,
+	0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0xA4,
+	// Bytes 2a40 - 2a7f
+	0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, 0xE3,
+	0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83,
+	0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, 0x49,
+	0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, 0x83,
+	0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A,
+	0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, 0xE3,
+	0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83,
+	0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, 0x49,
+	// Bytes 2a80 - 2abf
+	0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4,
+	0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, 0xE3,
+	0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, 0x83,
+	0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, 0x49,
+	0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, 0xA2,
+	0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, 0xE3,
+	// Bytes 2ac0 - 2aff
+	0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, 0x80,
+	0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2,
+	0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, 0x88,
+	0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x4C,
+	0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, 0x83,
+	0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, 0xA8,
+	0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, 0x83,
+	0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99,
+	// Bytes 2b00 - 2b3f
+	0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, 0xE3,
+	0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xB3,
+	0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, 0xE3,
+	0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88,
+	0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, 0xE3,
+	0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82,
+	0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, 0xE3,
+	0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x83,
+	// Bytes 2b40 - 2b7f
+	0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C,
+	0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83,
+	0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, 0xAF,
+	0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0xA4,
+	0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3,
+	0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC,
+	0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, 0xE3,
+	// Bytes 2b80 - 2bbf
+	0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x84,
+	0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3,
+	0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83,
+	0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82,
+	0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, 0x4C,
+	0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+	0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, 0x98,
+	// Bytes 2bc0 - 2bff
+	0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, 0x82,
+	0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99,
+	0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, 0xE3,
+	0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, 0xAF,
+	0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, 0xE3,
+	0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3,
+	0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, 0xE3,
+	0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83,
+	// Bytes 2c00 - 2c3f
+	0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3,
+	0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, 0x83,
+	0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0x4C,
+	0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, 0xBC,
+	0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, 0x84,
+	0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, 0xE1,
+	0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, 0x84,
+	0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, 0xD9,
+	// Bytes 2c40 - 2c7f
+	0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, 0xE3,
+	0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC,
+	0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, 0xE3,
+	0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A,
+	0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, 0xE3,
+	0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, 0x83,
+	0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, 0xE3,
+	0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, 0xBC,
+	// Bytes 2c80 - 2cbf
+	0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, 0xE3,
+	0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAC,
+	0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, 0xE3,
+	0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, 0xBC,
+	0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, 0xE3,
+	0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, 0xB3,
+	0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, 0xE3,
+	0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, 0xA7,
+	// Bytes 2cc0 - 2cff
+	0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, 0xE3,
+	0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x88,
+	0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, 0xE3,
+	0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99,
+	0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, 0x8B,
+	0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, 0x85,
+	0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, 0x82,
+	0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0xE3,
+	// Bytes 2d00 - 2d3f
+	0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC,
+	0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, 0xE3,
+	0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9,
+	0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, 0xE3,
+	0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC,
+	0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, 0xE3,
+	0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xA9,
+	0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, 0x83,
+	// Bytes 2d40 - 2d7f
+	0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB,
+	0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, 0x82,
+	0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, 0x8F,
+	0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x82,
+	0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, 0x52,
+	0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82,
+	0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, 0xE3,
+	0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, 0x82,
+	// Bytes 2d80 - 2dbf
+	0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, 0xE3,
+	0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83,
+	0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, 0xE3,
+	0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB,
+	0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, 0xE3,
+	0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99,
+	0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, 0x84,
+	0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, 0xD9,
+	// Bytes 2dc0 - 2dff
+	0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, 0x84,
+	0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, 0xD8,
+	0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, 0xA7,
+	0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, 0xA7,
+	0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, 0xAD,
+	0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, 0xAD,
+	0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, 0xAD,
+	0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, 0xAE,
+	// Bytes 2e00 - 2e3f
+	0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF,
+	0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xAF,
+	0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, 0xAF,
+	0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, 0xB2,
+	0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3,
+	0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, 0xB3,
+	0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, 0xB5,
+	0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB5,
+	// Bytes 2e40 - 2e7f
+	0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, 0xB5,
+	0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, 0xB7,
+	0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, 0x80,
+	0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, 0xAC,
+	0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	// Bytes 2e80 - 2ebf
+	0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAC,
+	0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, 0xAD,
+	0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, 0x91,
+	0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, 0x08,
+	// Bytes 2ec0 - 2eff
+	0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, 0xA7,
+	0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, 0x91,
+	0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87,
+	0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, 0x91,
+	0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, 0x08,
+	0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xBA,
+	0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91,
+	0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, 0xB8,
+	// Bytes 2f00 - 2f3f
+	0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, 0x91,
+	0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08,
+	0xF0, 0x91, 0xA4, 0xB5, 0xF0, 0x91, 0xA4, 0xB0,
+	0x01, 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82,
+	0xE0, 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99,
+	0xE0, 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x16, 0x44,
+	0x44, 0x5A, 0xCC, 0x8C, 0xCD, 0x44, 0x44, 0x7A,
+	0xCC, 0x8C, 0xCD, 0x44, 0x64, 0x7A, 0xCC, 0x8C,
+	// Bytes 2f40 - 2f7f
+	0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93,
+	0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94,
+	0xCD, 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95,
+	0xB9, 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1,
+	// Bytes 2f80 - 2fbf
+	0x01, 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE,
+	0x01, 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1,
+	// Bytes 2fc0 - 2fff
+	0x01, 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1,
+	0x01, 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1,
+	0x01, 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB,
+	0xE3, 0x82, 0x99, 0x11, 0x4C, 0xE1, 0x84, 0x8C,
+	0xE1, 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85,
+	0xB4, 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82,
+	0x99, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x11,
+	0x4C, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3,
+	// Bytes 3000 - 303f
+	0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x11, 0x4C, 0xE3,
+	0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88,
+	0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE1, 0x84, 0x8E,
+	0xE1, 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84,
+	0x80, 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82,
+	0xA4, 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3,
+	0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F, 0xE3,
+	0x82, 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3,
+	// Bytes 3040 - 307f
+	0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x11, 0x4F,
+	0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83,
+	0xBC, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x11,
+	0x4F, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3,
+	0x83, 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99,
+	0x11, 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9,
+	0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83,
+	0x88, 0xE3, 0x82, 0x99, 0x11, 0x52, 0xE3, 0x83,
+	// Bytes 3080 - 30bf
+	0x95, 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3,
+	0x83, 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99,
+	0x11, 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82,
+	0x01, 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F,
+	0x01, 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D,
+	0xCC, 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05,
+	0x03, 0x41, 0xCC, 0x80, 0xCD, 0x03, 0x41, 0xCC,
+	0x81, 0xCD, 0x03, 0x41, 0xCC, 0x83, 0xCD, 0x03,
+	// Bytes 30c0 - 30ff
+	0x41, 0xCC, 0x84, 0xCD, 0x03, 0x41, 0xCC, 0x89,
+	0xCD, 0x03, 0x41, 0xCC, 0x8C, 0xCD, 0x03, 0x41,
+	0xCC, 0x8F, 0xCD, 0x03, 0x41, 0xCC, 0x91, 0xCD,
+	0x03, 0x41, 0xCC, 0xA5, 0xB9, 0x03, 0x41, 0xCC,
+	0xA8, 0xA9, 0x03, 0x42, 0xCC, 0x87, 0xCD, 0x03,
+	0x42, 0xCC, 0xA3, 0xB9, 0x03, 0x42, 0xCC, 0xB1,
+	0xB9, 0x03, 0x43, 0xCC, 0x81, 0xCD, 0x03, 0x43,
+	0xCC, 0x82, 0xCD, 0x03, 0x43, 0xCC, 0x87, 0xCD,
+	// Bytes 3100 - 313f
+	0x03, 0x43, 0xCC, 0x8C, 0xCD, 0x03, 0x44, 0xCC,
+	0x87, 0xCD, 0x03, 0x44, 0xCC, 0x8C, 0xCD, 0x03,
+	0x44, 0xCC, 0xA3, 0xB9, 0x03, 0x44, 0xCC, 0xA7,
+	0xA9, 0x03, 0x44, 0xCC, 0xAD, 0xB9, 0x03, 0x44,
+	0xCC, 0xB1, 0xB9, 0x03, 0x45, 0xCC, 0x80, 0xCD,
+	0x03, 0x45, 0xCC, 0x81, 0xCD, 0x03, 0x45, 0xCC,
+	0x83, 0xCD, 0x03, 0x45, 0xCC, 0x86, 0xCD, 0x03,
+	0x45, 0xCC, 0x87, 0xCD, 0x03, 0x45, 0xCC, 0x88,
+	// Bytes 3140 - 317f
+	0xCD, 0x03, 0x45, 0xCC, 0x89, 0xCD, 0x03, 0x45,
+	0xCC, 0x8C, 0xCD, 0x03, 0x45, 0xCC, 0x8F, 0xCD,
+	0x03, 0x45, 0xCC, 0x91, 0xCD, 0x03, 0x45, 0xCC,
+	0xA8, 0xA9, 0x03, 0x45, 0xCC, 0xAD, 0xB9, 0x03,
+	0x45, 0xCC, 0xB0, 0xB9, 0x03, 0x46, 0xCC, 0x87,
+	0xCD, 0x03, 0x47, 0xCC, 0x81, 0xCD, 0x03, 0x47,
+	0xCC, 0x82, 0xCD, 0x03, 0x47, 0xCC, 0x84, 0xCD,
+	0x03, 0x47, 0xCC, 0x86, 0xCD, 0x03, 0x47, 0xCC,
+	// Bytes 3180 - 31bf
+	0x87, 0xCD, 0x03, 0x47, 0xCC, 0x8C, 0xCD, 0x03,
+	0x47, 0xCC, 0xA7, 0xA9, 0x03, 0x48, 0xCC, 0x82,
+	0xCD, 0x03, 0x48, 0xCC, 0x87, 0xCD, 0x03, 0x48,
+	0xCC, 0x88, 0xCD, 0x03, 0x48, 0xCC, 0x8C, 0xCD,
+	0x03, 0x48, 0xCC, 0xA3, 0xB9, 0x03, 0x48, 0xCC,
+	0xA7, 0xA9, 0x03, 0x48, 0xCC, 0xAE, 0xB9, 0x03,
+	0x49, 0xCC, 0x80, 0xCD, 0x03, 0x49, 0xCC, 0x81,
+	0xCD, 0x03, 0x49, 0xCC, 0x82, 0xCD, 0x03, 0x49,
+	// Bytes 31c0 - 31ff
+	0xCC, 0x83, 0xCD, 0x03, 0x49, 0xCC, 0x84, 0xCD,
+	0x03, 0x49, 0xCC, 0x86, 0xCD, 0x03, 0x49, 0xCC,
+	0x87, 0xCD, 0x03, 0x49, 0xCC, 0x89, 0xCD, 0x03,
+	0x49, 0xCC, 0x8C, 0xCD, 0x03, 0x49, 0xCC, 0x8F,
+	0xCD, 0x03, 0x49, 0xCC, 0x91, 0xCD, 0x03, 0x49,
+	0xCC, 0xA3, 0xB9, 0x03, 0x49, 0xCC, 0xA8, 0xA9,
+	0x03, 0x49, 0xCC, 0xB0, 0xB9, 0x03, 0x4A, 0xCC,
+	0x82, 0xCD, 0x03, 0x4B, 0xCC, 0x81, 0xCD, 0x03,
+	// Bytes 3200 - 323f
+	0x4B, 0xCC, 0x8C, 0xCD, 0x03, 0x4B, 0xCC, 0xA3,
+	0xB9, 0x03, 0x4B, 0xCC, 0xA7, 0xA9, 0x03, 0x4B,
+	0xCC, 0xB1, 0xB9, 0x03, 0x4C, 0xCC, 0x81, 0xCD,
+	0x03, 0x4C, 0xCC, 0x8C, 0xCD, 0x03, 0x4C, 0xCC,
+	0xA7, 0xA9, 0x03, 0x4C, 0xCC, 0xAD, 0xB9, 0x03,
+	0x4C, 0xCC, 0xB1, 0xB9, 0x03, 0x4D, 0xCC, 0x81,
+	0xCD, 0x03, 0x4D, 0xCC, 0x87, 0xCD, 0x03, 0x4D,
+	0xCC, 0xA3, 0xB9, 0x03, 0x4E, 0xCC, 0x80, 0xCD,
+	// Bytes 3240 - 327f
+	0x03, 0x4E, 0xCC, 0x81, 0xCD, 0x03, 0x4E, 0xCC,
+	0x83, 0xCD, 0x03, 0x4E, 0xCC, 0x87, 0xCD, 0x03,
+	0x4E, 0xCC, 0x8C, 0xCD, 0x03, 0x4E, 0xCC, 0xA3,
+	0xB9, 0x03, 0x4E, 0xCC, 0xA7, 0xA9, 0x03, 0x4E,
+	0xCC, 0xAD, 0xB9, 0x03, 0x4E, 0xCC, 0xB1, 0xB9,
+	0x03, 0x4F, 0xCC, 0x80, 0xCD, 0x03, 0x4F, 0xCC,
+	0x81, 0xCD, 0x03, 0x4F, 0xCC, 0x86, 0xCD, 0x03,
+	0x4F, 0xCC, 0x89, 0xCD, 0x03, 0x4F, 0xCC, 0x8B,
+	// Bytes 3280 - 32bf
+	0xCD, 0x03, 0x4F, 0xCC, 0x8C, 0xCD, 0x03, 0x4F,
+	0xCC, 0x8F, 0xCD, 0x03, 0x4F, 0xCC, 0x91, 0xCD,
+	0x03, 0x50, 0xCC, 0x81, 0xCD, 0x03, 0x50, 0xCC,
+	0x87, 0xCD, 0x03, 0x52, 0xCC, 0x81, 0xCD, 0x03,
+	0x52, 0xCC, 0x87, 0xCD, 0x03, 0x52, 0xCC, 0x8C,
+	0xCD, 0x03, 0x52, 0xCC, 0x8F, 0xCD, 0x03, 0x52,
+	0xCC, 0x91, 0xCD, 0x03, 0x52, 0xCC, 0xA7, 0xA9,
+	0x03, 0x52, 0xCC, 0xB1, 0xB9, 0x03, 0x53, 0xCC,
+	// Bytes 32c0 - 32ff
+	0x82, 0xCD, 0x03, 0x53, 0xCC, 0x87, 0xCD, 0x03,
+	0x53, 0xCC, 0xA6, 0xB9, 0x03, 0x53, 0xCC, 0xA7,
+	0xA9, 0x03, 0x54, 0xCC, 0x87, 0xCD, 0x03, 0x54,
+	0xCC, 0x8C, 0xCD, 0x03, 0x54, 0xCC, 0xA3, 0xB9,
+	0x03, 0x54, 0xCC, 0xA6, 0xB9, 0x03, 0x54, 0xCC,
+	0xA7, 0xA9, 0x03, 0x54, 0xCC, 0xAD, 0xB9, 0x03,
+	0x54, 0xCC, 0xB1, 0xB9, 0x03, 0x55, 0xCC, 0x80,
+	0xCD, 0x03, 0x55, 0xCC, 0x81, 0xCD, 0x03, 0x55,
+	// Bytes 3300 - 333f
+	0xCC, 0x82, 0xCD, 0x03, 0x55, 0xCC, 0x86, 0xCD,
+	0x03, 0x55, 0xCC, 0x89, 0xCD, 0x03, 0x55, 0xCC,
+	0x8A, 0xCD, 0x03, 0x55, 0xCC, 0x8B, 0xCD, 0x03,
+	0x55, 0xCC, 0x8C, 0xCD, 0x03, 0x55, 0xCC, 0x8F,
+	0xCD, 0x03, 0x55, 0xCC, 0x91, 0xCD, 0x03, 0x55,
+	0xCC, 0xA3, 0xB9, 0x03, 0x55, 0xCC, 0xA4, 0xB9,
+	0x03, 0x55, 0xCC, 0xA8, 0xA9, 0x03, 0x55, 0xCC,
+	0xAD, 0xB9, 0x03, 0x55, 0xCC, 0xB0, 0xB9, 0x03,
+	// Bytes 3340 - 337f
+	0x56, 0xCC, 0x83, 0xCD, 0x03, 0x56, 0xCC, 0xA3,
+	0xB9, 0x03, 0x57, 0xCC, 0x80, 0xCD, 0x03, 0x57,
+	0xCC, 0x81, 0xCD, 0x03, 0x57, 0xCC, 0x82, 0xCD,
+	0x03, 0x57, 0xCC, 0x87, 0xCD, 0x03, 0x57, 0xCC,
+	0x88, 0xCD, 0x03, 0x57, 0xCC, 0xA3, 0xB9, 0x03,
+	0x58, 0xCC, 0x87, 0xCD, 0x03, 0x58, 0xCC, 0x88,
+	0xCD, 0x03, 0x59, 0xCC, 0x80, 0xCD, 0x03, 0x59,
+	0xCC, 0x81, 0xCD, 0x03, 0x59, 0xCC, 0x82, 0xCD,
+	// Bytes 3380 - 33bf
+	0x03, 0x59, 0xCC, 0x83, 0xCD, 0x03, 0x59, 0xCC,
+	0x84, 0xCD, 0x03, 0x59, 0xCC, 0x87, 0xCD, 0x03,
+	0x59, 0xCC, 0x88, 0xCD, 0x03, 0x59, 0xCC, 0x89,
+	0xCD, 0x03, 0x59, 0xCC, 0xA3, 0xB9, 0x03, 0x5A,
+	0xCC, 0x81, 0xCD, 0x03, 0x5A, 0xCC, 0x82, 0xCD,
+	0x03, 0x5A, 0xCC, 0x87, 0xCD, 0x03, 0x5A, 0xCC,
+	0x8C, 0xCD, 0x03, 0x5A, 0xCC, 0xA3, 0xB9, 0x03,
+	0x5A, 0xCC, 0xB1, 0xB9, 0x03, 0x61, 0xCC, 0x80,
+	// Bytes 33c0 - 33ff
+	0xCD, 0x03, 0x61, 0xCC, 0x81, 0xCD, 0x03, 0x61,
+	0xCC, 0x83, 0xCD, 0x03, 0x61, 0xCC, 0x84, 0xCD,
+	0x03, 0x61, 0xCC, 0x89, 0xCD, 0x03, 0x61, 0xCC,
+	0x8C, 0xCD, 0x03, 0x61, 0xCC, 0x8F, 0xCD, 0x03,
+	0x61, 0xCC, 0x91, 0xCD, 0x03, 0x61, 0xCC, 0xA5,
+	0xB9, 0x03, 0x61, 0xCC, 0xA8, 0xA9, 0x03, 0x62,
+	0xCC, 0x87, 0xCD, 0x03, 0x62, 0xCC, 0xA3, 0xB9,
+	0x03, 0x62, 0xCC, 0xB1, 0xB9, 0x03, 0x63, 0xCC,
+	// Bytes 3400 - 343f
+	0x81, 0xCD, 0x03, 0x63, 0xCC, 0x82, 0xCD, 0x03,
+	0x63, 0xCC, 0x87, 0xCD, 0x03, 0x63, 0xCC, 0x8C,
+	0xCD, 0x03, 0x64, 0xCC, 0x87, 0xCD, 0x03, 0x64,
+	0xCC, 0x8C, 0xCD, 0x03, 0x64, 0xCC, 0xA3, 0xB9,
+	0x03, 0x64, 0xCC, 0xA7, 0xA9, 0x03, 0x64, 0xCC,
+	0xAD, 0xB9, 0x03, 0x64, 0xCC, 0xB1, 0xB9, 0x03,
+	0x65, 0xCC, 0x80, 0xCD, 0x03, 0x65, 0xCC, 0x81,
+	0xCD, 0x03, 0x65, 0xCC, 0x83, 0xCD, 0x03, 0x65,
+	// Bytes 3440 - 347f
+	0xCC, 0x86, 0xCD, 0x03, 0x65, 0xCC, 0x87, 0xCD,
+	0x03, 0x65, 0xCC, 0x88, 0xCD, 0x03, 0x65, 0xCC,
+	0x89, 0xCD, 0x03, 0x65, 0xCC, 0x8C, 0xCD, 0x03,
+	0x65, 0xCC, 0x8F, 0xCD, 0x03, 0x65, 0xCC, 0x91,
+	0xCD, 0x03, 0x65, 0xCC, 0xA8, 0xA9, 0x03, 0x65,
+	0xCC, 0xAD, 0xB9, 0x03, 0x65, 0xCC, 0xB0, 0xB9,
+	0x03, 0x66, 0xCC, 0x87, 0xCD, 0x03, 0x67, 0xCC,
+	0x81, 0xCD, 0x03, 0x67, 0xCC, 0x82, 0xCD, 0x03,
+	// Bytes 3480 - 34bf
+	0x67, 0xCC, 0x84, 0xCD, 0x03, 0x67, 0xCC, 0x86,
+	0xCD, 0x03, 0x67, 0xCC, 0x87, 0xCD, 0x03, 0x67,
+	0xCC, 0x8C, 0xCD, 0x03, 0x67, 0xCC, 0xA7, 0xA9,
+	0x03, 0x68, 0xCC, 0x82, 0xCD, 0x03, 0x68, 0xCC,
+	0x87, 0xCD, 0x03, 0x68, 0xCC, 0x88, 0xCD, 0x03,
+	0x68, 0xCC, 0x8C, 0xCD, 0x03, 0x68, 0xCC, 0xA3,
+	0xB9, 0x03, 0x68, 0xCC, 0xA7, 0xA9, 0x03, 0x68,
+	0xCC, 0xAE, 0xB9, 0x03, 0x68, 0xCC, 0xB1, 0xB9,
+	// Bytes 34c0 - 34ff
+	0x03, 0x69, 0xCC, 0x80, 0xCD, 0x03, 0x69, 0xCC,
+	0x81, 0xCD, 0x03, 0x69, 0xCC, 0x82, 0xCD, 0x03,
+	0x69, 0xCC, 0x83, 0xCD, 0x03, 0x69, 0xCC, 0x84,
+	0xCD, 0x03, 0x69, 0xCC, 0x86, 0xCD, 0x03, 0x69,
+	0xCC, 0x89, 0xCD, 0x03, 0x69, 0xCC, 0x8C, 0xCD,
+	0x03, 0x69, 0xCC, 0x8F, 0xCD, 0x03, 0x69, 0xCC,
+	0x91, 0xCD, 0x03, 0x69, 0xCC, 0xA3, 0xB9, 0x03,
+	0x69, 0xCC, 0xA8, 0xA9, 0x03, 0x69, 0xCC, 0xB0,
+	// Bytes 3500 - 353f
+	0xB9, 0x03, 0x6A, 0xCC, 0x82, 0xCD, 0x03, 0x6A,
+	0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC, 0x81, 0xCD,
+	0x03, 0x6B, 0xCC, 0x8C, 0xCD, 0x03, 0x6B, 0xCC,
+	0xA3, 0xB9, 0x03, 0x6B, 0xCC, 0xA7, 0xA9, 0x03,
+	0x6B, 0xCC, 0xB1, 0xB9, 0x03, 0x6C, 0xCC, 0x81,
+	0xCD, 0x03, 0x6C, 0xCC, 0x8C, 0xCD, 0x03, 0x6C,
+	0xCC, 0xA7, 0xA9, 0x03, 0x6C, 0xCC, 0xAD, 0xB9,
+	0x03, 0x6C, 0xCC, 0xB1, 0xB9, 0x03, 0x6D, 0xCC,
+	// Bytes 3540 - 357f
+	0x81, 0xCD, 0x03, 0x6D, 0xCC, 0x87, 0xCD, 0x03,
+	0x6D, 0xCC, 0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0x80,
+	0xCD, 0x03, 0x6E, 0xCC, 0x81, 0xCD, 0x03, 0x6E,
+	0xCC, 0x83, 0xCD, 0x03, 0x6E, 0xCC, 0x87, 0xCD,
+	0x03, 0x6E, 0xCC, 0x8C, 0xCD, 0x03, 0x6E, 0xCC,
+	0xA3, 0xB9, 0x03, 0x6E, 0xCC, 0xA7, 0xA9, 0x03,
+	0x6E, 0xCC, 0xAD, 0xB9, 0x03, 0x6E, 0xCC, 0xB1,
+	0xB9, 0x03, 0x6F, 0xCC, 0x80, 0xCD, 0x03, 0x6F,
+	// Bytes 3580 - 35bf
+	0xCC, 0x81, 0xCD, 0x03, 0x6F, 0xCC, 0x86, 0xCD,
+	0x03, 0x6F, 0xCC, 0x89, 0xCD, 0x03, 0x6F, 0xCC,
+	0x8B, 0xCD, 0x03, 0x6F, 0xCC, 0x8C, 0xCD, 0x03,
+	0x6F, 0xCC, 0x8F, 0xCD, 0x03, 0x6F, 0xCC, 0x91,
+	0xCD, 0x03, 0x70, 0xCC, 0x81, 0xCD, 0x03, 0x70,
+	0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC, 0x81, 0xCD,
+	0x03, 0x72, 0xCC, 0x87, 0xCD, 0x03, 0x72, 0xCC,
+	0x8C, 0xCD, 0x03, 0x72, 0xCC, 0x8F, 0xCD, 0x03,
+	// Bytes 35c0 - 35ff
+	0x72, 0xCC, 0x91, 0xCD, 0x03, 0x72, 0xCC, 0xA7,
+	0xA9, 0x03, 0x72, 0xCC, 0xB1, 0xB9, 0x03, 0x73,
+	0xCC, 0x82, 0xCD, 0x03, 0x73, 0xCC, 0x87, 0xCD,
+	0x03, 0x73, 0xCC, 0xA6, 0xB9, 0x03, 0x73, 0xCC,
+	0xA7, 0xA9, 0x03, 0x74, 0xCC, 0x87, 0xCD, 0x03,
+	0x74, 0xCC, 0x88, 0xCD, 0x03, 0x74, 0xCC, 0x8C,
+	0xCD, 0x03, 0x74, 0xCC, 0xA3, 0xB9, 0x03, 0x74,
+	0xCC, 0xA6, 0xB9, 0x03, 0x74, 0xCC, 0xA7, 0xA9,
+	// Bytes 3600 - 363f
+	0x03, 0x74, 0xCC, 0xAD, 0xB9, 0x03, 0x74, 0xCC,
+	0xB1, 0xB9, 0x03, 0x75, 0xCC, 0x80, 0xCD, 0x03,
+	0x75, 0xCC, 0x81, 0xCD, 0x03, 0x75, 0xCC, 0x82,
+	0xCD, 0x03, 0x75, 0xCC, 0x86, 0xCD, 0x03, 0x75,
+	0xCC, 0x89, 0xCD, 0x03, 0x75, 0xCC, 0x8A, 0xCD,
+	0x03, 0x75, 0xCC, 0x8B, 0xCD, 0x03, 0x75, 0xCC,
+	0x8C, 0xCD, 0x03, 0x75, 0xCC, 0x8F, 0xCD, 0x03,
+	0x75, 0xCC, 0x91, 0xCD, 0x03, 0x75, 0xCC, 0xA3,
+	// Bytes 3640 - 367f
+	0xB9, 0x03, 0x75, 0xCC, 0xA4, 0xB9, 0x03, 0x75,
+	0xCC, 0xA8, 0xA9, 0x03, 0x75, 0xCC, 0xAD, 0xB9,
+	0x03, 0x75, 0xCC, 0xB0, 0xB9, 0x03, 0x76, 0xCC,
+	0x83, 0xCD, 0x03, 0x76, 0xCC, 0xA3, 0xB9, 0x03,
+	0x77, 0xCC, 0x80, 0xCD, 0x03, 0x77, 0xCC, 0x81,
+	0xCD, 0x03, 0x77, 0xCC, 0x82, 0xCD, 0x03, 0x77,
+	0xCC, 0x87, 0xCD, 0x03, 0x77, 0xCC, 0x88, 0xCD,
+	0x03, 0x77, 0xCC, 0x8A, 0xCD, 0x03, 0x77, 0xCC,
+	// Bytes 3680 - 36bf
+	0xA3, 0xB9, 0x03, 0x78, 0xCC, 0x87, 0xCD, 0x03,
+	0x78, 0xCC, 0x88, 0xCD, 0x03, 0x79, 0xCC, 0x80,
+	0xCD, 0x03, 0x79, 0xCC, 0x81, 0xCD, 0x03, 0x79,
+	0xCC, 0x82, 0xCD, 0x03, 0x79, 0xCC, 0x83, 0xCD,
+	0x03, 0x79, 0xCC, 0x84, 0xCD, 0x03, 0x79, 0xCC,
+	0x87, 0xCD, 0x03, 0x79, 0xCC, 0x88, 0xCD, 0x03,
+	0x79, 0xCC, 0x89, 0xCD, 0x03, 0x79, 0xCC, 0x8A,
+	0xCD, 0x03, 0x79, 0xCC, 0xA3, 0xB9, 0x03, 0x7A,
+	// Bytes 36c0 - 36ff
+	0xCC, 0x81, 0xCD, 0x03, 0x7A, 0xCC, 0x82, 0xCD,
+	0x03, 0x7A, 0xCC, 0x87, 0xCD, 0x03, 0x7A, 0xCC,
+	0x8C, 0xCD, 0x03, 0x7A, 0xCC, 0xA3, 0xB9, 0x03,
+	0x7A, 0xCC, 0xB1, 0xB9, 0x04, 0xC2, 0xA8, 0xCC,
+	0x80, 0xCE, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCE,
+	0x04, 0xC2, 0xA8, 0xCD, 0x82, 0xCE, 0x04, 0xC3,
+	0x86, 0xCC, 0x81, 0xCD, 0x04, 0xC3, 0x86, 0xCC,
+	0x84, 0xCD, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xCD,
+	// Bytes 3700 - 373f
+	0x04, 0xC3, 0xA6, 0xCC, 0x81, 0xCD, 0x04, 0xC3,
+	0xA6, 0xCC, 0x84, 0xCD, 0x04, 0xC3, 0xB8, 0xCC,
+	0x81, 0xCD, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xCD,
+	0x04, 0xC6, 0xB7, 0xCC, 0x8C, 0xCD, 0x04, 0xCA,
+	0x92, 0xCC, 0x8C, 0xCD, 0x04, 0xCE, 0x91, 0xCC,
+	0x80, 0xCD, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xCD,
+	0x04, 0xCE, 0x91, 0xCC, 0x84, 0xCD, 0x04, 0xCE,
+	0x91, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0x91, 0xCD,
+	// Bytes 3740 - 377f
+	0x85, 0xDD, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xCD,
+	0x04, 0xCE, 0x95, 0xCC, 0x81, 0xCD, 0x04, 0xCE,
+	0x97, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x97, 0xCC,
+	0x81, 0xCD, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xDD,
+	0x04, 0xCE, 0x99, 0xCC, 0x80, 0xCD, 0x04, 0xCE,
+	0x99, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0x99, 0xCC,
+	0x84, 0xCD, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xCD,
+	0x04, 0xCE, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xCE,
+	// Bytes 3780 - 37bf
+	0x9F, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0x9F, 0xCC,
+	0x81, 0xCD, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xCD,
+	0x04, 0xCE, 0xA5, 0xCC, 0x80, 0xCD, 0x04, 0xCE,
+	0xA5, 0xCC, 0x81, 0xCD, 0x04, 0xCE, 0xA5, 0xCC,
+	0x84, 0xCD, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xCD,
+	0x04, 0xCE, 0xA5, 0xCC, 0x88, 0xCD, 0x04, 0xCE,
+	0xA9, 0xCC, 0x80, 0xCD, 0x04, 0xCE, 0xA9, 0xCC,
+	0x81, 0xCD, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xDD,
+	// Bytes 37c0 - 37ff
+	0x04, 0xCE, 0xB1, 0xCC, 0x84, 0xCD, 0x04, 0xCE,
+	0xB1, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB1, 0xCD,
+	0x85, 0xDD, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xCD,
+	0x04, 0xCE, 0xB5, 0xCC, 0x81, 0xCD, 0x04, 0xCE,
+	0xB7, 0xCD, 0x85, 0xDD, 0x04, 0xCE, 0xB9, 0xCC,
+	0x80, 0xCD, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xCD,
+	0x04, 0xCE, 0xB9, 0xCC, 0x84, 0xCD, 0x04, 0xCE,
+	0xB9, 0xCC, 0x86, 0xCD, 0x04, 0xCE, 0xB9, 0xCD,
+	// Bytes 3800 - 383f
+	0x82, 0xCD, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xCD,
+	0x04, 0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x04, 0xCF,
+	0x81, 0xCC, 0x93, 0xCD, 0x04, 0xCF, 0x81, 0xCC,
+	0x94, 0xCD, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xCD,
+	0x04, 0xCF, 0x85, 0xCC, 0x81, 0xCD, 0x04, 0xCF,
+	0x85, 0xCC, 0x84, 0xCD, 0x04, 0xCF, 0x85, 0xCC,
+	0x86, 0xCD, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xCD,
+	0x04, 0xCF, 0x89, 0xCD, 0x85, 0xDD, 0x04, 0xCF,
+	// Bytes 3840 - 387f
+	0x92, 0xCC, 0x81, 0xCD, 0x04, 0xCF, 0x92, 0xCC,
+	0x88, 0xCD, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xCD,
+	0x04, 0xD0, 0x90, 0xCC, 0x86, 0xCD, 0x04, 0xD0,
+	0x90, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x93, 0xCC,
+	0x81, 0xCD, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xCD,
+	0x04, 0xD0, 0x95, 0xCC, 0x86, 0xCD, 0x04, 0xD0,
+	0x95, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0x96, 0xCC,
+	0x86, 0xCD, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xCD,
+	// Bytes 3880 - 38bf
+	0x04, 0xD0, 0x97, 0xCC, 0x88, 0xCD, 0x04, 0xD0,
+	0x98, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0x98, 0xCC,
+	0x84, 0xCD, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xCD,
+	0x04, 0xD0, 0x98, 0xCC, 0x88, 0xCD, 0x04, 0xD0,
+	0x9A, 0xCC, 0x81, 0xCD, 0x04, 0xD0, 0x9E, 0xCC,
+	0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xCD,
+	0x04, 0xD0, 0xA3, 0xCC, 0x86, 0xCD, 0x04, 0xD0,
+	0xA3, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xA3, 0xCC,
+	// Bytes 38c0 - 38ff
+	0x8B, 0xCD, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xCD,
+	0x04, 0xD0, 0xAB, 0xCC, 0x88, 0xCD, 0x04, 0xD0,
+	0xAD, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB0, 0xCC,
+	0x86, 0xCD, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xCD,
+	0x04, 0xD0, 0xB3, 0xCC, 0x81, 0xCD, 0x04, 0xD0,
+	0xB5, 0xCC, 0x80, 0xCD, 0x04, 0xD0, 0xB5, 0xCC,
+	0x86, 0xCD, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xCD,
+	0x04, 0xD0, 0xB6, 0xCC, 0x86, 0xCD, 0x04, 0xD0,
+	// Bytes 3900 - 393f
+	0xB6, 0xCC, 0x88, 0xCD, 0x04, 0xD0, 0xB7, 0xCC,
+	0x88, 0xCD, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xCD,
+	0x04, 0xD0, 0xB8, 0xCC, 0x84, 0xCD, 0x04, 0xD0,
+	0xB8, 0xCC, 0x86, 0xCD, 0x04, 0xD0, 0xB8, 0xCC,
+	0x88, 0xCD, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xCD,
+	0x04, 0xD0, 0xBE, 0xCC, 0x88, 0xCD, 0x04, 0xD1,
+	0x83, 0xCC, 0x84, 0xCD, 0x04, 0xD1, 0x83, 0xCC,
+	0x86, 0xCD, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xCD,
+	// Bytes 3940 - 397f
+	0x04, 0xD1, 0x83, 0xCC, 0x8B, 0xCD, 0x04, 0xD1,
+	0x87, 0xCC, 0x88, 0xCD, 0x04, 0xD1, 0x8B, 0xCC,
+	0x88, 0xCD, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xCD,
+	0x04, 0xD1, 0x96, 0xCC, 0x88, 0xCD, 0x04, 0xD1,
+	0xB4, 0xCC, 0x8F, 0xCD, 0x04, 0xD1, 0xB5, 0xCC,
+	0x8F, 0xCD, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xCD,
+	0x04, 0xD3, 0x99, 0xCC, 0x88, 0xCD, 0x04, 0xD3,
+	0xA8, 0xCC, 0x88, 0xCD, 0x04, 0xD3, 0xA9, 0xCC,
+	// Bytes 3980 - 39bf
+	0x88, 0xCD, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xCD,
+	0x04, 0xD8, 0xA7, 0xD9, 0x94, 0xCD, 0x04, 0xD8,
+	0xA7, 0xD9, 0x95, 0xB9, 0x04, 0xD9, 0x88, 0xD9,
+	0x94, 0xCD, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xCD,
+	0x04, 0xDB, 0x81, 0xD9, 0x94, 0xCD, 0x04, 0xDB,
+	0x92, 0xD9, 0x94, 0xCD, 0x04, 0xDB, 0x95, 0xD9,
+	0x94, 0xCD, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80,
+	0xCE, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCE,
+	// Bytes 39c0 - 39ff
+	0x05, 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05,
+	0x41, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x41,
+	0xCC, 0x86, 0xCC, 0x80, 0xCE, 0x05, 0x41, 0xCC,
+	0x86, 0xCC, 0x81, 0xCE, 0x05, 0x41, 0xCC, 0x86,
+	0xCC, 0x83, 0xCE, 0x05, 0x41, 0xCC, 0x86, 0xCC,
+	0x89, 0xCE, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84,
+	0xCE, 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCE,
+	0x05, 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05,
+	// Bytes 3a00 - 3a3f
+	0x41, 0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x41,
+	0xCC, 0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x43, 0xCC,
+	0xA7, 0xCC, 0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82,
+	0xCC, 0x80, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC,
+	0x81, 0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83,
+	0xCE, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCE,
+	0x05, 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05,
+	0x45, 0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x45,
+	// Bytes 3a40 - 3a7f
+	0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x45, 0xCC,
+	0xA7, 0xCC, 0x86, 0xCE, 0x05, 0x49, 0xCC, 0x88,
+	0xCC, 0x81, 0xCE, 0x05, 0x4C, 0xCC, 0xA3, 0xCC,
+	0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80,
+	0xCE, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCE,
+	0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05,
+	0x4F, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x4F,
+	0xCC, 0x83, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC,
+	// Bytes 3a80 - 3abf
+	0x83, 0xCC, 0x84, 0xCE, 0x05, 0x4F, 0xCC, 0x83,
+	0xCC, 0x88, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC,
+	0x80, 0xCE, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81,
+	0xCE, 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCE,
+	0x05, 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05,
+	0x4F, 0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x4F,
+	0xCC, 0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x4F, 0xCC,
+	0x9B, 0xCC, 0x83, 0xCE, 0x05, 0x4F, 0xCC, 0x9B,
+	// Bytes 3ac0 - 3aff
+	0xCC, 0x89, 0xCE, 0x05, 0x4F, 0xCC, 0x9B, 0xCC,
+	0xA3, 0xBA, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82,
+	0xCE, 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE,
+	0x05, 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05,
+	0x53, 0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x53,
+	0xCC, 0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x53, 0xCC,
+	0xA3, 0xCC, 0x87, 0xCE, 0x05, 0x55, 0xCC, 0x83,
+	0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x84, 0xCC,
+	// Bytes 3b00 - 3b3f
+	0x88, 0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80,
+	0xCE, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCE,
+	0x05, 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05,
+	0x55, 0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x55,
+	0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x55, 0xCC,
+	0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x55, 0xCC, 0x9B,
+	0xCC, 0x83, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC,
+	0x89, 0xCE, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3,
+	// Bytes 3b40 - 3b7f
+	0xBA, 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCE,
+	0x05, 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05,
+	0x61, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x61,
+	0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x61, 0xCC,
+	0x86, 0xCC, 0x80, 0xCE, 0x05, 0x61, 0xCC, 0x86,
+	0xCC, 0x81, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC,
+	0x83, 0xCE, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89,
+	0xCE, 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCE,
+	// Bytes 3b80 - 3bbf
+	0x05, 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05,
+	0x61, 0xCC, 0x8A, 0xCC, 0x81, 0xCE, 0x05, 0x61,
+	0xCC, 0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x61, 0xCC,
+	0xA3, 0xCC, 0x86, 0xCE, 0x05, 0x63, 0xCC, 0xA7,
+	0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC,
+	0x80, 0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81,
+	0xCE, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCE,
+	0x05, 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05,
+	// Bytes 3bc0 - 3bff
+	0x65, 0xCC, 0x84, 0xCC, 0x80, 0xCE, 0x05, 0x65,
+	0xCC, 0x84, 0xCC, 0x81, 0xCE, 0x05, 0x65, 0xCC,
+	0xA3, 0xCC, 0x82, 0xCE, 0x05, 0x65, 0xCC, 0xA7,
+	0xCC, 0x86, 0xCE, 0x05, 0x69, 0xCC, 0x88, 0xCC,
+	0x81, 0xCE, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84,
+	0xCE, 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCE,
+	0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCE, 0x05,
+	0x6F, 0xCC, 0x82, 0xCC, 0x83, 0xCE, 0x05, 0x6F,
+	// Bytes 3c00 - 3c3f
+	0xCC, 0x82, 0xCC, 0x89, 0xCE, 0x05, 0x6F, 0xCC,
+	0x83, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x83,
+	0xCC, 0x84, 0xCE, 0x05, 0x6F, 0xCC, 0x83, 0xCC,
+	0x88, 0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80,
+	0xCE, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCE,
+	0x05, 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCE, 0x05,
+	0x6F, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x6F,
+	0xCC, 0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x6F, 0xCC,
+	// Bytes 3c40 - 3c7f
+	0x9B, 0xCC, 0x81, 0xCE, 0x05, 0x6F, 0xCC, 0x9B,
+	0xCC, 0x83, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC,
+	0x89, 0xCE, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3,
+	0xBA, 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCE,
+	0x05, 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCE, 0x05,
+	0x72, 0xCC, 0xA3, 0xCC, 0x84, 0xCE, 0x05, 0x73,
+	0xCC, 0x81, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC,
+	0x8C, 0xCC, 0x87, 0xCE, 0x05, 0x73, 0xCC, 0xA3,
+	// Bytes 3c80 - 3cbf
+	0xCC, 0x87, 0xCE, 0x05, 0x75, 0xCC, 0x83, 0xCC,
+	0x81, 0xCE, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88,
+	0xCE, 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCE,
+	0x05, 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x05,
+	0x75, 0xCC, 0x88, 0xCC, 0x84, 0xCE, 0x05, 0x75,
+	0xCC, 0x88, 0xCC, 0x8C, 0xCE, 0x05, 0x75, 0xCC,
+	0x9B, 0xCC, 0x80, 0xCE, 0x05, 0x75, 0xCC, 0x9B,
+	0xCC, 0x81, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC,
+	// Bytes 3cc0 - 3cff
+	0x83, 0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89,
+	0xCE, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xBA,
+	0x05, 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCE, 0x05,
+	0xE1, 0xBE, 0xBF, 0xCC, 0x81, 0xCE, 0x05, 0xE1,
+	0xBE, 0xBF, 0xCD, 0x82, 0xCE, 0x05, 0xE1, 0xBF,
+	0xBE, 0xCC, 0x80, 0xCE, 0x05, 0xE1, 0xBF, 0xBE,
+	0xCC, 0x81, 0xCE, 0x05, 0xE1, 0xBF, 0xBE, 0xCD,
+	0x82, 0xCE, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8,
+	// Bytes 3d00 - 3d3f
+	0x05, 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x87, 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87,
+	0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05,
+	// Bytes 3d40 - 3d7f
+	0x05, 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x89, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+	0x85, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05,
+	// Bytes 3d80 - 3dbf
+	0xE2, 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x89, 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89,
+	0xB6, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	// Bytes 3dc0 - 3dff
+	0x8A, 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+	0x86, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8,
+	0x05, 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05,
+	0x05, 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05,
+	0xE2, 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2,
+	0x8A, 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A,
+	// Bytes 3e00 - 3e3f
+	0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3,
+	0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC,
+	0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8,
+	0x05, 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80,
+	// Bytes 3e40 - 3e7f
+	0xCE, 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82,
+	0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81,
+	// Bytes 3e80 - 3ebf
+	0xCE, 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82,
+	0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82,
+	// Bytes 3ec0 - 3eff
+	0xCE, 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80,
+	// Bytes 3f00 - 3f3f
+	0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85,
+	// Bytes 3f40 - 3f7f
+	0xDE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81,
+	// Bytes 3f80 - 3fbf
+	0xCE, 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82,
+	0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82,
+	// Bytes 3fc0 - 3fff
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81,
+	0xCE, 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82,
+	0xCE, 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85,
+	0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85,
+	// Bytes 4000 - 403f
+	0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85,
+	0xDE, 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85,
+	0xDE, 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85,
+	0xDE, 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC,
+	0x0D, 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC,
+	0x0D, 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC,
+	0x0D, 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96,
+	0x89, 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A,
+	// Bytes 4040 - 407f
+	0x15, 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99,
+	// Bytes 4080 - 40bf
+	0x11, 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99,
+	// Bytes 40c0 - 40ff
+	0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A,
+	// Bytes 4100 - 413f
+	0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99,
+	// Bytes 4140 - 417f
+	0x11, 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99,
+	// Bytes 4180 - 41bf
+	0x11, 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99,
+	// Bytes 41c0 - 41ff
+	0x11, 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A,
+	0x11, 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99,
+	// Bytes 4200 - 423f
+	0x11, 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99,
+	0x11, 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99,
+	0x11, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x93,
+	0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91,
+	0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81,
+	// Bytes 4240 - 427f
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x91, 0xCC, 0x94,
+	0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97,
+	0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97, 0xCC, 0x94,
+	0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0x97,
+	0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08,
+	// Bytes 4280 - 42bf
+	0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x93,
+	0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9,
+	0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xA9, 0xCC, 0x94,
+	// Bytes 42c0 - 42ff
+	0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1,
+	0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1, 0xCC, 0x94,
+	0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB1,
+	0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85,
+	// Bytes 4300 - 433f
+	0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x93,
+	0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7,
+	0xCC, 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08,
+	0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85,
+	0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81,
+	0xCD, 0x85, 0xDF, 0x08, 0xCE, 0xB7, 0xCC, 0x94,
+	0xCD, 0x82, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89,
+	// Bytes 4340 - 437f
+	0xCC, 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08,
+	0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85,
+	0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82,
+	0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89, 0xCC, 0x94,
+	0xCC, 0x80, 0xCD, 0x85, 0xDF, 0x08, 0xCF, 0x89,
+	0xCC, 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDF, 0x08,
+	0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85,
+	0xDF, 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91,
+	// Bytes 4380 - 43bf
+	0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91, 0x82, 0x9B,
+	0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x08, 0xF0, 0x91,
+	0x82, 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x0D, 0x42,
+	0xC2, 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xCD,
+	0x43, 0x20, 0xCC, 0x83, 0xCD, 0x43, 0x20, 0xCC,
+	0x84, 0xCD, 0x43, 0x20, 0xCC, 0x85, 0xCD, 0x43,
+	0x20, 0xCC, 0x86, 0xCD, 0x43, 0x20, 0xCC, 0x87,
+	0xCD, 0x43, 0x20, 0xCC, 0x88, 0xCD, 0x43, 0x20,
+	// Bytes 43c0 - 43ff
+	0xCC, 0x8A, 0xCD, 0x43, 0x20, 0xCC, 0x8B, 0xCD,
+	0x43, 0x20, 0xCC, 0x93, 0xCD, 0x43, 0x20, 0xCC,
+	0x94, 0xCD, 0x43, 0x20, 0xCC, 0xA7, 0xA9, 0x43,
+	0x20, 0xCC, 0xA8, 0xA9, 0x43, 0x20, 0xCC, 0xB3,
+	0xB9, 0x43, 0x20, 0xCD, 0x82, 0xCD, 0x43, 0x20,
+	0xCD, 0x85, 0xDD, 0x43, 0x20, 0xD9, 0x8B, 0x5D,
+	0x43, 0x20, 0xD9, 0x8C, 0x61, 0x43, 0x20, 0xD9,
+	0x8D, 0x65, 0x43, 0x20, 0xD9, 0x8E, 0x69, 0x43,
+	// Bytes 4400 - 443f
+	0x20, 0xD9, 0x8F, 0x6D, 0x43, 0x20, 0xD9, 0x90,
+	0x71, 0x43, 0x20, 0xD9, 0x91, 0x75, 0x43, 0x20,
+	0xD9, 0x92, 0x79, 0x43, 0x41, 0xCC, 0x8A, 0xCD,
+	0x43, 0x73, 0xCC, 0x87, 0xCD, 0x44, 0x20, 0xE3,
+	0x82, 0x99, 0x11, 0x44, 0x20, 0xE3, 0x82, 0x9A,
+	0x11, 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCE, 0x44,
+	0xCE, 0x91, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x95,
+	0xCC, 0x81, 0xCD, 0x44, 0xCE, 0x97, 0xCC, 0x81,
+	// Bytes 4440 - 447f
+	0xCD, 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xCD, 0x44,
+	0xCE, 0x9F, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5,
+	0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xA5, 0xCC, 0x88,
+	0xCD, 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xCD, 0x44,
+	0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB5,
+	0xCC, 0x81, 0xCD, 0x44, 0xCE, 0xB7, 0xCC, 0x81,
+	0xCD, 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xCD, 0x44,
+	0xCE, 0xBF, 0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x85,
+	// Bytes 4480 - 44bf
+	0xCC, 0x81, 0xCD, 0x44, 0xCF, 0x89, 0xCC, 0x81,
+	0xCD, 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x35, 0x44,
+	0xD7, 0x90, 0xD6, 0xB8, 0x39, 0x44, 0xD7, 0x90,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBC,
+	0x45, 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x4D, 0x44,
+	0xD7, 0x92, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x93,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x94, 0xD6, 0xBC,
+	0x45, 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x3D, 0x44,
+	// Bytes 44c0 - 44ff
+	0xD7, 0x95, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x96,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x98, 0xD6, 0xBC,
+	0x45, 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x29, 0x44,
+	0xD7, 0x99, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9A,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBC,
+	0x45, 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x4D, 0x44,
+	0xD7, 0x9C, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0x9E,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA0, 0xD6, 0xBC,
+	// Bytes 4500 - 453f
+	0x45, 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x45, 0x44,
+	0xD7, 0xA3, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA4, 0xD6, 0xBF,
+	0x4D, 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x45, 0x44,
+	0xD7, 0xA7, 0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA8,
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xA9, 0xD6, 0xBC,
+	0x45, 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x51, 0x44,
+	0xD7, 0xA9, 0xD7, 0x82, 0x55, 0x44, 0xD7, 0xAA,
+	// Bytes 4540 - 457f
+	0xD6, 0xBC, 0x45, 0x44, 0xD7, 0xB2, 0xD6, 0xB7,
+	0x35, 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x5D, 0x44,
+	0xD8, 0xA7, 0xD9, 0x93, 0xCD, 0x44, 0xD8, 0xA7,
+	0xD9, 0x94, 0xCD, 0x44, 0xD8, 0xA7, 0xD9, 0x95,
+	0xB9, 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x7D, 0x44,
+	0xD8, 0xB1, 0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x80,
+	0xD9, 0x8B, 0x5D, 0x44, 0xD9, 0x80, 0xD9, 0x8E,
+	0x69, 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x6D, 0x44,
+	// Bytes 4580 - 45bf
+	0xD9, 0x80, 0xD9, 0x90, 0x71, 0x44, 0xD9, 0x80,
+	0xD9, 0x91, 0x75, 0x44, 0xD9, 0x80, 0xD9, 0x92,
+	0x79, 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x7D, 0x44,
+	0xD9, 0x88, 0xD9, 0x94, 0xCD, 0x44, 0xD9, 0x89,
+	0xD9, 0xB0, 0x7D, 0x44, 0xD9, 0x8A, 0xD9, 0x94,
+	0xCD, 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xCD, 0x44,
+	0xDB, 0x95, 0xD9, 0x94, 0xCD, 0x45, 0x20, 0xCC,
+	0x88, 0xCC, 0x80, 0xCE, 0x45, 0x20, 0xCC, 0x88,
+	// Bytes 45c0 - 45ff
+	0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC, 0x88, 0xCD,
+	0x82, 0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80,
+	0xCE, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCE,
+	0x45, 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x45,
+	0x20, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x45, 0x20,
+	0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x45, 0x20, 0xCC,
+	0x94, 0xCD, 0x82, 0xCE, 0x45, 0x20, 0xD9, 0x8C,
+	0xD9, 0x91, 0x76, 0x45, 0x20, 0xD9, 0x8D, 0xD9,
+	// Bytes 4600 - 463f
+	0x91, 0x76, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91,
+	0x76, 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x76,
+	0x45, 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x76, 0x45,
+	0x20, 0xD9, 0x91, 0xD9, 0xB0, 0x7E, 0x45, 0xE2,
+	0xAB, 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9,
+	0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xCF, 0x85,
+	0xCC, 0x88, 0xCC, 0x81, 0xCE, 0x46, 0xD7, 0xA9,
+	0xD6, 0xBC, 0xD7, 0x81, 0x52, 0x46, 0xD7, 0xA9,
+	// Bytes 4640 - 467f
+	0xD6, 0xBC, 0xD7, 0x82, 0x56, 0x46, 0xD9, 0x80,
+	0xD9, 0x8E, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80,
+	0xD9, 0x8F, 0xD9, 0x91, 0x76, 0x46, 0xD9, 0x80,
+	0xD9, 0x90, 0xD9, 0x91, 0x76, 0x46, 0xE0, 0xA4,
+	0x95, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0x96, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0x97, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0x9C, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	// Bytes 4680 - 46bf
+	0xA1, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0xA2, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0xAB, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA4,
+	0xAF, 0xE0, 0xA4, 0xBC, 0x0D, 0x46, 0xE0, 0xA6,
+	0xA1, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6,
+	0xA2, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA6,
+	0xAF, 0xE0, 0xA6, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	0x96, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	// Bytes 46c0 - 46ff
+	0x97, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	0x9C, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	0xAB, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	0xB2, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xA8,
+	0xB8, 0xE0, 0xA8, 0xBC, 0x0D, 0x46, 0xE0, 0xAC,
+	0xA1, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xAC,
+	0xA2, 0xE0, 0xAC, 0xBC, 0x0D, 0x46, 0xE0, 0xBE,
+	0xB2, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE0, 0xBE,
+	// Bytes 4700 - 473f
+	0xB3, 0xE0, 0xBE, 0x80, 0xA1, 0x46, 0xE3, 0x83,
+	0x86, 0xE3, 0x82, 0x99, 0x11, 0x48, 0xF0, 0x9D,
+	0x85, 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x48,
+	0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5,
+	0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D,
+	0x85, 0xA5, 0xB1, 0x48, 0xF0, 0x9D, 0x86, 0xBA,
+	0xF0, 0x9D, 0x85, 0xA5, 0xB1, 0x49, 0xE0, 0xBE,
+	0xB2, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2,
+	// Bytes 4740 - 477f
+	0x49, 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0,
+	0xBE, 0x80, 0xA2, 0x4C, 0xF0, 0x9D, 0x85, 0x98,
+	0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE,
+	0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D,
+	0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C,
+	0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5,
+	0xF0, 0x9D, 0x85, 0xB0, 0xB2, 0x4C, 0xF0, 0x9D,
+	0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D,
+	// Bytes 4780 - 47bf
+	0x85, 0xB1, 0xB2, 0x4C, 0xF0, 0x9D, 0x85, 0x98,
+	0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2,
+	0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D,
+	0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xB2, 0x4C,
+	0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5,
+	0xF0, 0x9D, 0x85, 0xAF, 0xB2, 0x4C, 0xF0, 0x9D,
+	0x86, 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D,
+	0x85, 0xAE, 0xB2, 0x4C, 0xF0, 0x9D, 0x86, 0xBA,
+	// Bytes 47c0 - 47ff
+	0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF,
+	0xB2, 0x83, 0x41, 0xCC, 0x82, 0xCD, 0x83, 0x41,
+	0xCC, 0x86, 0xCD, 0x83, 0x41, 0xCC, 0x87, 0xCD,
+	0x83, 0x41, 0xCC, 0x88, 0xCD, 0x83, 0x41, 0xCC,
+	0x8A, 0xCD, 0x83, 0x41, 0xCC, 0xA3, 0xB9, 0x83,
+	0x43, 0xCC, 0xA7, 0xA9, 0x83, 0x45, 0xCC, 0x82,
+	0xCD, 0x83, 0x45, 0xCC, 0x84, 0xCD, 0x83, 0x45,
+	0xCC, 0xA3, 0xB9, 0x83, 0x45, 0xCC, 0xA7, 0xA9,
+	// Bytes 4800 - 483f
+	0x83, 0x49, 0xCC, 0x88, 0xCD, 0x83, 0x4C, 0xCC,
+	0xA3, 0xB9, 0x83, 0x4F, 0xCC, 0x82, 0xCD, 0x83,
+	0x4F, 0xCC, 0x83, 0xCD, 0x83, 0x4F, 0xCC, 0x84,
+	0xCD, 0x83, 0x4F, 0xCC, 0x87, 0xCD, 0x83, 0x4F,
+	0xCC, 0x88, 0xCD, 0x83, 0x4F, 0xCC, 0x9B, 0xB1,
+	0x83, 0x4F, 0xCC, 0xA3, 0xB9, 0x83, 0x4F, 0xCC,
+	0xA8, 0xA9, 0x83, 0x52, 0xCC, 0xA3, 0xB9, 0x83,
+	0x53, 0xCC, 0x81, 0xCD, 0x83, 0x53, 0xCC, 0x8C,
+	// Bytes 4840 - 487f
+	0xCD, 0x83, 0x53, 0xCC, 0xA3, 0xB9, 0x83, 0x55,
+	0xCC, 0x83, 0xCD, 0x83, 0x55, 0xCC, 0x84, 0xCD,
+	0x83, 0x55, 0xCC, 0x88, 0xCD, 0x83, 0x55, 0xCC,
+	0x9B, 0xB1, 0x83, 0x61, 0xCC, 0x82, 0xCD, 0x83,
+	0x61, 0xCC, 0x86, 0xCD, 0x83, 0x61, 0xCC, 0x87,
+	0xCD, 0x83, 0x61, 0xCC, 0x88, 0xCD, 0x83, 0x61,
+	0xCC, 0x8A, 0xCD, 0x83, 0x61, 0xCC, 0xA3, 0xB9,
+	0x83, 0x63, 0xCC, 0xA7, 0xA9, 0x83, 0x65, 0xCC,
+	// Bytes 4880 - 48bf
+	0x82, 0xCD, 0x83, 0x65, 0xCC, 0x84, 0xCD, 0x83,
+	0x65, 0xCC, 0xA3, 0xB9, 0x83, 0x65, 0xCC, 0xA7,
+	0xA9, 0x83, 0x69, 0xCC, 0x88, 0xCD, 0x83, 0x6C,
+	0xCC, 0xA3, 0xB9, 0x83, 0x6F, 0xCC, 0x82, 0xCD,
+	0x83, 0x6F, 0xCC, 0x83, 0xCD, 0x83, 0x6F, 0xCC,
+	0x84, 0xCD, 0x83, 0x6F, 0xCC, 0x87, 0xCD, 0x83,
+	0x6F, 0xCC, 0x88, 0xCD, 0x83, 0x6F, 0xCC, 0x9B,
+	0xB1, 0x83, 0x6F, 0xCC, 0xA3, 0xB9, 0x83, 0x6F,
+	// Bytes 48c0 - 48ff
+	0xCC, 0xA8, 0xA9, 0x83, 0x72, 0xCC, 0xA3, 0xB9,
+	0x83, 0x73, 0xCC, 0x81, 0xCD, 0x83, 0x73, 0xCC,
+	0x8C, 0xCD, 0x83, 0x73, 0xCC, 0xA3, 0xB9, 0x83,
+	0x75, 0xCC, 0x83, 0xCD, 0x83, 0x75, 0xCC, 0x84,
+	0xCD, 0x83, 0x75, 0xCC, 0x88, 0xCD, 0x83, 0x75,
+	0xCC, 0x9B, 0xB1, 0x84, 0xCE, 0x91, 0xCC, 0x93,
+	0xCD, 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x84,
+	0xCE, 0x95, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x95,
+	// Bytes 4900 - 493f
+	0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x93,
+	0xCD, 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x84,
+	0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0x99,
+	0xCC, 0x94, 0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x93,
+	0xCD, 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xCD, 0x84,
+	0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xA9,
+	0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xA9, 0xCC, 0x94,
+	0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x84,
+	// Bytes 4940 - 497f
+	0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x84, 0xCE, 0xB1,
+	0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB1, 0xCC, 0x94,
+	0xCD, 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x84,
+	0xCE, 0xB5, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB5,
+	0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x80,
+	0xCD, 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x84,
+	0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB7,
+	0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xB7, 0xCD, 0x82,
+	// Bytes 4980 - 49bf
+	0xCD, 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x84,
+	0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x84, 0xCE, 0xB9,
+	0xCC, 0x94, 0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x93,
+	0xCD, 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xCD, 0x84,
+	0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x84, 0xCF, 0x85,
+	0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x85, 0xCC, 0x94,
+	0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x84,
+	0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x84, 0xCF, 0x89,
+	// Bytes 49c0 - 49ff
+	0xCC, 0x93, 0xCD, 0x84, 0xCF, 0x89, 0xCC, 0x94,
+	0xCD, 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x86,
+	0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86,
+	// Bytes 4a00 - 4a3f
+	0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	// Bytes 4a40 - 4a7f
+	0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	// Bytes 4a80 - 4abf
+	0xCE, 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x86,
+	// Bytes 4ac0 - 4aff
+	0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCE, 0x86,
+	0xCF, 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCE, 0x86,
+	0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCE, 0x86,
+	0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCE, 0x86,
+	0xCF, 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCE, 0x86,
+	0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCE, 0x42,
+	0xCC, 0x80, 0xCD, 0x33, 0x42, 0xCC, 0x81, 0xCD,
+	0x33, 0x42, 0xCC, 0x93, 0xCD, 0x33, 0x43, 0xE1,
+	// Bytes 4b00 - 4b3f
+	0x85, 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2,
+	0x01, 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00,
+	0x43, 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1,
+	0x85, 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6,
+	0x01, 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00,
+	0x43, 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1,
+	0x85, 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA,
+	0x01, 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00,
+	// Bytes 4b40 - 4b7f
+	0x43, 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1,
+	0x85, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE,
+	0x01, 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00,
+	0x43, 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1,
+	0x85, 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2,
+	0x01, 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00,
+	0x43, 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1,
+	0x85, 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA,
+	// Bytes 4b80 - 4bbf
+	0x01, 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00,
+	0x43, 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1,
+	0x86, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1,
+	0x01, 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00,
+	0x43, 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1,
+	0x86, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5,
+	0x01, 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCE,
+	0x33, 0x43, 0xE3, 0x82, 0x99, 0x11, 0x04, 0x43,
+	// Bytes 4bc0 - 4bff
+	0xE3, 0x82, 0x9A, 0x11, 0x04, 0x46, 0xE0, 0xBD,
+	0xB1, 0xE0, 0xBD, 0xB2, 0xA2, 0x27, 0x46, 0xE0,
+	0xBD, 0xB1, 0xE0, 0xBD, 0xB4, 0xA6, 0x27, 0x46,
+	0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0xA2, 0x27,
+	0x00, 0x01,
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupUnsafe(s []byte) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfcValues[c0]
+	}
+	i := nfcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfcTrie) lookupString(s string) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfcTrie) lookupStringUnsafe(s string) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfcValues[c0]
+	}
+	i := nfcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// nfcTrie. Total size: 10798 bytes (10.54 KiB). Checksum: b5981cc85e3bd14.
+type nfcTrie struct{}
+
+func newNfcTrie(i int) *nfcTrie {
+	return &nfcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 {
+	switch {
+	case n < 46:
+		return uint16(nfcValues[n<<6+uint32(b)])
+	default:
+		n -= 46
+		return uint16(nfcSparse.lookup(n, b))
+	}
+}
+
+// nfcValues: 48 blocks, 3072 entries, 6144 bytes
+// The third block is the zero block.
+var nfcValues = [3072]uint16{
+	// Block 0x0, offset 0x0
+	0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+	// Block 0x1, offset 0x40
+	0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+	0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+	0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+	0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+	0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+	0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+	0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+	0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+	0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+	0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd,
+	0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c,
+	0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245,
+	0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e,
+	0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376,
+	0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6,
+	0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434,
+	0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891,
+	0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0,
+	0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614,
+	0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa,
+	// Block 0x4, offset 0x100
+	0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9,
+	0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407,
+	0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416,
+	0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443,
+	0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a,
+	0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493,
+	0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf,
+	0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7,
+	0x130: 0x31cd, 0x134: 0x31f5, 0x135: 0x3501,
+	0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d,
+	0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529,
+	// Block 0x5, offset 0x140
+	0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259,
+	0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560,
+	0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d,
+	0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4,
+	0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce,
+	0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb,
+	0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7,
+	0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623,
+	0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669,
+	0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8,
+	0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0xa000,
+	// Block 0x6, offset 0x180
+	0x184: 0x8100, 0x185: 0x8100,
+	0x186: 0x8100,
+	0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281,
+	0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09,
+	0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91,
+	0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706,
+	0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510,
+	0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e,
+	0x1b0: 0x3506, 0x1b4: 0x3169, 0x1b5: 0x3475,
+	0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87,
+	0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457,
+	0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed,
+	0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba,
+	0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637,
+	0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6,
+	0x1de: 0x319b, 0x1df: 0x34a7,
+	0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c,
+	0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa,
+	0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0,
+	// Block 0x8, offset 0x200
+	0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133,
+	0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933,
+	0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933,
+	0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e,
+	0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e,
+	0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e,
+	0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e,
+	0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e,
+	0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101,
+	0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e,
+	0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133,
+	// Block 0x9, offset 0x240
+	0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937,
+	0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133,
+	0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133,
+	0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133,
+	0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136,
+	0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133,
+	0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133,
+	0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133,
+	0x274: 0x01ee,
+	0x27a: 0x8100,
+	0x27e: 0x0037,
+	// Block 0xa, offset 0x280
+	0x284: 0x8100, 0x285: 0x36e2,
+	0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766,
+	0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000,
+	0x295: 0xa000, 0x297: 0xa000,
+	0x299: 0xa000,
+	0x29f: 0xa000, 0x2a1: 0xa000,
+	0x2a5: 0xa000, 0x2a9: 0xa000,
+	0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea,
+	0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000,
+	0x2b7: 0xa000, 0x2b9: 0xa000,
+	0x2bf: 0xa000,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0x3862, 0x2c1: 0x386e, 0x2c3: 0x385c,
+	0x2c6: 0xa000, 0x2c7: 0x384a,
+	0x2cc: 0x389e, 0x2cd: 0x3886, 0x2ce: 0x38b0, 0x2d0: 0xa000,
+	0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000,
+	0x2d8: 0xa000, 0x2d9: 0x3892, 0x2da: 0xa000,
+	0x2de: 0xa000, 0x2e3: 0xa000,
+	0x2e7: 0xa000,
+	0x2eb: 0xa000, 0x2ed: 0xa000,
+	0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000,
+	0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x3916, 0x2fa: 0xa000,
+	0x2fe: 0xa000,
+	// Block 0xc, offset 0x300
+	0x301: 0x3874, 0x302: 0x38f8,
+	0x310: 0x3850, 0x311: 0x38d4,
+	0x312: 0x3856, 0x313: 0x38da, 0x316: 0x3868, 0x317: 0x38ec,
+	0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x396a, 0x31b: 0x3970, 0x31c: 0x387a, 0x31d: 0x38fe,
+	0x31e: 0x3880, 0x31f: 0x3904, 0x322: 0x388c, 0x323: 0x3910,
+	0x324: 0x3898, 0x325: 0x391c, 0x326: 0x38a4, 0x327: 0x3928, 0x328: 0xa000, 0x329: 0xa000,
+	0x32a: 0x3976, 0x32b: 0x397c, 0x32c: 0x38ce, 0x32d: 0x3952, 0x32e: 0x38aa, 0x32f: 0x392e,
+	0x330: 0x38b6, 0x331: 0x393a, 0x332: 0x38bc, 0x333: 0x3940, 0x334: 0x38c2, 0x335: 0x3946,
+	0x338: 0x38c8, 0x339: 0x394c,
+	// Block 0xd, offset 0x340
+	0x351: 0x812e,
+	0x352: 0x8133, 0x353: 0x8133, 0x354: 0x8133, 0x355: 0x8133, 0x356: 0x812e, 0x357: 0x8133,
+	0x358: 0x8133, 0x359: 0x8133, 0x35a: 0x812f, 0x35b: 0x812e, 0x35c: 0x8133, 0x35d: 0x8133,
+	0x35e: 0x8133, 0x35f: 0x8133, 0x360: 0x8133, 0x361: 0x8133, 0x362: 0x812e, 0x363: 0x812e,
+	0x364: 0x812e, 0x365: 0x812e, 0x366: 0x812e, 0x367: 0x812e, 0x368: 0x8133, 0x369: 0x8133,
+	0x36a: 0x812e, 0x36b: 0x8133, 0x36c: 0x8133, 0x36d: 0x812f, 0x36e: 0x8132, 0x36f: 0x8133,
+	0x370: 0x8106, 0x371: 0x8107, 0x372: 0x8108, 0x373: 0x8109, 0x374: 0x810a, 0x375: 0x810b,
+	0x376: 0x810c, 0x377: 0x810d, 0x378: 0x810e, 0x379: 0x810f, 0x37a: 0x810f, 0x37b: 0x8110,
+	0x37c: 0x8111, 0x37d: 0x8112, 0x37f: 0x8113,
+	// Block 0xe, offset 0x380
+	0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8117,
+	0x38c: 0x8118, 0x38d: 0x8119, 0x38e: 0x811a, 0x38f: 0x811b, 0x390: 0x811c, 0x391: 0x811d,
+	0x392: 0x811e, 0x393: 0x9933, 0x394: 0x9933, 0x395: 0x992e, 0x396: 0x812e, 0x397: 0x8133,
+	0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x8133, 0x39b: 0x8133, 0x39c: 0x812e, 0x39d: 0x8133,
+	0x39e: 0x8133, 0x39f: 0x812e,
+	0x3b0: 0x811f,
+	// Block 0xf, offset 0x3c0
+	0x3ca: 0x8133, 0x3cb: 0x8133,
+	0x3cc: 0x8133, 0x3cd: 0x8133, 0x3ce: 0x8133, 0x3cf: 0x812e, 0x3d0: 0x812e, 0x3d1: 0x812e,
+	0x3d2: 0x812e, 0x3d3: 0x812e, 0x3d4: 0x8133, 0x3d5: 0x8133, 0x3d6: 0x8133, 0x3d7: 0x8133,
+	0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x8133, 0x3dd: 0x8133,
+	0x3de: 0x8133, 0x3df: 0x8133, 0x3e0: 0x8133, 0x3e1: 0x8133, 0x3e3: 0x812e,
+	0x3e4: 0x8133, 0x3e5: 0x8133, 0x3e6: 0x812e, 0x3e7: 0x8133, 0x3e8: 0x8133, 0x3e9: 0x812e,
+	0x3ea: 0x8133, 0x3eb: 0x8133, 0x3ec: 0x8133, 0x3ed: 0x812e, 0x3ee: 0x812e, 0x3ef: 0x812e,
+	0x3f0: 0x8117, 0x3f1: 0x8118, 0x3f2: 0x8119, 0x3f3: 0x8133, 0x3f4: 0x8133, 0x3f5: 0x8133,
+	0x3f6: 0x812e, 0x3f7: 0x8133, 0x3f8: 0x8133, 0x3f9: 0x812e, 0x3fa: 0x812e, 0x3fb: 0x8133,
+	0x3fc: 0x8133, 0x3fd: 0x8133, 0x3fe: 0x8133, 0x3ff: 0x8133,
+	// Block 0x10, offset 0x400
+	0x405: 0xa000,
+	0x406: 0x2e5d, 0x407: 0xa000, 0x408: 0x2e65, 0x409: 0xa000, 0x40a: 0x2e6d, 0x40b: 0xa000,
+	0x40c: 0x2e75, 0x40d: 0xa000, 0x40e: 0x2e7d, 0x411: 0xa000,
+	0x412: 0x2e85,
+	0x434: 0x8103, 0x435: 0x9900,
+	0x43a: 0xa000, 0x43b: 0x2e8d,
+	0x43c: 0xa000, 0x43d: 0x2e95, 0x43e: 0xa000, 0x43f: 0xa000,
+	// Block 0x11, offset 0x440
+	0x440: 0x8133, 0x441: 0x8133, 0x442: 0x812e, 0x443: 0x8133, 0x444: 0x8133, 0x445: 0x8133,
+	0x446: 0x8133, 0x447: 0x8133, 0x448: 0x8133, 0x449: 0x8133, 0x44a: 0x812e, 0x44b: 0x8133,
+	0x44c: 0x8133, 0x44d: 0x8136, 0x44e: 0x812b, 0x44f: 0x812e, 0x450: 0x812a, 0x451: 0x8133,
+	0x452: 0x8133, 0x453: 0x8133, 0x454: 0x8133, 0x455: 0x8133, 0x456: 0x8133, 0x457: 0x8133,
+	0x458: 0x8133, 0x459: 0x8133, 0x45a: 0x8133, 0x45b: 0x8133, 0x45c: 0x8133, 0x45d: 0x8133,
+	0x45e: 0x8133, 0x45f: 0x8133, 0x460: 0x8133, 0x461: 0x8133, 0x462: 0x8133, 0x463: 0x8133,
+	0x464: 0x8133, 0x465: 0x8133, 0x466: 0x8133, 0x467: 0x8133, 0x468: 0x8133, 0x469: 0x8133,
+	0x46a: 0x8133, 0x46b: 0x8133, 0x46c: 0x8133, 0x46d: 0x8133, 0x46e: 0x8133, 0x46f: 0x8133,
+	0x470: 0x8133, 0x471: 0x8133, 0x472: 0x8133, 0x473: 0x8133, 0x474: 0x8133, 0x475: 0x8133,
+	0x476: 0x8134, 0x477: 0x8132, 0x478: 0x8132, 0x479: 0x812e, 0x47a: 0x812d, 0x47b: 0x8133,
+	0x47c: 0x8135, 0x47d: 0x812e, 0x47e: 0x8133, 0x47f: 0x812e,
+	// Block 0x12, offset 0x480
+	0x480: 0x30d8, 0x481: 0x33e4, 0x482: 0x30e2, 0x483: 0x33ee, 0x484: 0x30e7, 0x485: 0x33f3,
+	0x486: 0x30ec, 0x487: 0x33f8, 0x488: 0x3a0d, 0x489: 0x3b9c, 0x48a: 0x3105, 0x48b: 0x3411,
+	0x48c: 0x310f, 0x48d: 0x341b, 0x48e: 0x311e, 0x48f: 0x342a, 0x490: 0x3114, 0x491: 0x3420,
+	0x492: 0x3119, 0x493: 0x3425, 0x494: 0x3a30, 0x495: 0x3bbf, 0x496: 0x3a37, 0x497: 0x3bc6,
+	0x498: 0x315a, 0x499: 0x3466, 0x49a: 0x315f, 0x49b: 0x346b, 0x49c: 0x3a45, 0x49d: 0x3bd4,
+	0x49e: 0x3164, 0x49f: 0x3470, 0x4a0: 0x3173, 0x4a1: 0x347f, 0x4a2: 0x3191, 0x4a3: 0x349d,
+	0x4a4: 0x31a0, 0x4a5: 0x34ac, 0x4a6: 0x3196, 0x4a7: 0x34a2, 0x4a8: 0x31a5, 0x4a9: 0x34b1,
+	0x4aa: 0x31aa, 0x4ab: 0x34b6, 0x4ac: 0x31f0, 0x4ad: 0x34fc, 0x4ae: 0x3a4c, 0x4af: 0x3bdb,
+	0x4b0: 0x31fa, 0x4b1: 0x350b, 0x4b2: 0x3204, 0x4b3: 0x3515, 0x4b4: 0x320e, 0x4b5: 0x351f,
+	0x4b6: 0x4805, 0x4b7: 0x4896, 0x4b8: 0x3a53, 0x4b9: 0x3be2, 0x4ba: 0x3227, 0x4bb: 0x3538,
+	0x4bc: 0x3222, 0x4bd: 0x3533, 0x4be: 0x322c, 0x4bf: 0x353d,
+	// Block 0x13, offset 0x4c0
+	0x4c0: 0x3231, 0x4c1: 0x3542, 0x4c2: 0x3236, 0x4c3: 0x3547, 0x4c4: 0x324a, 0x4c5: 0x355b,
+	0x4c6: 0x3254, 0x4c7: 0x3565, 0x4c8: 0x3263, 0x4c9: 0x3574, 0x4ca: 0x325e, 0x4cb: 0x356f,
+	0x4cc: 0x3a76, 0x4cd: 0x3c05, 0x4ce: 0x3a84, 0x4cf: 0x3c13, 0x4d0: 0x3a8b, 0x4d1: 0x3c1a,
+	0x4d2: 0x3a92, 0x4d3: 0x3c21, 0x4d4: 0x3290, 0x4d5: 0x35a1, 0x4d6: 0x3295, 0x4d7: 0x35a6,
+	0x4d8: 0x329f, 0x4d9: 0x35b0, 0x4da: 0x4832, 0x4db: 0x48c3, 0x4dc: 0x3ad8, 0x4dd: 0x3c67,
+	0x4de: 0x32b8, 0x4df: 0x35c9, 0x4e0: 0x32c2, 0x4e1: 0x35d3, 0x4e2: 0x4841, 0x4e3: 0x48d2,
+	0x4e4: 0x3adf, 0x4e5: 0x3c6e, 0x4e6: 0x3ae6, 0x4e7: 0x3c75, 0x4e8: 0x3aed, 0x4e9: 0x3c7c,
+	0x4ea: 0x32d1, 0x4eb: 0x35e2, 0x4ec: 0x32db, 0x4ed: 0x35f1, 0x4ee: 0x32ef, 0x4ef: 0x3605,
+	0x4f0: 0x32ea, 0x4f1: 0x3600, 0x4f2: 0x332b, 0x4f3: 0x3641, 0x4f4: 0x333a, 0x4f5: 0x3650,
+	0x4f6: 0x3335, 0x4f7: 0x364b, 0x4f8: 0x3af4, 0x4f9: 0x3c83, 0x4fa: 0x3afb, 0x4fb: 0x3c8a,
+	0x4fc: 0x333f, 0x4fd: 0x3655, 0x4fe: 0x3344, 0x4ff: 0x365a,
+	// Block 0x14, offset 0x500
+	0x500: 0x3349, 0x501: 0x365f, 0x502: 0x334e, 0x503: 0x3664, 0x504: 0x335d, 0x505: 0x3673,
+	0x506: 0x3358, 0x507: 0x366e, 0x508: 0x3362, 0x509: 0x367d, 0x50a: 0x3367, 0x50b: 0x3682,
+	0x50c: 0x336c, 0x50d: 0x3687, 0x50e: 0x338a, 0x50f: 0x36a5, 0x510: 0x33a3, 0x511: 0x36c3,
+	0x512: 0x33b2, 0x513: 0x36d2, 0x514: 0x33b7, 0x515: 0x36d7, 0x516: 0x34bb, 0x517: 0x35e7,
+	0x518: 0x3678, 0x519: 0x36b4, 0x51b: 0x3712,
+	0x520: 0x47e2, 0x521: 0x4873, 0x522: 0x30c4, 0x523: 0x33d0,
+	0x524: 0x39b9, 0x525: 0x3b48, 0x526: 0x39b2, 0x527: 0x3b41, 0x528: 0x39c7, 0x529: 0x3b56,
+	0x52a: 0x39c0, 0x52b: 0x3b4f, 0x52c: 0x39ff, 0x52d: 0x3b8e, 0x52e: 0x39d5, 0x52f: 0x3b64,
+	0x530: 0x39ce, 0x531: 0x3b5d, 0x532: 0x39e3, 0x533: 0x3b72, 0x534: 0x39dc, 0x535: 0x3b6b,
+	0x536: 0x3a06, 0x537: 0x3b95, 0x538: 0x47f6, 0x539: 0x4887, 0x53a: 0x3141, 0x53b: 0x344d,
+	0x53c: 0x312d, 0x53d: 0x3439, 0x53e: 0x3a1b, 0x53f: 0x3baa,
+	// Block 0x15, offset 0x540
+	0x540: 0x3a14, 0x541: 0x3ba3, 0x542: 0x3a29, 0x543: 0x3bb8, 0x544: 0x3a22, 0x545: 0x3bb1,
+	0x546: 0x3a3e, 0x547: 0x3bcd, 0x548: 0x31d2, 0x549: 0x34de, 0x54a: 0x31e6, 0x54b: 0x34f2,
+	0x54c: 0x4828, 0x54d: 0x48b9, 0x54e: 0x3277, 0x54f: 0x3588, 0x550: 0x3a61, 0x551: 0x3bf0,
+	0x552: 0x3a5a, 0x553: 0x3be9, 0x554: 0x3a6f, 0x555: 0x3bfe, 0x556: 0x3a68, 0x557: 0x3bf7,
+	0x558: 0x3aca, 0x559: 0x3c59, 0x55a: 0x3aae, 0x55b: 0x3c3d, 0x55c: 0x3aa7, 0x55d: 0x3c36,
+	0x55e: 0x3abc, 0x55f: 0x3c4b, 0x560: 0x3ab5, 0x561: 0x3c44, 0x562: 0x3ac3, 0x563: 0x3c52,
+	0x564: 0x3326, 0x565: 0x363c, 0x566: 0x3308, 0x567: 0x361e, 0x568: 0x3b25, 0x569: 0x3cb4,
+	0x56a: 0x3b1e, 0x56b: 0x3cad, 0x56c: 0x3b33, 0x56d: 0x3cc2, 0x56e: 0x3b2c, 0x56f: 0x3cbb,
+	0x570: 0x3b3a, 0x571: 0x3cc9, 0x572: 0x3371, 0x573: 0x368c, 0x574: 0x3399, 0x575: 0x36b9,
+	0x576: 0x3394, 0x577: 0x36af, 0x578: 0x3380, 0x579: 0x369b,
+	// Block 0x16, offset 0x580
+	0x580: 0x4945, 0x581: 0x494b, 0x582: 0x4a5f, 0x583: 0x4a77, 0x584: 0x4a67, 0x585: 0x4a7f,
+	0x586: 0x4a6f, 0x587: 0x4a87, 0x588: 0x48eb, 0x589: 0x48f1, 0x58a: 0x49cf, 0x58b: 0x49e7,
+	0x58c: 0x49d7, 0x58d: 0x49ef, 0x58e: 0x49df, 0x58f: 0x49f7, 0x590: 0x4957, 0x591: 0x495d,
+	0x592: 0x3ef9, 0x593: 0x3f09, 0x594: 0x3f01, 0x595: 0x3f11,
+	0x598: 0x48f7, 0x599: 0x48fd, 0x59a: 0x3e29, 0x59b: 0x3e39, 0x59c: 0x3e31, 0x59d: 0x3e41,
+	0x5a0: 0x496f, 0x5a1: 0x4975, 0x5a2: 0x4a8f, 0x5a3: 0x4aa7,
+	0x5a4: 0x4a97, 0x5a5: 0x4aaf, 0x5a6: 0x4a9f, 0x5a7: 0x4ab7, 0x5a8: 0x4903, 0x5a9: 0x4909,
+	0x5aa: 0x49ff, 0x5ab: 0x4a17, 0x5ac: 0x4a07, 0x5ad: 0x4a1f, 0x5ae: 0x4a0f, 0x5af: 0x4a27,
+	0x5b0: 0x4987, 0x5b1: 0x498d, 0x5b2: 0x3f59, 0x5b3: 0x3f71, 0x5b4: 0x3f61, 0x5b5: 0x3f79,
+	0x5b6: 0x3f69, 0x5b7: 0x3f81, 0x5b8: 0x490f, 0x5b9: 0x4915, 0x5ba: 0x3e59, 0x5bb: 0x3e71,
+	0x5bc: 0x3e61, 0x5bd: 0x3e79, 0x5be: 0x3e69, 0x5bf: 0x3e81,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x4993, 0x5c1: 0x4999, 0x5c2: 0x3f89, 0x5c3: 0x3f99, 0x5c4: 0x3f91, 0x5c5: 0x3fa1,
+	0x5c8: 0x491b, 0x5c9: 0x4921, 0x5ca: 0x3e89, 0x5cb: 0x3e99,
+	0x5cc: 0x3e91, 0x5cd: 0x3ea1, 0x5d0: 0x49a5, 0x5d1: 0x49ab,
+	0x5d2: 0x3fc1, 0x5d3: 0x3fd9, 0x5d4: 0x3fc9, 0x5d5: 0x3fe1, 0x5d6: 0x3fd1, 0x5d7: 0x3fe9,
+	0x5d9: 0x4927, 0x5db: 0x3ea9, 0x5dd: 0x3eb1,
+	0x5df: 0x3eb9, 0x5e0: 0x49bd, 0x5e1: 0x49c3, 0x5e2: 0x4abf, 0x5e3: 0x4ad7,
+	0x5e4: 0x4ac7, 0x5e5: 0x4adf, 0x5e6: 0x4acf, 0x5e7: 0x4ae7, 0x5e8: 0x492d, 0x5e9: 0x4933,
+	0x5ea: 0x4a2f, 0x5eb: 0x4a47, 0x5ec: 0x4a37, 0x5ed: 0x4a4f, 0x5ee: 0x4a3f, 0x5ef: 0x4a57,
+	0x5f0: 0x4939, 0x5f1: 0x445f, 0x5f2: 0x37d2, 0x5f3: 0x4465, 0x5f4: 0x4963, 0x5f5: 0x446b,
+	0x5f6: 0x37e4, 0x5f7: 0x4471, 0x5f8: 0x3802, 0x5f9: 0x4477, 0x5fa: 0x381a, 0x5fb: 0x447d,
+	0x5fc: 0x49b1, 0x5fd: 0x4483,
+	// Block 0x18, offset 0x600
+	0x600: 0x3ee1, 0x601: 0x3ee9, 0x602: 0x42c5, 0x603: 0x42e3, 0x604: 0x42cf, 0x605: 0x42ed,
+	0x606: 0x42d9, 0x607: 0x42f7, 0x608: 0x3e19, 0x609: 0x3e21, 0x60a: 0x4211, 0x60b: 0x422f,
+	0x60c: 0x421b, 0x60d: 0x4239, 0x60e: 0x4225, 0x60f: 0x4243, 0x610: 0x3f29, 0x611: 0x3f31,
+	0x612: 0x4301, 0x613: 0x431f, 0x614: 0x430b, 0x615: 0x4329, 0x616: 0x4315, 0x617: 0x4333,
+	0x618: 0x3e49, 0x619: 0x3e51, 0x61a: 0x424d, 0x61b: 0x426b, 0x61c: 0x4257, 0x61d: 0x4275,
+	0x61e: 0x4261, 0x61f: 0x427f, 0x620: 0x4001, 0x621: 0x4009, 0x622: 0x433d, 0x623: 0x435b,
+	0x624: 0x4347, 0x625: 0x4365, 0x626: 0x4351, 0x627: 0x436f, 0x628: 0x3ec1, 0x629: 0x3ec9,
+	0x62a: 0x4289, 0x62b: 0x42a7, 0x62c: 0x4293, 0x62d: 0x42b1, 0x62e: 0x429d, 0x62f: 0x42bb,
+	0x630: 0x37c6, 0x631: 0x37c0, 0x632: 0x3ed1, 0x633: 0x37cc, 0x634: 0x3ed9,
+	0x636: 0x4951, 0x637: 0x3ef1, 0x638: 0x3736, 0x639: 0x3730, 0x63a: 0x3724, 0x63b: 0x442f,
+	0x63c: 0x373c, 0x63d: 0x8100, 0x63e: 0x0257, 0x63f: 0xa100,
+	// Block 0x19, offset 0x640
+	0x640: 0x8100, 0x641: 0x36e8, 0x642: 0x3f19, 0x643: 0x37de, 0x644: 0x3f21,
+	0x646: 0x497b, 0x647: 0x3f39, 0x648: 0x3742, 0x649: 0x4435, 0x64a: 0x374e, 0x64b: 0x443b,
+	0x64c: 0x375a, 0x64d: 0x3cd0, 0x64e: 0x3cd7, 0x64f: 0x3cde, 0x650: 0x37f6, 0x651: 0x37f0,
+	0x652: 0x3f41, 0x653: 0x4625, 0x656: 0x37fc, 0x657: 0x3f51,
+	0x658: 0x3772, 0x659: 0x376c, 0x65a: 0x3760, 0x65b: 0x4441, 0x65d: 0x3ce5,
+	0x65e: 0x3cec, 0x65f: 0x3cf3, 0x660: 0x382c, 0x661: 0x3826, 0x662: 0x3fa9, 0x663: 0x462d,
+	0x664: 0x380e, 0x665: 0x3814, 0x666: 0x3832, 0x667: 0x3fb9, 0x668: 0x37a2, 0x669: 0x379c,
+	0x66a: 0x3790, 0x66b: 0x444d, 0x66c: 0x378a, 0x66d: 0x36dc, 0x66e: 0x4429, 0x66f: 0x0081,
+	0x672: 0x3ff1, 0x673: 0x3838, 0x674: 0x3ff9,
+	0x676: 0x49c9, 0x677: 0x4011, 0x678: 0x377e, 0x679: 0x4447, 0x67a: 0x37ae, 0x67b: 0x4459,
+	0x67c: 0x37ba, 0x67d: 0x4397, 0x67e: 0xa100,
+	// Block 0x1a, offset 0x680
+	0x681: 0x3d47, 0x683: 0xa000, 0x684: 0x3d4e, 0x685: 0xa000,
+	0x687: 0x3d55, 0x688: 0xa000, 0x689: 0x3d5c,
+	0x68d: 0xa000,
+	0x6a0: 0x30a6, 0x6a1: 0xa000, 0x6a2: 0x3d6a,
+	0x6a4: 0xa000, 0x6a5: 0xa000,
+	0x6ad: 0x3d63, 0x6ae: 0x30a1, 0x6af: 0x30ab,
+	0x6b0: 0x3d71, 0x6b1: 0x3d78, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3d7f, 0x6b5: 0x3d86,
+	0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3d8d, 0x6b9: 0x3d94, 0x6ba: 0xa000, 0x6bb: 0xa000,
+	0x6bc: 0xa000, 0x6bd: 0xa000,
+	// Block 0x1b, offset 0x6c0
+	0x6c0: 0x3d9b, 0x6c1: 0x3da2, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3db7, 0x6c5: 0x3dbe,
+	0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3dc5, 0x6c9: 0x3dcc,
+	0x6d1: 0xa000,
+	0x6d2: 0xa000,
+	0x6e2: 0xa000,
+	0x6e8: 0xa000, 0x6e9: 0xa000,
+	0x6eb: 0xa000, 0x6ec: 0x3de1, 0x6ed: 0x3de8, 0x6ee: 0x3def, 0x6ef: 0x3df6,
+	0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000,
+	// Block 0x1c, offset 0x700
+	0x706: 0xa000, 0x70b: 0xa000,
+	0x70c: 0x4049, 0x70d: 0xa000, 0x70e: 0x4051, 0x70f: 0xa000, 0x710: 0x4059, 0x711: 0xa000,
+	0x712: 0x4061, 0x713: 0xa000, 0x714: 0x4069, 0x715: 0xa000, 0x716: 0x4071, 0x717: 0xa000,
+	0x718: 0x4079, 0x719: 0xa000, 0x71a: 0x4081, 0x71b: 0xa000, 0x71c: 0x4089, 0x71d: 0xa000,
+	0x71e: 0x4091, 0x71f: 0xa000, 0x720: 0x4099, 0x721: 0xa000, 0x722: 0x40a1,
+	0x724: 0xa000, 0x725: 0x40a9, 0x726: 0xa000, 0x727: 0x40b1, 0x728: 0xa000, 0x729: 0x40b9,
+	0x72f: 0xa000,
+	0x730: 0x40c1, 0x731: 0x40c9, 0x732: 0xa000, 0x733: 0x40d1, 0x734: 0x40d9, 0x735: 0xa000,
+	0x736: 0x40e1, 0x737: 0x40e9, 0x738: 0xa000, 0x739: 0x40f1, 0x73a: 0x40f9, 0x73b: 0xa000,
+	0x73c: 0x4101, 0x73d: 0x4109,
+	// Block 0x1d, offset 0x740
+	0x754: 0x4041,
+	0x759: 0x9904, 0x75a: 0x9904, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000,
+	0x75e: 0x4111,
+	0x766: 0xa000,
+	0x76b: 0xa000, 0x76c: 0x4121, 0x76d: 0xa000, 0x76e: 0x4129, 0x76f: 0xa000,
+	0x770: 0x4131, 0x771: 0xa000, 0x772: 0x4139, 0x773: 0xa000, 0x774: 0x4141, 0x775: 0xa000,
+	0x776: 0x4149, 0x777: 0xa000, 0x778: 0x4151, 0x779: 0xa000, 0x77a: 0x4159, 0x77b: 0xa000,
+	0x77c: 0x4161, 0x77d: 0xa000, 0x77e: 0x4169, 0x77f: 0xa000,
+	// Block 0x1e, offset 0x780
+	0x780: 0x4171, 0x781: 0xa000, 0x782: 0x4179, 0x784: 0xa000, 0x785: 0x4181,
+	0x786: 0xa000, 0x787: 0x4189, 0x788: 0xa000, 0x789: 0x4191,
+	0x78f: 0xa000, 0x790: 0x4199, 0x791: 0x41a1,
+	0x792: 0xa000, 0x793: 0x41a9, 0x794: 0x41b1, 0x795: 0xa000, 0x796: 0x41b9, 0x797: 0x41c1,
+	0x798: 0xa000, 0x799: 0x41c9, 0x79a: 0x41d1, 0x79b: 0xa000, 0x79c: 0x41d9, 0x79d: 0x41e1,
+	0x7af: 0xa000,
+	0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x4119,
+	0x7b7: 0x41e9, 0x7b8: 0x41f1, 0x7b9: 0x41f9, 0x7ba: 0x4201,
+	0x7bd: 0xa000, 0x7be: 0x4209,
+	// Block 0x1f, offset 0x7c0
+	0x7c0: 0x1472, 0x7c1: 0x0df6, 0x7c2: 0x14ce, 0x7c3: 0x149a, 0x7c4: 0x0f52, 0x7c5: 0x07e6,
+	0x7c6: 0x09da, 0x7c7: 0x1726, 0x7c8: 0x1726, 0x7c9: 0x0b06, 0x7ca: 0x155a, 0x7cb: 0x0a3e,
+	0x7cc: 0x0b02, 0x7cd: 0x0cea, 0x7ce: 0x10ca, 0x7cf: 0x125a, 0x7d0: 0x1392, 0x7d1: 0x13ce,
+	0x7d2: 0x1402, 0x7d3: 0x1516, 0x7d4: 0x0e6e, 0x7d5: 0x0efa, 0x7d6: 0x0fa6, 0x7d7: 0x103e,
+	0x7d8: 0x135a, 0x7d9: 0x1542, 0x7da: 0x166e, 0x7db: 0x080a, 0x7dc: 0x09ae, 0x7dd: 0x0e82,
+	0x7de: 0x0fca, 0x7df: 0x138e, 0x7e0: 0x16be, 0x7e1: 0x0bae, 0x7e2: 0x0f72, 0x7e3: 0x137e,
+	0x7e4: 0x1412, 0x7e5: 0x0d1e, 0x7e6: 0x12b6, 0x7e7: 0x13da, 0x7e8: 0x0c1a, 0x7e9: 0x0e0a,
+	0x7ea: 0x0f12, 0x7eb: 0x1016, 0x7ec: 0x1522, 0x7ed: 0x084a, 0x7ee: 0x08e2, 0x7ef: 0x094e,
+	0x7f0: 0x0d86, 0x7f1: 0x0e7a, 0x7f2: 0x0fc6, 0x7f3: 0x10ea, 0x7f4: 0x1272, 0x7f5: 0x1386,
+	0x7f6: 0x139e, 0x7f7: 0x14c2, 0x7f8: 0x15ea, 0x7f9: 0x169e, 0x7fa: 0x16ba, 0x7fb: 0x1126,
+	0x7fc: 0x1166, 0x7fd: 0x121e, 0x7fe: 0x133e, 0x7ff: 0x1576,
+	// Block 0x20, offset 0x800
+	0x800: 0x16c6, 0x801: 0x1446, 0x802: 0x0ac2, 0x803: 0x0c36, 0x804: 0x11d6, 0x805: 0x1296,
+	0x806: 0x0ffa, 0x807: 0x112e, 0x808: 0x1492, 0x809: 0x15e2, 0x80a: 0x0abe, 0x80b: 0x0b8a,
+	0x80c: 0x0e72, 0x80d: 0x0f26, 0x80e: 0x0f5a, 0x80f: 0x120e, 0x810: 0x1236, 0x811: 0x15a2,
+	0x812: 0x094a, 0x813: 0x12a2, 0x814: 0x08ee, 0x815: 0x08ea, 0x816: 0x1192, 0x817: 0x1222,
+	0x818: 0x1356, 0x819: 0x15aa, 0x81a: 0x1462, 0x81b: 0x0d22, 0x81c: 0x0e6e, 0x81d: 0x1452,
+	0x81e: 0x07f2, 0x81f: 0x0b5e, 0x820: 0x0c8e, 0x821: 0x102a, 0x822: 0x10aa, 0x823: 0x096e,
+	0x824: 0x1136, 0x825: 0x085a, 0x826: 0x0c72, 0x827: 0x07d2, 0x828: 0x0ee6, 0x829: 0x0d9e,
+	0x82a: 0x120a, 0x82b: 0x09c2, 0x82c: 0x0aae, 0x82d: 0x10f6, 0x82e: 0x135e, 0x82f: 0x1436,
+	0x830: 0x0eb2, 0x831: 0x14f2, 0x832: 0x0ede, 0x833: 0x0d32, 0x834: 0x1316, 0x835: 0x0d52,
+	0x836: 0x10a6, 0x837: 0x0826, 0x838: 0x08a2, 0x839: 0x08e6, 0x83a: 0x0e4e, 0x83b: 0x11f6,
+	0x83c: 0x12ee, 0x83d: 0x1442, 0x83e: 0x1556, 0x83f: 0x0956,
+	// Block 0x21, offset 0x840
+	0x840: 0x0a0a, 0x841: 0x0b12, 0x842: 0x0c2a, 0x843: 0x0dba, 0x844: 0x0f76, 0x845: 0x113a,
+	0x846: 0x1592, 0x847: 0x1676, 0x848: 0x16ca, 0x849: 0x16e2, 0x84a: 0x0932, 0x84b: 0x0dee,
+	0x84c: 0x0e9e, 0x84d: 0x14e6, 0x84e: 0x0bf6, 0x84f: 0x0cd2, 0x850: 0x0cee, 0x851: 0x0d7e,
+	0x852: 0x0f66, 0x853: 0x0fb2, 0x854: 0x1062, 0x855: 0x1186, 0x856: 0x122a, 0x857: 0x128e,
+	0x858: 0x14d6, 0x859: 0x1366, 0x85a: 0x14fe, 0x85b: 0x157a, 0x85c: 0x090a, 0x85d: 0x0936,
+	0x85e: 0x0a1e, 0x85f: 0x0fa2, 0x860: 0x13ee, 0x861: 0x1436, 0x862: 0x0c16, 0x863: 0x0c86,
+	0x864: 0x0d4a, 0x865: 0x0eaa, 0x866: 0x11d2, 0x867: 0x101e, 0x868: 0x0836, 0x869: 0x0a7a,
+	0x86a: 0x0b5e, 0x86b: 0x0bc2, 0x86c: 0x0c92, 0x86d: 0x103a, 0x86e: 0x1056, 0x86f: 0x1266,
+	0x870: 0x1286, 0x871: 0x155e, 0x872: 0x15de, 0x873: 0x15ee, 0x874: 0x162a, 0x875: 0x084e,
+	0x876: 0x117a, 0x877: 0x154a, 0x878: 0x15c6, 0x879: 0x0caa, 0x87a: 0x0812, 0x87b: 0x0872,
+	0x87c: 0x0b62, 0x87d: 0x0b82, 0x87e: 0x0daa, 0x87f: 0x0e6e,
+	// Block 0x22, offset 0x880
+	0x880: 0x0fbe, 0x881: 0x10c6, 0x882: 0x1372, 0x883: 0x1512, 0x884: 0x171e, 0x885: 0x0dde,
+	0x886: 0x159e, 0x887: 0x092e, 0x888: 0x0e2a, 0x889: 0x0e36, 0x88a: 0x0f0a, 0x88b: 0x0f42,
+	0x88c: 0x1046, 0x88d: 0x10a2, 0x88e: 0x1122, 0x88f: 0x1206, 0x890: 0x1636, 0x891: 0x08aa,
+	0x892: 0x0cfe, 0x893: 0x15ae, 0x894: 0x0862, 0x895: 0x0ba6, 0x896: 0x0f2a, 0x897: 0x14da,
+	0x898: 0x0c62, 0x899: 0x0cb2, 0x89a: 0x0e3e, 0x89b: 0x102a, 0x89c: 0x15b6, 0x89d: 0x0912,
+	0x89e: 0x09fa, 0x89f: 0x0b92, 0x8a0: 0x0dce, 0x8a1: 0x0e1a, 0x8a2: 0x0e5a, 0x8a3: 0x0eee,
+	0x8a4: 0x1042, 0x8a5: 0x10b6, 0x8a6: 0x1252, 0x8a7: 0x13f2, 0x8a8: 0x13fe, 0x8a9: 0x1552,
+	0x8aa: 0x15d2, 0x8ab: 0x097e, 0x8ac: 0x0f46, 0x8ad: 0x09fe, 0x8ae: 0x0fc2, 0x8af: 0x1066,
+	0x8b0: 0x1382, 0x8b1: 0x15ba, 0x8b2: 0x16a6, 0x8b3: 0x16ce, 0x8b4: 0x0e32, 0x8b5: 0x0f22,
+	0x8b6: 0x12be, 0x8b7: 0x11b2, 0x8b8: 0x11be, 0x8b9: 0x11e2, 0x8ba: 0x1012, 0x8bb: 0x0f9a,
+	0x8bc: 0x145e, 0x8bd: 0x082e, 0x8be: 0x1326, 0x8bf: 0x0916,
+	// Block 0x23, offset 0x8c0
+	0x8c0: 0x0906, 0x8c1: 0x0c06, 0x8c2: 0x0d26, 0x8c3: 0x11ee, 0x8c4: 0x0b4e, 0x8c5: 0x0efe,
+	0x8c6: 0x0dea, 0x8c7: 0x14e2, 0x8c8: 0x13e2, 0x8c9: 0x15a6, 0x8ca: 0x141e, 0x8cb: 0x0c22,
+	0x8cc: 0x0882, 0x8cd: 0x0a56, 0x8d0: 0x0aaa,
+	0x8d2: 0x0dda, 0x8d5: 0x08f2, 0x8d6: 0x101a, 0x8d7: 0x10de,
+	0x8d8: 0x1142, 0x8d9: 0x115e, 0x8da: 0x1162, 0x8db: 0x1176, 0x8dc: 0x15f6, 0x8dd: 0x11e6,
+	0x8de: 0x126a, 0x8e0: 0x138a, 0x8e2: 0x144e,
+	0x8e5: 0x1502, 0x8e6: 0x152e,
+	0x8ea: 0x164a, 0x8eb: 0x164e, 0x8ec: 0x1652, 0x8ed: 0x16b6, 0x8ee: 0x1526, 0x8ef: 0x15c2,
+	0x8f0: 0x0852, 0x8f1: 0x0876, 0x8f2: 0x088a, 0x8f3: 0x0946, 0x8f4: 0x0952, 0x8f5: 0x0992,
+	0x8f6: 0x0a46, 0x8f7: 0x0a62, 0x8f8: 0x0a6a, 0x8f9: 0x0aa6, 0x8fa: 0x0ab2, 0x8fb: 0x0b8e,
+	0x8fc: 0x0b96, 0x8fd: 0x0c9e, 0x8fe: 0x0cc6, 0x8ff: 0x0cce,
+	// Block 0x24, offset 0x900
+	0x900: 0x0ce6, 0x901: 0x0d92, 0x902: 0x0dc2, 0x903: 0x0de2, 0x904: 0x0e52, 0x905: 0x0f16,
+	0x906: 0x0f32, 0x907: 0x0f62, 0x908: 0x0fb6, 0x909: 0x0fd6, 0x90a: 0x104a, 0x90b: 0x112a,
+	0x90c: 0x1146, 0x90d: 0x114e, 0x90e: 0x114a, 0x90f: 0x1152, 0x910: 0x1156, 0x911: 0x115a,
+	0x912: 0x116e, 0x913: 0x1172, 0x914: 0x1196, 0x915: 0x11aa, 0x916: 0x11c6, 0x917: 0x122a,
+	0x918: 0x1232, 0x919: 0x123a, 0x91a: 0x124e, 0x91b: 0x1276, 0x91c: 0x12c6, 0x91d: 0x12fa,
+	0x91e: 0x12fa, 0x91f: 0x1362, 0x920: 0x140a, 0x921: 0x1422, 0x922: 0x1456, 0x923: 0x145a,
+	0x924: 0x149e, 0x925: 0x14a2, 0x926: 0x14fa, 0x927: 0x1502, 0x928: 0x15d6, 0x929: 0x161a,
+	0x92a: 0x1632, 0x92b: 0x0c96, 0x92c: 0x184b, 0x92d: 0x12de,
+	0x930: 0x07da, 0x931: 0x08de, 0x932: 0x089e, 0x933: 0x0846, 0x934: 0x0886, 0x935: 0x08b2,
+	0x936: 0x0942, 0x937: 0x095e, 0x938: 0x0a46, 0x939: 0x0a32, 0x93a: 0x0a42, 0x93b: 0x0a5e,
+	0x93c: 0x0aaa, 0x93d: 0x0aba, 0x93e: 0x0afe, 0x93f: 0x0b0a,
+	// Block 0x25, offset 0x940
+	0x940: 0x0b26, 0x941: 0x0b36, 0x942: 0x0c1e, 0x943: 0x0c26, 0x944: 0x0c56, 0x945: 0x0c76,
+	0x946: 0x0ca6, 0x947: 0x0cbe, 0x948: 0x0cae, 0x949: 0x0cce, 0x94a: 0x0cc2, 0x94b: 0x0ce6,
+	0x94c: 0x0d02, 0x94d: 0x0d5a, 0x94e: 0x0d66, 0x94f: 0x0d6e, 0x950: 0x0d96, 0x951: 0x0dda,
+	0x952: 0x0e0a, 0x953: 0x0e0e, 0x954: 0x0e22, 0x955: 0x0ea2, 0x956: 0x0eb2, 0x957: 0x0f0a,
+	0x958: 0x0f56, 0x959: 0x0f4e, 0x95a: 0x0f62, 0x95b: 0x0f7e, 0x95c: 0x0fb6, 0x95d: 0x110e,
+	0x95e: 0x0fda, 0x95f: 0x100e, 0x960: 0x101a, 0x961: 0x105a, 0x962: 0x1076, 0x963: 0x109a,
+	0x964: 0x10be, 0x965: 0x10c2, 0x966: 0x10de, 0x967: 0x10e2, 0x968: 0x10f2, 0x969: 0x1106,
+	0x96a: 0x1102, 0x96b: 0x1132, 0x96c: 0x11ae, 0x96d: 0x11c6, 0x96e: 0x11de, 0x96f: 0x1216,
+	0x970: 0x122a, 0x971: 0x1246, 0x972: 0x1276, 0x973: 0x132a, 0x974: 0x1352, 0x975: 0x13c6,
+	0x976: 0x140e, 0x977: 0x141a, 0x978: 0x1422, 0x979: 0x143a, 0x97a: 0x144e, 0x97b: 0x143e,
+	0x97c: 0x1456, 0x97d: 0x1452, 0x97e: 0x144a, 0x97f: 0x145a,
+	// Block 0x26, offset 0x980
+	0x980: 0x1466, 0x981: 0x14a2, 0x982: 0x14de, 0x983: 0x150e, 0x984: 0x1546, 0x985: 0x1566,
+	0x986: 0x15b2, 0x987: 0x15d6, 0x988: 0x15f6, 0x989: 0x160a, 0x98a: 0x161a, 0x98b: 0x1626,
+	0x98c: 0x1632, 0x98d: 0x1686, 0x98e: 0x1726, 0x98f: 0x17e2, 0x990: 0x17dd, 0x991: 0x180f,
+	0x992: 0x0702, 0x993: 0x072a, 0x994: 0x072e, 0x995: 0x1891, 0x996: 0x18be, 0x997: 0x1936,
+	0x998: 0x1712, 0x999: 0x1722,
+	// Block 0x27, offset 0x9c0
+	0x9c0: 0x07f6, 0x9c1: 0x07ee, 0x9c2: 0x07fe, 0x9c3: 0x1774, 0x9c4: 0x0842, 0x9c5: 0x0852,
+	0x9c6: 0x0856, 0x9c7: 0x085e, 0x9c8: 0x0866, 0x9c9: 0x086a, 0x9ca: 0x0876, 0x9cb: 0x086e,
+	0x9cc: 0x06ae, 0x9cd: 0x1788, 0x9ce: 0x088a, 0x9cf: 0x088e, 0x9d0: 0x0892, 0x9d1: 0x08ae,
+	0x9d2: 0x1779, 0x9d3: 0x06b2, 0x9d4: 0x089a, 0x9d5: 0x08ba, 0x9d6: 0x1783, 0x9d7: 0x08ca,
+	0x9d8: 0x08d2, 0x9d9: 0x0832, 0x9da: 0x08da, 0x9db: 0x08de, 0x9dc: 0x195e, 0x9dd: 0x08fa,
+	0x9de: 0x0902, 0x9df: 0x06ba, 0x9e0: 0x091a, 0x9e1: 0x091e, 0x9e2: 0x0926, 0x9e3: 0x092a,
+	0x9e4: 0x06be, 0x9e5: 0x0942, 0x9e6: 0x0946, 0x9e7: 0x0952, 0x9e8: 0x095e, 0x9e9: 0x0962,
+	0x9ea: 0x0966, 0x9eb: 0x096e, 0x9ec: 0x098e, 0x9ed: 0x0992, 0x9ee: 0x099a, 0x9ef: 0x09aa,
+	0x9f0: 0x09b2, 0x9f1: 0x09b6, 0x9f2: 0x09b6, 0x9f3: 0x09b6, 0x9f4: 0x1797, 0x9f5: 0x0f8e,
+	0x9f6: 0x09ca, 0x9f7: 0x09d2, 0x9f8: 0x179c, 0x9f9: 0x09de, 0x9fa: 0x09e6, 0x9fb: 0x09ee,
+	0x9fc: 0x0a16, 0x9fd: 0x0a02, 0x9fe: 0x0a0e, 0x9ff: 0x0a12,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x0a1a, 0xa01: 0x0a22, 0xa02: 0x0a26, 0xa03: 0x0a2e, 0xa04: 0x0a36, 0xa05: 0x0a3a,
+	0xa06: 0x0a3a, 0xa07: 0x0a42, 0xa08: 0x0a4a, 0xa09: 0x0a4e, 0xa0a: 0x0a5a, 0xa0b: 0x0a7e,
+	0xa0c: 0x0a62, 0xa0d: 0x0a82, 0xa0e: 0x0a66, 0xa0f: 0x0a6e, 0xa10: 0x0906, 0xa11: 0x0aca,
+	0xa12: 0x0a92, 0xa13: 0x0a96, 0xa14: 0x0a9a, 0xa15: 0x0a8e, 0xa16: 0x0aa2, 0xa17: 0x0a9e,
+	0xa18: 0x0ab6, 0xa19: 0x17a1, 0xa1a: 0x0ad2, 0xa1b: 0x0ad6, 0xa1c: 0x0ade, 0xa1d: 0x0aea,
+	0xa1e: 0x0af2, 0xa1f: 0x0b0e, 0xa20: 0x17a6, 0xa21: 0x17ab, 0xa22: 0x0b1a, 0xa23: 0x0b1e,
+	0xa24: 0x0b22, 0xa25: 0x0b16, 0xa26: 0x0b2a, 0xa27: 0x06c2, 0xa28: 0x06c6, 0xa29: 0x0b32,
+	0xa2a: 0x0b3a, 0xa2b: 0x0b3a, 0xa2c: 0x17b0, 0xa2d: 0x0b56, 0xa2e: 0x0b5a, 0xa2f: 0x0b5e,
+	0xa30: 0x0b66, 0xa31: 0x17b5, 0xa32: 0x0b6e, 0xa33: 0x0b72, 0xa34: 0x0c4a, 0xa35: 0x0b7a,
+	0xa36: 0x06ca, 0xa37: 0x0b86, 0xa38: 0x0b96, 0xa39: 0x0ba2, 0xa3a: 0x0b9e, 0xa3b: 0x17bf,
+	0xa3c: 0x0baa, 0xa3d: 0x17c4, 0xa3e: 0x0bb6, 0xa3f: 0x0bb2,
+	// Block 0x29, offset 0xa40
+	0xa40: 0x0bba, 0xa41: 0x0bca, 0xa42: 0x0bce, 0xa43: 0x06ce, 0xa44: 0x0bde, 0xa45: 0x0be6,
+	0xa46: 0x0bea, 0xa47: 0x0bee, 0xa48: 0x06d2, 0xa49: 0x17c9, 0xa4a: 0x06d6, 0xa4b: 0x0c0a,
+	0xa4c: 0x0c0e, 0xa4d: 0x0c12, 0xa4e: 0x0c1a, 0xa4f: 0x1990, 0xa50: 0x0c32, 0xa51: 0x17d3,
+	0xa52: 0x17d3, 0xa53: 0x12d2, 0xa54: 0x0c42, 0xa55: 0x0c42, 0xa56: 0x06da, 0xa57: 0x17f6,
+	0xa58: 0x18c8, 0xa59: 0x0c52, 0xa5a: 0x0c5a, 0xa5b: 0x06de, 0xa5c: 0x0c6e, 0xa5d: 0x0c7e,
+	0xa5e: 0x0c82, 0xa5f: 0x0c8a, 0xa60: 0x0c9a, 0xa61: 0x06e6, 0xa62: 0x06e2, 0xa63: 0x0c9e,
+	0xa64: 0x17d8, 0xa65: 0x0ca2, 0xa66: 0x0cb6, 0xa67: 0x0cba, 0xa68: 0x0cbe, 0xa69: 0x0cba,
+	0xa6a: 0x0cca, 0xa6b: 0x0cce, 0xa6c: 0x0cde, 0xa6d: 0x0cd6, 0xa6e: 0x0cda, 0xa6f: 0x0ce2,
+	0xa70: 0x0ce6, 0xa71: 0x0cea, 0xa72: 0x0cf6, 0xa73: 0x0cfa, 0xa74: 0x0d12, 0xa75: 0x0d1a,
+	0xa76: 0x0d2a, 0xa77: 0x0d3e, 0xa78: 0x17e7, 0xa79: 0x0d3a, 0xa7a: 0x0d2e, 0xa7b: 0x0d46,
+	0xa7c: 0x0d4e, 0xa7d: 0x0d62, 0xa7e: 0x17ec, 0xa7f: 0x0d6a,
+	// Block 0x2a, offset 0xa80
+	0xa80: 0x0d5e, 0xa81: 0x0d56, 0xa82: 0x06ea, 0xa83: 0x0d72, 0xa84: 0x0d7a, 0xa85: 0x0d82,
+	0xa86: 0x0d76, 0xa87: 0x06ee, 0xa88: 0x0d92, 0xa89: 0x0d9a, 0xa8a: 0x17f1, 0xa8b: 0x0dc6,
+	0xa8c: 0x0dfa, 0xa8d: 0x0dd6, 0xa8e: 0x06fa, 0xa8f: 0x0de2, 0xa90: 0x06f6, 0xa91: 0x06f2,
+	0xa92: 0x08be, 0xa93: 0x08c2, 0xa94: 0x0dfe, 0xa95: 0x0de6, 0xa96: 0x12a6, 0xa97: 0x075e,
+	0xa98: 0x0e0a, 0xa99: 0x0e0e, 0xa9a: 0x0e12, 0xa9b: 0x0e26, 0xa9c: 0x0e1e, 0xa9d: 0x180a,
+	0xa9e: 0x06fe, 0xa9f: 0x0e3a, 0xaa0: 0x0e2e, 0xaa1: 0x0e4a, 0xaa2: 0x0e52, 0xaa3: 0x1814,
+	0xaa4: 0x0e56, 0xaa5: 0x0e42, 0xaa6: 0x0e5e, 0xaa7: 0x0702, 0xaa8: 0x0e62, 0xaa9: 0x0e66,
+	0xaaa: 0x0e6a, 0xaab: 0x0e76, 0xaac: 0x1819, 0xaad: 0x0e7e, 0xaae: 0x0706, 0xaaf: 0x0e8a,
+	0xab0: 0x181e, 0xab1: 0x0e8e, 0xab2: 0x070a, 0xab3: 0x0e9a, 0xab4: 0x0ea6, 0xab5: 0x0eb2,
+	0xab6: 0x0eb6, 0xab7: 0x1823, 0xab8: 0x17ba, 0xab9: 0x1828, 0xaba: 0x0ed6, 0xabb: 0x182d,
+	0xabc: 0x0ee2, 0xabd: 0x0eea, 0xabe: 0x0eda, 0xabf: 0x0ef6,
+	// Block 0x2b, offset 0xac0
+	0xac0: 0x0f06, 0xac1: 0x0f16, 0xac2: 0x0f0a, 0xac3: 0x0f0e, 0xac4: 0x0f1a, 0xac5: 0x0f1e,
+	0xac6: 0x1832, 0xac7: 0x0f02, 0xac8: 0x0f36, 0xac9: 0x0f3a, 0xaca: 0x070e, 0xacb: 0x0f4e,
+	0xacc: 0x0f4a, 0xacd: 0x1837, 0xace: 0x0f2e, 0xacf: 0x0f6a, 0xad0: 0x183c, 0xad1: 0x1841,
+	0xad2: 0x0f6e, 0xad3: 0x0f82, 0xad4: 0x0f7e, 0xad5: 0x0f7a, 0xad6: 0x0712, 0xad7: 0x0f86,
+	0xad8: 0x0f96, 0xad9: 0x0f92, 0xada: 0x0f9e, 0xadb: 0x177e, 0xadc: 0x0fae, 0xadd: 0x1846,
+	0xade: 0x0fba, 0xadf: 0x1850, 0xae0: 0x0fce, 0xae1: 0x0fda, 0xae2: 0x0fee, 0xae3: 0x1855,
+	0xae4: 0x1002, 0xae5: 0x1006, 0xae6: 0x185a, 0xae7: 0x185f, 0xae8: 0x1022, 0xae9: 0x1032,
+	0xaea: 0x0716, 0xaeb: 0x1036, 0xaec: 0x071a, 0xaed: 0x071a, 0xaee: 0x104e, 0xaef: 0x1052,
+	0xaf0: 0x105a, 0xaf1: 0x105e, 0xaf2: 0x106a, 0xaf3: 0x071e, 0xaf4: 0x1082, 0xaf5: 0x1864,
+	0xaf6: 0x109e, 0xaf7: 0x1869, 0xaf8: 0x10aa, 0xaf9: 0x17ce, 0xafa: 0x10ba, 0xafb: 0x186e,
+	0xafc: 0x1873, 0xafd: 0x1878, 0xafe: 0x0722, 0xaff: 0x0726,
+	// Block 0x2c, offset 0xb00
+	0xb00: 0x10f2, 0xb01: 0x1882, 0xb02: 0x187d, 0xb03: 0x1887, 0xb04: 0x188c, 0xb05: 0x10fa,
+	0xb06: 0x10fe, 0xb07: 0x10fe, 0xb08: 0x1106, 0xb09: 0x072e, 0xb0a: 0x110a, 0xb0b: 0x0732,
+	0xb0c: 0x0736, 0xb0d: 0x1896, 0xb0e: 0x111e, 0xb0f: 0x1126, 0xb10: 0x1132, 0xb11: 0x073a,
+	0xb12: 0x189b, 0xb13: 0x1156, 0xb14: 0x18a0, 0xb15: 0x18a5, 0xb16: 0x1176, 0xb17: 0x118e,
+	0xb18: 0x073e, 0xb19: 0x1196, 0xb1a: 0x119a, 0xb1b: 0x119e, 0xb1c: 0x18aa, 0xb1d: 0x18af,
+	0xb1e: 0x18af, 0xb1f: 0x11b6, 0xb20: 0x0742, 0xb21: 0x18b4, 0xb22: 0x11ca, 0xb23: 0x11ce,
+	0xb24: 0x0746, 0xb25: 0x18b9, 0xb26: 0x11ea, 0xb27: 0x074a, 0xb28: 0x11fa, 0xb29: 0x11f2,
+	0xb2a: 0x1202, 0xb2b: 0x18c3, 0xb2c: 0x121a, 0xb2d: 0x074e, 0xb2e: 0x1226, 0xb2f: 0x122e,
+	0xb30: 0x123e, 0xb31: 0x0752, 0xb32: 0x18cd, 0xb33: 0x18d2, 0xb34: 0x0756, 0xb35: 0x18d7,
+	0xb36: 0x1256, 0xb37: 0x18dc, 0xb38: 0x1262, 0xb39: 0x126e, 0xb3a: 0x1276, 0xb3b: 0x18e1,
+	0xb3c: 0x18e6, 0xb3d: 0x128a, 0xb3e: 0x18eb, 0xb3f: 0x1292,
+	// Block 0x2d, offset 0xb40
+	0xb40: 0x17fb, 0xb41: 0x075a, 0xb42: 0x12aa, 0xb43: 0x12ae, 0xb44: 0x0762, 0xb45: 0x12b2,
+	0xb46: 0x0b2e, 0xb47: 0x18f0, 0xb48: 0x18f5, 0xb49: 0x1800, 0xb4a: 0x1805, 0xb4b: 0x12d2,
+	0xb4c: 0x12d6, 0xb4d: 0x14ee, 0xb4e: 0x0766, 0xb4f: 0x1302, 0xb50: 0x12fe, 0xb51: 0x1306,
+	0xb52: 0x093a, 0xb53: 0x130a, 0xb54: 0x130e, 0xb55: 0x1312, 0xb56: 0x131a, 0xb57: 0x18fa,
+	0xb58: 0x1316, 0xb59: 0x131e, 0xb5a: 0x1332, 0xb5b: 0x1336, 0xb5c: 0x1322, 0xb5d: 0x133a,
+	0xb5e: 0x134e, 0xb5f: 0x1362, 0xb60: 0x132e, 0xb61: 0x1342, 0xb62: 0x1346, 0xb63: 0x134a,
+	0xb64: 0x18ff, 0xb65: 0x1909, 0xb66: 0x1904, 0xb67: 0x076a, 0xb68: 0x136a, 0xb69: 0x136e,
+	0xb6a: 0x1376, 0xb6b: 0x191d, 0xb6c: 0x137a, 0xb6d: 0x190e, 0xb6e: 0x076e, 0xb6f: 0x0772,
+	0xb70: 0x1913, 0xb71: 0x1918, 0xb72: 0x0776, 0xb73: 0x139a, 0xb74: 0x139e, 0xb75: 0x13a2,
+	0xb76: 0x13a6, 0xb77: 0x13b2, 0xb78: 0x13ae, 0xb79: 0x13ba, 0xb7a: 0x13b6, 0xb7b: 0x13c6,
+	0xb7c: 0x13be, 0xb7d: 0x13c2, 0xb7e: 0x13ca, 0xb7f: 0x077a,
+	// Block 0x2e, offset 0xb80
+	0xb80: 0x13d2, 0xb81: 0x13d6, 0xb82: 0x077e, 0xb83: 0x13e6, 0xb84: 0x13ea, 0xb85: 0x1922,
+	0xb86: 0x13f6, 0xb87: 0x13fa, 0xb88: 0x0782, 0xb89: 0x1406, 0xb8a: 0x06b6, 0xb8b: 0x1927,
+	0xb8c: 0x192c, 0xb8d: 0x0786, 0xb8e: 0x078a, 0xb8f: 0x1432, 0xb90: 0x144a, 0xb91: 0x1466,
+	0xb92: 0x1476, 0xb93: 0x1931, 0xb94: 0x148a, 0xb95: 0x148e, 0xb96: 0x14a6, 0xb97: 0x14b2,
+	0xb98: 0x193b, 0xb99: 0x178d, 0xb9a: 0x14be, 0xb9b: 0x14ba, 0xb9c: 0x14c6, 0xb9d: 0x1792,
+	0xb9e: 0x14d2, 0xb9f: 0x14de, 0xba0: 0x1940, 0xba1: 0x1945, 0xba2: 0x151e, 0xba3: 0x152a,
+	0xba4: 0x1532, 0xba5: 0x194a, 0xba6: 0x1536, 0xba7: 0x1562, 0xba8: 0x156e, 0xba9: 0x1572,
+	0xbaa: 0x156a, 0xbab: 0x157e, 0xbac: 0x1582, 0xbad: 0x194f, 0xbae: 0x158e, 0xbaf: 0x078e,
+	0xbb0: 0x1596, 0xbb1: 0x1954, 0xbb2: 0x0792, 0xbb3: 0x15ce, 0xbb4: 0x0bbe, 0xbb5: 0x15e6,
+	0xbb6: 0x1959, 0xbb7: 0x1963, 0xbb8: 0x0796, 0xbb9: 0x079a, 0xbba: 0x160e, 0xbbb: 0x1968,
+	0xbbc: 0x079e, 0xbbd: 0x196d, 0xbbe: 0x1626, 0xbbf: 0x1626,
+	// Block 0x2f, offset 0xbc0
+	0xbc0: 0x162e, 0xbc1: 0x1972, 0xbc2: 0x1646, 0xbc3: 0x07a2, 0xbc4: 0x1656, 0xbc5: 0x1662,
+	0xbc6: 0x166a, 0xbc7: 0x1672, 0xbc8: 0x07a6, 0xbc9: 0x1977, 0xbca: 0x1686, 0xbcb: 0x16a2,
+	0xbcc: 0x16ae, 0xbcd: 0x07aa, 0xbce: 0x07ae, 0xbcf: 0x16b2, 0xbd0: 0x197c, 0xbd1: 0x07b2,
+	0xbd2: 0x1981, 0xbd3: 0x1986, 0xbd4: 0x198b, 0xbd5: 0x16d6, 0xbd6: 0x07b6, 0xbd7: 0x16ea,
+	0xbd8: 0x16f2, 0xbd9: 0x16f6, 0xbda: 0x16fe, 0xbdb: 0x1706, 0xbdc: 0x170e, 0xbdd: 0x1995,
+}
+
+// nfcIndex: 22 blocks, 1408 entries, 1408 bytes
+// Block 0 is the zero block.
+var nfcIndex = [1408]uint8{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04,
+	0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32,
+	0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35,
+	0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+	0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+	0xf0: 0x13,
+	// Block 0x4, offset 0x100
+	0x120: 0x3b, 0x121: 0x3c, 0x122: 0x3d, 0x123: 0x0d, 0x124: 0x3e, 0x125: 0x3f, 0x126: 0x40, 0x127: 0x41,
+	0x128: 0x42, 0x129: 0x43, 0x12a: 0x44, 0x12b: 0x45, 0x12c: 0x40, 0x12d: 0x46, 0x12e: 0x47, 0x12f: 0x48,
+	0x130: 0x44, 0x131: 0x49, 0x132: 0x4a, 0x133: 0x4b, 0x134: 0x4c, 0x135: 0x4d, 0x137: 0x4e,
+	0x138: 0x4f, 0x139: 0x50, 0x13a: 0x51, 0x13b: 0x52, 0x13c: 0x53, 0x13d: 0x54, 0x13e: 0x55, 0x13f: 0x56,
+	// Block 0x5, offset 0x140
+	0x140: 0x57, 0x142: 0x58, 0x144: 0x59, 0x145: 0x5a, 0x146: 0x5b, 0x147: 0x5c,
+	0x14d: 0x5d,
+	0x15c: 0x5e, 0x15f: 0x5f,
+	0x162: 0x60, 0x164: 0x61,
+	0x168: 0x62, 0x169: 0x63, 0x16a: 0x64, 0x16b: 0x65, 0x16c: 0x0e, 0x16d: 0x66, 0x16e: 0x67, 0x16f: 0x68,
+	0x170: 0x69, 0x173: 0x6a, 0x177: 0x0f,
+	0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17,
+	// Block 0x6, offset 0x180
+	0x180: 0x6b, 0x183: 0x6c, 0x184: 0x6d, 0x186: 0x6e, 0x187: 0x6f,
+	0x188: 0x70, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x71, 0x18c: 0x72,
+	0x1ab: 0x73,
+	0x1b3: 0x74, 0x1b5: 0x75, 0x1b7: 0x76,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x77, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x78, 0x1c5: 0x79,
+	0x1c9: 0x7a, 0x1cc: 0x7b, 0x1cd: 0x7c,
+	// Block 0x8, offset 0x200
+	0x219: 0x7d, 0x21a: 0x7e, 0x21b: 0x7f,
+	0x220: 0x80, 0x223: 0x81, 0x224: 0x82, 0x225: 0x83, 0x226: 0x84, 0x227: 0x85,
+	0x22a: 0x86, 0x22b: 0x87, 0x22f: 0x88,
+	0x230: 0x89, 0x231: 0x8a, 0x232: 0x8b, 0x233: 0x8c, 0x234: 0x8d, 0x235: 0x8e, 0x236: 0x8f, 0x237: 0x89,
+	0x238: 0x8a, 0x239: 0x8b, 0x23a: 0x8c, 0x23b: 0x8d, 0x23c: 0x8e, 0x23d: 0x8f, 0x23e: 0x89, 0x23f: 0x8a,
+	// Block 0x9, offset 0x240
+	0x240: 0x8b, 0x241: 0x8c, 0x242: 0x8d, 0x243: 0x8e, 0x244: 0x8f, 0x245: 0x89, 0x246: 0x8a, 0x247: 0x8b,
+	0x248: 0x8c, 0x249: 0x8d, 0x24a: 0x8e, 0x24b: 0x8f, 0x24c: 0x89, 0x24d: 0x8a, 0x24e: 0x8b, 0x24f: 0x8c,
+	0x250: 0x8d, 0x251: 0x8e, 0x252: 0x8f, 0x253: 0x89, 0x254: 0x8a, 0x255: 0x8b, 0x256: 0x8c, 0x257: 0x8d,
+	0x258: 0x8e, 0x259: 0x8f, 0x25a: 0x89, 0x25b: 0x8a, 0x25c: 0x8b, 0x25d: 0x8c, 0x25e: 0x8d, 0x25f: 0x8e,
+	0x260: 0x8f, 0x261: 0x89, 0x262: 0x8a, 0x263: 0x8b, 0x264: 0x8c, 0x265: 0x8d, 0x266: 0x8e, 0x267: 0x8f,
+	0x268: 0x89, 0x269: 0x8a, 0x26a: 0x8b, 0x26b: 0x8c, 0x26c: 0x8d, 0x26d: 0x8e, 0x26e: 0x8f, 0x26f: 0x89,
+	0x270: 0x8a, 0x271: 0x8b, 0x272: 0x8c, 0x273: 0x8d, 0x274: 0x8e, 0x275: 0x8f, 0x276: 0x89, 0x277: 0x8a,
+	0x278: 0x8b, 0x279: 0x8c, 0x27a: 0x8d, 0x27b: 0x8e, 0x27c: 0x8f, 0x27d: 0x89, 0x27e: 0x8a, 0x27f: 0x8b,
+	// Block 0xa, offset 0x280
+	0x280: 0x8c, 0x281: 0x8d, 0x282: 0x8e, 0x283: 0x8f, 0x284: 0x89, 0x285: 0x8a, 0x286: 0x8b, 0x287: 0x8c,
+	0x288: 0x8d, 0x289: 0x8e, 0x28a: 0x8f, 0x28b: 0x89, 0x28c: 0x8a, 0x28d: 0x8b, 0x28e: 0x8c, 0x28f: 0x8d,
+	0x290: 0x8e, 0x291: 0x8f, 0x292: 0x89, 0x293: 0x8a, 0x294: 0x8b, 0x295: 0x8c, 0x296: 0x8d, 0x297: 0x8e,
+	0x298: 0x8f, 0x299: 0x89, 0x29a: 0x8a, 0x29b: 0x8b, 0x29c: 0x8c, 0x29d: 0x8d, 0x29e: 0x8e, 0x29f: 0x8f,
+	0x2a0: 0x89, 0x2a1: 0x8a, 0x2a2: 0x8b, 0x2a3: 0x8c, 0x2a4: 0x8d, 0x2a5: 0x8e, 0x2a6: 0x8f, 0x2a7: 0x89,
+	0x2a8: 0x8a, 0x2a9: 0x8b, 0x2aa: 0x8c, 0x2ab: 0x8d, 0x2ac: 0x8e, 0x2ad: 0x8f, 0x2ae: 0x89, 0x2af: 0x8a,
+	0x2b0: 0x8b, 0x2b1: 0x8c, 0x2b2: 0x8d, 0x2b3: 0x8e, 0x2b4: 0x8f, 0x2b5: 0x89, 0x2b6: 0x8a, 0x2b7: 0x8b,
+	0x2b8: 0x8c, 0x2b9: 0x8d, 0x2ba: 0x8e, 0x2bb: 0x8f, 0x2bc: 0x89, 0x2bd: 0x8a, 0x2be: 0x8b, 0x2bf: 0x8c,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0x8d, 0x2c1: 0x8e, 0x2c2: 0x8f, 0x2c3: 0x89, 0x2c4: 0x8a, 0x2c5: 0x8b, 0x2c6: 0x8c, 0x2c7: 0x8d,
+	0x2c8: 0x8e, 0x2c9: 0x8f, 0x2ca: 0x89, 0x2cb: 0x8a, 0x2cc: 0x8b, 0x2cd: 0x8c, 0x2ce: 0x8d, 0x2cf: 0x8e,
+	0x2d0: 0x8f, 0x2d1: 0x89, 0x2d2: 0x8a, 0x2d3: 0x8b, 0x2d4: 0x8c, 0x2d5: 0x8d, 0x2d6: 0x8e, 0x2d7: 0x8f,
+	0x2d8: 0x89, 0x2d9: 0x8a, 0x2da: 0x8b, 0x2db: 0x8c, 0x2dc: 0x8d, 0x2dd: 0x8e, 0x2de: 0x90,
+	// Block 0xc, offset 0x300
+	0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20,
+	0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x91, 0x32d: 0x92, 0x32e: 0x93,
+	0x331: 0x94, 0x332: 0x95, 0x333: 0x96, 0x334: 0x97,
+	0x338: 0x98, 0x339: 0x99, 0x33a: 0x9a, 0x33b: 0x9b, 0x33e: 0x9c, 0x33f: 0x9d,
+	// Block 0xd, offset 0x340
+	0x347: 0x9e,
+	0x34b: 0x9f, 0x34d: 0xa0,
+	0x368: 0xa1, 0x36b: 0xa2,
+	0x374: 0xa3,
+	0x37a: 0xa4, 0x37b: 0xa5, 0x37d: 0xa6, 0x37e: 0xa7,
+	// Block 0xe, offset 0x380
+	0x381: 0xa8, 0x382: 0xa9, 0x384: 0xaa, 0x385: 0x84, 0x387: 0xab,
+	0x388: 0xac, 0x38b: 0xad, 0x38c: 0xae, 0x38d: 0xaf,
+	0x391: 0xb0, 0x392: 0xb1, 0x393: 0xb2, 0x396: 0xb3, 0x397: 0xb4,
+	0x398: 0x75, 0x39a: 0xb5, 0x39c: 0xb6,
+	0x3a0: 0xb7, 0x3a4: 0xb8, 0x3a5: 0xb9, 0x3a7: 0xba,
+	0x3a8: 0xbb, 0x3a9: 0xbc, 0x3aa: 0xbd,
+	0x3b0: 0x75, 0x3b5: 0xbe, 0x3b6: 0xbf,
+	0x3bd: 0xc0,
+	// Block 0xf, offset 0x3c0
+	0x3eb: 0xc1, 0x3ec: 0xc2,
+	0x3ff: 0xc3,
+	// Block 0x10, offset 0x400
+	0x432: 0xc4,
+	// Block 0x11, offset 0x440
+	0x445: 0xc5, 0x446: 0xc6, 0x447: 0xc7,
+	0x449: 0xc8,
+	// Block 0x12, offset 0x480
+	0x480: 0xc9, 0x482: 0xca, 0x484: 0xc2,
+	0x48a: 0xcb, 0x48b: 0xcc,
+	0x493: 0xcd,
+	0x4a3: 0xce, 0x4a5: 0xcf,
+	// Block 0x13, offset 0x4c0
+	0x4c8: 0xd0,
+	// Block 0x14, offset 0x500
+	0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c,
+	0x528: 0x2d,
+	// Block 0x15, offset 0x540
+	0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+	0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+	0x56f: 0x12,
+}
+
+// nfcSparseOffset: 163 entries, 326 bytes
+var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x6e, 0x76, 0x7d, 0x80, 0x88, 0x8c, 0x90, 0x92, 0x94, 0x9d, 0xa1, 0xa8, 0xad, 0xb0, 0xba, 0xbd, 0xc4, 0xcc, 0xcf, 0xd1, 0xd4, 0xd6, 0xdb, 0xec, 0xf8, 0xfa, 0x100, 0x102, 0x104, 0x106, 0x108, 0x10a, 0x10c, 0x10f, 0x112, 0x114, 0x117, 0x11a, 0x11e, 0x124, 0x12b, 0x134, 0x136, 0x139, 0x13b, 0x146, 0x14a, 0x158, 0x15b, 0x161, 0x167, 0x172, 0x176, 0x178, 0x17a, 0x17c, 0x17e, 0x180, 0x186, 0x18a, 0x18c, 0x18e, 0x196, 0x19a, 0x19d, 0x19f, 0x1a1, 0x1a4, 0x1a7, 0x1a9, 0x1ab, 0x1ad, 0x1af, 0x1b5, 0x1b8, 0x1ba, 0x1c1, 0x1c7, 0x1cd, 0x1d5, 0x1db, 0x1e1, 0x1e7, 0x1eb, 0x1f9, 0x202, 0x205, 0x208, 0x20a, 0x20d, 0x20f, 0x213, 0x218, 0x21a, 0x21c, 0x221, 0x227, 0x229, 0x22b, 0x22d, 0x233, 0x236, 0x238, 0x23a, 0x23c, 0x242, 0x246, 0x24a, 0x252, 0x259, 0x25c, 0x25f, 0x261, 0x264, 0x26c, 0x270, 0x277, 0x27a, 0x280, 0x282, 0x285, 0x287, 0x28a, 0x28f, 0x291, 0x293, 0x295, 0x297, 0x299, 0x29c, 0x29e, 0x2a0, 0x2a2, 0x2a4, 0x2a6, 0x2a8, 0x2b5, 0x2bf, 0x2c1, 0x2c3, 0x2c9, 0x2cb, 0x2cd, 0x2cf, 0x2d3, 0x2d5, 0x2d8}
+
+// nfcSparseValues: 730 entries, 2920 bytes
+var nfcSparseValues = [730]valueRange{
+	// Block 0x0, offset 0x0
+	{value: 0x0000, lo: 0x04},
+	{value: 0xa100, lo: 0xa8, hi: 0xa8},
+	{value: 0x8100, lo: 0xaf, hi: 0xaf},
+	{value: 0x8100, lo: 0xb4, hi: 0xb4},
+	{value: 0x8100, lo: 0xb8, hi: 0xb8},
+	// Block 0x1, offset 0x5
+	{value: 0x0091, lo: 0x03},
+	{value: 0x4823, lo: 0xa0, hi: 0xa1},
+	{value: 0x4855, lo: 0xaf, hi: 0xb0},
+	{value: 0xa000, lo: 0xb7, hi: 0xb7},
+	// Block 0x2, offset 0x9
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	// Block 0x3, offset 0xb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x98, hi: 0x9d},
+	// Block 0x4, offset 0xd
+	{value: 0x0006, lo: 0x0a},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x85, hi: 0x85},
+	{value: 0xa000, lo: 0x89, hi: 0x89},
+	{value: 0x4981, lo: 0x8a, hi: 0x8a},
+	{value: 0x499f, lo: 0x8b, hi: 0x8b},
+	{value: 0x3808, lo: 0x8c, hi: 0x8c},
+	{value: 0x3820, lo: 0x8d, hi: 0x8d},
+	{value: 0x49b7, lo: 0x8e, hi: 0x8e},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x383e, lo: 0x93, hi: 0x94},
+	// Block 0x5, offset 0x18
+	{value: 0x0000, lo: 0x0f},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0xa000, lo: 0x8d, hi: 0x8d},
+	{value: 0x38e6, lo: 0x90, hi: 0x90},
+	{value: 0x38f2, lo: 0x91, hi: 0x91},
+	{value: 0x38e0, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x96, hi: 0x96},
+	{value: 0x3958, lo: 0x97, hi: 0x97},
+	{value: 0x3922, lo: 0x9c, hi: 0x9c},
+	{value: 0x390a, lo: 0x9d, hi: 0x9d},
+	{value: 0x3934, lo: 0x9e, hi: 0x9e},
+	{value: 0xa000, lo: 0xb4, hi: 0xb5},
+	{value: 0x395e, lo: 0xb6, hi: 0xb6},
+	{value: 0x3964, lo: 0xb7, hi: 0xb7},
+	// Block 0x6, offset 0x28
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x83, hi: 0x87},
+	// Block 0x7, offset 0x2a
+	{value: 0x0001, lo: 0x04},
+	{value: 0x8114, lo: 0x81, hi: 0x82},
+	{value: 0x8133, lo: 0x84, hi: 0x84},
+	{value: 0x812e, lo: 0x85, hi: 0x85},
+	{value: 0x810e, lo: 0x87, hi: 0x87},
+	// Block 0x8, offset 0x2f
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8133, lo: 0x90, hi: 0x97},
+	{value: 0x811a, lo: 0x98, hi: 0x98},
+	{value: 0x811b, lo: 0x99, hi: 0x99},
+	{value: 0x811c, lo: 0x9a, hi: 0x9a},
+	{value: 0x3982, lo: 0xa2, hi: 0xa2},
+	{value: 0x3988, lo: 0xa3, hi: 0xa3},
+	{value: 0x3994, lo: 0xa4, hi: 0xa4},
+	{value: 0x398e, lo: 0xa5, hi: 0xa5},
+	{value: 0x399a, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xa7, hi: 0xa7},
+	// Block 0x9, offset 0x3a
+	{value: 0x0000, lo: 0x0e},
+	{value: 0x39ac, lo: 0x80, hi: 0x80},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0x39a0, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x39a6, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x95, hi: 0x95},
+	{value: 0x8133, lo: 0x96, hi: 0x9c},
+	{value: 0x8133, lo: 0x9f, hi: 0xa2},
+	{value: 0x812e, lo: 0xa3, hi: 0xa3},
+	{value: 0x8133, lo: 0xa4, hi: 0xa4},
+	{value: 0x8133, lo: 0xa7, hi: 0xa8},
+	{value: 0x812e, lo: 0xaa, hi: 0xaa},
+	{value: 0x8133, lo: 0xab, hi: 0xac},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	// Block 0xa, offset 0x49
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x8120, lo: 0x91, hi: 0x91},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	{value: 0x812e, lo: 0xb1, hi: 0xb1},
+	{value: 0x8133, lo: 0xb2, hi: 0xb3},
+	{value: 0x812e, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb5, hi: 0xb6},
+	{value: 0x812e, lo: 0xb7, hi: 0xb9},
+	{value: 0x8133, lo: 0xba, hi: 0xba},
+	{value: 0x812e, lo: 0xbb, hi: 0xbc},
+	{value: 0x8133, lo: 0xbd, hi: 0xbd},
+	{value: 0x812e, lo: 0xbe, hi: 0xbe},
+	{value: 0x8133, lo: 0xbf, hi: 0xbf},
+	// Block 0xb, offset 0x56
+	{value: 0x0005, lo: 0x07},
+	{value: 0x8133, lo: 0x80, hi: 0x80},
+	{value: 0x8133, lo: 0x81, hi: 0x81},
+	{value: 0x812e, lo: 0x82, hi: 0x83},
+	{value: 0x812e, lo: 0x84, hi: 0x85},
+	{value: 0x812e, lo: 0x86, hi: 0x87},
+	{value: 0x812e, lo: 0x88, hi: 0x89},
+	{value: 0x8133, lo: 0x8a, hi: 0x8a},
+	// Block 0xc, offset 0x5e
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8133, lo: 0xab, hi: 0xb1},
+	{value: 0x812e, lo: 0xb2, hi: 0xb2},
+	{value: 0x8133, lo: 0xb3, hi: 0xb3},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	// Block 0xd, offset 0x63
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8133, lo: 0x96, hi: 0x99},
+	{value: 0x8133, lo: 0x9b, hi: 0xa3},
+	{value: 0x8133, lo: 0xa5, hi: 0xa7},
+	{value: 0x8133, lo: 0xa9, hi: 0xad},
+	// Block 0xe, offset 0x68
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x99, hi: 0x9b},
+	// Block 0xf, offset 0x6a
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8133, lo: 0x98, hi: 0x98},
+	{value: 0x812e, lo: 0x99, hi: 0x9b},
+	{value: 0x8133, lo: 0x9c, hi: 0x9f},
+	// Block 0x10, offset 0x6e
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0xa8, hi: 0xa8},
+	{value: 0x4019, lo: 0xa9, hi: 0xa9},
+	{value: 0xa000, lo: 0xb0, hi: 0xb0},
+	{value: 0x4021, lo: 0xb1, hi: 0xb1},
+	{value: 0xa000, lo: 0xb3, hi: 0xb3},
+	{value: 0x4029, lo: 0xb4, hi: 0xb4},
+	{value: 0x9903, lo: 0xbc, hi: 0xbc},
+	// Block 0x11, offset 0x76
+	{value: 0x0008, lo: 0x06},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x8133, lo: 0x91, hi: 0x91},
+	{value: 0x812e, lo: 0x92, hi: 0x92},
+	{value: 0x8133, lo: 0x93, hi: 0x93},
+	{value: 0x8133, lo: 0x94, hi: 0x94},
+	{value: 0x465d, lo: 0x98, hi: 0x9f},
+	// Block 0x12, offset 0x7d
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x13, offset 0x80
+	{value: 0x0008, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2dd5, lo: 0x8b, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x469d, lo: 0x9c, hi: 0x9d},
+	{value: 0x46ad, lo: 0x9f, hi: 0x9f},
+	{value: 0x8133, lo: 0xbe, hi: 0xbe},
+	// Block 0x14, offset 0x88
+	{value: 0x0000, lo: 0x03},
+	{value: 0x46d5, lo: 0xb3, hi: 0xb3},
+	{value: 0x46dd, lo: 0xb6, hi: 0xb6},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	// Block 0x15, offset 0x8c
+	{value: 0x0008, lo: 0x03},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x46b5, lo: 0x99, hi: 0x9b},
+	{value: 0x46cd, lo: 0x9e, hi: 0x9e},
+	// Block 0x16, offset 0x90
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	// Block 0x17, offset 0x92
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	// Block 0x18, offset 0x94
+	{value: 0x0000, lo: 0x08},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2ded, lo: 0x88, hi: 0x88},
+	{value: 0x2de5, lo: 0x8b, hi: 0x8b},
+	{value: 0x2df5, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x96, hi: 0x97},
+	{value: 0x46e5, lo: 0x9c, hi: 0x9c},
+	{value: 0x46ed, lo: 0x9d, hi: 0x9d},
+	// Block 0x19, offset 0x9d
+	{value: 0x0000, lo: 0x03},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x2dfd, lo: 0x94, hi: 0x94},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x1a, offset 0xa1
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2e05, lo: 0x8a, hi: 0x8a},
+	{value: 0x2e15, lo: 0x8b, hi: 0x8b},
+	{value: 0x2e0d, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1b, offset 0xa8
+	{value: 0x1801, lo: 0x04},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x4031, lo: 0x88, hi: 0x88},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x8121, lo: 0x95, hi: 0x96},
+	// Block 0x1c, offset 0xad
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	{value: 0xa000, lo: 0xbf, hi: 0xbf},
+	// Block 0x1d, offset 0xb0
+	{value: 0x0000, lo: 0x09},
+	{value: 0x2e1d, lo: 0x80, hi: 0x80},
+	{value: 0x9900, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x2e25, lo: 0x87, hi: 0x87},
+	{value: 0x2e2d, lo: 0x88, hi: 0x88},
+	{value: 0x3091, lo: 0x8a, hi: 0x8a},
+	{value: 0x2f19, lo: 0x8b, hi: 0x8b},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x95, hi: 0x96},
+	// Block 0x1e, offset 0xba
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x1f, offset 0xbd
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2e35, lo: 0x8a, hi: 0x8a},
+	{value: 0x2e45, lo: 0x8b, hi: 0x8b},
+	{value: 0x2e3d, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x20, offset 0xc4
+	{value: 0x6ab3, lo: 0x07},
+	{value: 0x9905, lo: 0x8a, hi: 0x8a},
+	{value: 0x9900, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4039, lo: 0x9a, hi: 0x9a},
+	{value: 0x3099, lo: 0x9c, hi: 0x9c},
+	{value: 0x2f24, lo: 0x9d, hi: 0x9d},
+	{value: 0x2e4d, lo: 0x9e, hi: 0x9f},
+	// Block 0x21, offset 0xcc
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8123, lo: 0xb8, hi: 0xb9},
+	{value: 0x8105, lo: 0xba, hi: 0xba},
+	// Block 0x22, offset 0xcf
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8124, lo: 0x88, hi: 0x8b},
+	// Block 0x23, offset 0xd1
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8125, lo: 0xb8, hi: 0xb9},
+	{value: 0x8105, lo: 0xba, hi: 0xba},
+	// Block 0x24, offset 0xd4
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8126, lo: 0x88, hi: 0x8b},
+	// Block 0x25, offset 0xd6
+	{value: 0x0000, lo: 0x04},
+	{value: 0x812e, lo: 0x98, hi: 0x99},
+	{value: 0x812e, lo: 0xb5, hi: 0xb5},
+	{value: 0x812e, lo: 0xb7, hi: 0xb7},
+	{value: 0x812c, lo: 0xb9, hi: 0xb9},
+	// Block 0x26, offset 0xdb
+	{value: 0x0000, lo: 0x10},
+	{value: 0x2774, lo: 0x83, hi: 0x83},
+	{value: 0x277b, lo: 0x8d, hi: 0x8d},
+	{value: 0x2782, lo: 0x92, hi: 0x92},
+	{value: 0x2789, lo: 0x97, hi: 0x97},
+	{value: 0x2790, lo: 0x9c, hi: 0x9c},
+	{value: 0x276d, lo: 0xa9, hi: 0xa9},
+	{value: 0x8127, lo: 0xb1, hi: 0xb1},
+	{value: 0x8128, lo: 0xb2, hi: 0xb2},
+	{value: 0x4bc5, lo: 0xb3, hi: 0xb3},
+	{value: 0x8129, lo: 0xb4, hi: 0xb4},
+	{value: 0x4bce, lo: 0xb5, hi: 0xb5},
+	{value: 0x46f5, lo: 0xb6, hi: 0xb6},
+	{value: 0x8200, lo: 0xb7, hi: 0xb7},
+	{value: 0x46fd, lo: 0xb8, hi: 0xb8},
+	{value: 0x8200, lo: 0xb9, hi: 0xb9},
+	{value: 0x8128, lo: 0xba, hi: 0xbd},
+	// Block 0x27, offset 0xec
+	{value: 0x0000, lo: 0x0b},
+	{value: 0x8128, lo: 0x80, hi: 0x80},
+	{value: 0x4bd7, lo: 0x81, hi: 0x81},
+	{value: 0x8133, lo: 0x82, hi: 0x83},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0x86, hi: 0x87},
+	{value: 0x279e, lo: 0x93, hi: 0x93},
+	{value: 0x27a5, lo: 0x9d, hi: 0x9d},
+	{value: 0x27ac, lo: 0xa2, hi: 0xa2},
+	{value: 0x27b3, lo: 0xa7, hi: 0xa7},
+	{value: 0x27ba, lo: 0xac, hi: 0xac},
+	{value: 0x2797, lo: 0xb9, hi: 0xb9},
+	// Block 0x28, offset 0xf8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x86, hi: 0x86},
+	// Block 0x29, offset 0xfa
+	{value: 0x0000, lo: 0x05},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x2e55, lo: 0xa6, hi: 0xa6},
+	{value: 0x9900, lo: 0xae, hi: 0xae},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	{value: 0x8105, lo: 0xb9, hi: 0xba},
+	// Block 0x2a, offset 0x100
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x8d, hi: 0x8d},
+	// Block 0x2b, offset 0x102
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x80, hi: 0x92},
+	// Block 0x2c, offset 0x104
+	{value: 0x0000, lo: 0x01},
+	{value: 0xb900, lo: 0xa1, hi: 0xb5},
+	// Block 0x2d, offset 0x106
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0xa8, hi: 0xbf},
+	// Block 0x2e, offset 0x108
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0x80, hi: 0x82},
+	// Block 0x2f, offset 0x10a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x9d, hi: 0x9f},
+	// Block 0x30, offset 0x10c
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x94, hi: 0x95},
+	{value: 0x8105, lo: 0xb4, hi: 0xb4},
+	// Block 0x31, offset 0x10f
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x92, hi: 0x92},
+	{value: 0x8133, lo: 0x9d, hi: 0x9d},
+	// Block 0x32, offset 0x112
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa9, hi: 0xa9},
+	// Block 0x33, offset 0x114
+	{value: 0x0004, lo: 0x02},
+	{value: 0x812f, lo: 0xb9, hi: 0xba},
+	{value: 0x812e, lo: 0xbb, hi: 0xbb},
+	// Block 0x34, offset 0x117
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x97, hi: 0x97},
+	{value: 0x812e, lo: 0x98, hi: 0x98},
+	// Block 0x35, offset 0x11a
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0xa0, hi: 0xa0},
+	{value: 0x8133, lo: 0xb5, hi: 0xbc},
+	{value: 0x812e, lo: 0xbf, hi: 0xbf},
+	// Block 0x36, offset 0x11e
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8133, lo: 0xb0, hi: 0xb4},
+	{value: 0x812e, lo: 0xb5, hi: 0xba},
+	{value: 0x8133, lo: 0xbb, hi: 0xbc},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	{value: 0x812e, lo: 0xbf, hi: 0xbf},
+	// Block 0x37, offset 0x124
+	{value: 0x0000, lo: 0x06},
+	{value: 0x812e, lo: 0x80, hi: 0x80},
+	{value: 0x8133, lo: 0x81, hi: 0x82},
+	{value: 0x812e, lo: 0x83, hi: 0x84},
+	{value: 0x8133, lo: 0x85, hi: 0x89},
+	{value: 0x812e, lo: 0x8a, hi: 0x8a},
+	{value: 0x8133, lo: 0x8b, hi: 0x8e},
+	// Block 0x38, offset 0x12b
+	{value: 0x0000, lo: 0x08},
+	{value: 0x2e9d, lo: 0x80, hi: 0x80},
+	{value: 0x2ea5, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x82, hi: 0x82},
+	{value: 0x2ead, lo: 0x83, hi: 0x83},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0xab, hi: 0xab},
+	{value: 0x812e, lo: 0xac, hi: 0xac},
+	{value: 0x8133, lo: 0xad, hi: 0xb3},
+	// Block 0x39, offset 0x134
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xaa, hi: 0xab},
+	// Block 0x3a, offset 0x136
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xa6, hi: 0xa6},
+	{value: 0x8105, lo: 0xb2, hi: 0xb3},
+	// Block 0x3b, offset 0x139
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	// Block 0x3c, offset 0x13b
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8133, lo: 0x90, hi: 0x92},
+	{value: 0x8101, lo: 0x94, hi: 0x94},
+	{value: 0x812e, lo: 0x95, hi: 0x99},
+	{value: 0x8133, lo: 0x9a, hi: 0x9b},
+	{value: 0x812e, lo: 0x9c, hi: 0x9f},
+	{value: 0x8133, lo: 0xa0, hi: 0xa0},
+	{value: 0x8101, lo: 0xa2, hi: 0xa8},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	{value: 0x8133, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb8, hi: 0xb9},
+	// Block 0x3d, offset 0x146
+	{value: 0x0004, lo: 0x03},
+	{value: 0x052a, lo: 0x80, hi: 0x81},
+	{value: 0x8100, lo: 0x97, hi: 0x97},
+	{value: 0x8100, lo: 0xbe, hi: 0xbe},
+	// Block 0x3e, offset 0x14a
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x8133, lo: 0x90, hi: 0x91},
+	{value: 0x8101, lo: 0x92, hi: 0x93},
+	{value: 0x8133, lo: 0x94, hi: 0x97},
+	{value: 0x8101, lo: 0x98, hi: 0x9a},
+	{value: 0x8133, lo: 0x9b, hi: 0x9c},
+	{value: 0x8133, lo: 0xa1, hi: 0xa1},
+	{value: 0x8101, lo: 0xa5, hi: 0xa6},
+	{value: 0x8133, lo: 0xa7, hi: 0xa7},
+	{value: 0x812e, lo: 0xa8, hi: 0xa8},
+	{value: 0x8133, lo: 0xa9, hi: 0xa9},
+	{value: 0x8101, lo: 0xaa, hi: 0xab},
+	{value: 0x812e, lo: 0xac, hi: 0xaf},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	// Block 0x3f, offset 0x158
+	{value: 0x43bc, lo: 0x02},
+	{value: 0x023c, lo: 0xa6, hi: 0xa6},
+	{value: 0x0057, lo: 0xaa, hi: 0xab},
+	// Block 0x40, offset 0x15b
+	{value: 0x0007, lo: 0x05},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	{value: 0x3cfa, lo: 0x9a, hi: 0x9b},
+	{value: 0x3d08, lo: 0xae, hi: 0xae},
+	// Block 0x41, offset 0x161
+	{value: 0x000e, lo: 0x05},
+	{value: 0x3d0f, lo: 0x8d, hi: 0x8e},
+	{value: 0x3d16, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	// Block 0x42, offset 0x167
+	{value: 0x62c7, lo: 0x0a},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0x3d24, lo: 0x84, hi: 0x84},
+	{value: 0xa000, lo: 0x88, hi: 0x88},
+	{value: 0x3d2b, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0x3d32, lo: 0x8c, hi: 0x8c},
+	{value: 0xa000, lo: 0xa3, hi: 0xa3},
+	{value: 0x3d39, lo: 0xa4, hi: 0xa5},
+	{value: 0x3d40, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xbc, hi: 0xbc},
+	// Block 0x43, offset 0x172
+	{value: 0x0007, lo: 0x03},
+	{value: 0x3da9, lo: 0xa0, hi: 0xa1},
+	{value: 0x3dd3, lo: 0xa2, hi: 0xa3},
+	{value: 0x3dfd, lo: 0xaa, hi: 0xad},
+	// Block 0x44, offset 0x176
+	{value: 0x0004, lo: 0x01},
+	{value: 0x0586, lo: 0xa9, hi: 0xaa},
+	// Block 0x45, offset 0x178
+	{value: 0x0000, lo: 0x01},
+	{value: 0x461e, lo: 0x9c, hi: 0x9c},
+	// Block 0x46, offset 0x17a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xaf, hi: 0xb1},
+	// Block 0x47, offset 0x17c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x48, offset 0x17e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xa0, hi: 0xbf},
+	// Block 0x49, offset 0x180
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812d, lo: 0xaa, hi: 0xaa},
+	{value: 0x8132, lo: 0xab, hi: 0xab},
+	{value: 0x8134, lo: 0xac, hi: 0xac},
+	{value: 0x812f, lo: 0xad, hi: 0xad},
+	{value: 0x8130, lo: 0xae, hi: 0xaf},
+	// Block 0x4a, offset 0x186
+	{value: 0x0000, lo: 0x03},
+	{value: 0x4be0, lo: 0xb3, hi: 0xb3},
+	{value: 0x4be0, lo: 0xb5, hi: 0xb6},
+	{value: 0x4be0, lo: 0xba, hi: 0xbf},
+	// Block 0x4b, offset 0x18a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x4be0, lo: 0x8f, hi: 0xa3},
+	// Block 0x4c, offset 0x18c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xae, hi: 0xbe},
+	// Block 0x4d, offset 0x18e
+	{value: 0x0000, lo: 0x07},
+	{value: 0x8100, lo: 0x84, hi: 0x84},
+	{value: 0x8100, lo: 0x87, hi: 0x87},
+	{value: 0x8100, lo: 0x90, hi: 0x90},
+	{value: 0x8100, lo: 0x9e, hi: 0x9e},
+	{value: 0x8100, lo: 0xa1, hi: 0xa1},
+	{value: 0x8100, lo: 0xb2, hi: 0xb2},
+	{value: 0x8100, lo: 0xbb, hi: 0xbb},
+	// Block 0x4e, offset 0x196
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8100, lo: 0x80, hi: 0x80},
+	{value: 0x8100, lo: 0x8b, hi: 0x8b},
+	{value: 0x8100, lo: 0x8e, hi: 0x8e},
+	// Block 0x4f, offset 0x19a
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0xaf, hi: 0xaf},
+	{value: 0x8133, lo: 0xb4, hi: 0xbd},
+	// Block 0x50, offset 0x19d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x9e, hi: 0x9f},
+	// Block 0x51, offset 0x19f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb0, hi: 0xb1},
+	// Block 0x52, offset 0x1a1
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x86, hi: 0x86},
+	{value: 0x8105, lo: 0xac, hi: 0xac},
+	// Block 0x53, offset 0x1a4
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0xa0, hi: 0xb1},
+	// Block 0x54, offset 0x1a7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xab, hi: 0xad},
+	// Block 0x55, offset 0x1a9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x93, hi: 0x93},
+	// Block 0x56, offset 0x1ab
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xb3, hi: 0xb3},
+	// Block 0x57, offset 0x1ad
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x80, hi: 0x80},
+	// Block 0x58, offset 0x1af
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	{value: 0x8133, lo: 0xb2, hi: 0xb3},
+	{value: 0x812e, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb7, hi: 0xb8},
+	{value: 0x8133, lo: 0xbe, hi: 0xbf},
+	// Block 0x59, offset 0x1b5
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x81, hi: 0x81},
+	{value: 0x8105, lo: 0xb6, hi: 0xb6},
+	// Block 0x5a, offset 0x1b8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xad, hi: 0xad},
+	// Block 0x5b, offset 0x1ba
+	{value: 0x0000, lo: 0x06},
+	{value: 0xe500, lo: 0x80, hi: 0x80},
+	{value: 0xc600, lo: 0x81, hi: 0x9b},
+	{value: 0xe500, lo: 0x9c, hi: 0x9c},
+	{value: 0xc600, lo: 0x9d, hi: 0xb7},
+	{value: 0xe500, lo: 0xb8, hi: 0xb8},
+	{value: 0xc600, lo: 0xb9, hi: 0xbf},
+	// Block 0x5c, offset 0x1c1
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x93},
+	{value: 0xe500, lo: 0x94, hi: 0x94},
+	{value: 0xc600, lo: 0x95, hi: 0xaf},
+	{value: 0xe500, lo: 0xb0, hi: 0xb0},
+	{value: 0xc600, lo: 0xb1, hi: 0xbf},
+	// Block 0x5d, offset 0x1c7
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8b},
+	{value: 0xe500, lo: 0x8c, hi: 0x8c},
+	{value: 0xc600, lo: 0x8d, hi: 0xa7},
+	{value: 0xe500, lo: 0xa8, hi: 0xa8},
+	{value: 0xc600, lo: 0xa9, hi: 0xbf},
+	// Block 0x5e, offset 0x1cd
+	{value: 0x0000, lo: 0x07},
+	{value: 0xc600, lo: 0x80, hi: 0x83},
+	{value: 0xe500, lo: 0x84, hi: 0x84},
+	{value: 0xc600, lo: 0x85, hi: 0x9f},
+	{value: 0xe500, lo: 0xa0, hi: 0xa0},
+	{value: 0xc600, lo: 0xa1, hi: 0xbb},
+	{value: 0xe500, lo: 0xbc, hi: 0xbc},
+	{value: 0xc600, lo: 0xbd, hi: 0xbf},
+	// Block 0x5f, offset 0x1d5
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x97},
+	{value: 0xe500, lo: 0x98, hi: 0x98},
+	{value: 0xc600, lo: 0x99, hi: 0xb3},
+	{value: 0xe500, lo: 0xb4, hi: 0xb4},
+	{value: 0xc600, lo: 0xb5, hi: 0xbf},
+	// Block 0x60, offset 0x1db
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8f},
+	{value: 0xe500, lo: 0x90, hi: 0x90},
+	{value: 0xc600, lo: 0x91, hi: 0xab},
+	{value: 0xe500, lo: 0xac, hi: 0xac},
+	{value: 0xc600, lo: 0xad, hi: 0xbf},
+	// Block 0x61, offset 0x1e1
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	{value: 0xe500, lo: 0xa4, hi: 0xa4},
+	{value: 0xc600, lo: 0xa5, hi: 0xbf},
+	// Block 0x62, offset 0x1e7
+	{value: 0x0000, lo: 0x03},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	// Block 0x63, offset 0x1eb
+	{value: 0x0006, lo: 0x0d},
+	{value: 0x44d1, lo: 0x9d, hi: 0x9d},
+	{value: 0x8116, lo: 0x9e, hi: 0x9e},
+	{value: 0x4543, lo: 0x9f, hi: 0x9f},
+	{value: 0x4531, lo: 0xaa, hi: 0xab},
+	{value: 0x4635, lo: 0xac, hi: 0xac},
+	{value: 0x463d, lo: 0xad, hi: 0xad},
+	{value: 0x4489, lo: 0xae, hi: 0xb1},
+	{value: 0x44a7, lo: 0xb2, hi: 0xb4},
+	{value: 0x44bf, lo: 0xb5, hi: 0xb6},
+	{value: 0x44cb, lo: 0xb8, hi: 0xb8},
+	{value: 0x44d7, lo: 0xb9, hi: 0xbb},
+	{value: 0x44ef, lo: 0xbc, hi: 0xbc},
+	{value: 0x44f5, lo: 0xbe, hi: 0xbe},
+	// Block 0x64, offset 0x1f9
+	{value: 0x0006, lo: 0x08},
+	{value: 0x44fb, lo: 0x80, hi: 0x81},
+	{value: 0x4507, lo: 0x83, hi: 0x84},
+	{value: 0x4519, lo: 0x86, hi: 0x89},
+	{value: 0x453d, lo: 0x8a, hi: 0x8a},
+	{value: 0x44b9, lo: 0x8b, hi: 0x8b},
+	{value: 0x44a1, lo: 0x8c, hi: 0x8c},
+	{value: 0x44e9, lo: 0x8d, hi: 0x8d},
+	{value: 0x4513, lo: 0x8e, hi: 0x8e},
+	// Block 0x65, offset 0x202
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0xa4, hi: 0xa5},
+	{value: 0x8100, lo: 0xb0, hi: 0xb1},
+	// Block 0x66, offset 0x205
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0x9b, hi: 0x9d},
+	{value: 0x8200, lo: 0x9e, hi: 0xa3},
+	// Block 0x67, offset 0x208
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x90, hi: 0x90},
+	// Block 0x68, offset 0x20a
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8100, lo: 0x99, hi: 0x99},
+	{value: 0x8200, lo: 0xb2, hi: 0xb4},
+	// Block 0x69, offset 0x20d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xbc, hi: 0xbd},
+	// Block 0x6a, offset 0x20f
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8133, lo: 0xa0, hi: 0xa6},
+	{value: 0x812e, lo: 0xa7, hi: 0xad},
+	{value: 0x8133, lo: 0xae, hi: 0xaf},
+	// Block 0x6b, offset 0x213
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8100, lo: 0x89, hi: 0x8c},
+	{value: 0x8100, lo: 0xb0, hi: 0xb2},
+	{value: 0x8100, lo: 0xb4, hi: 0xb4},
+	{value: 0x8100, lo: 0xb6, hi: 0xbf},
+	// Block 0x6c, offset 0x218
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x81, hi: 0x8c},
+	// Block 0x6d, offset 0x21a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0xb5, hi: 0xba},
+	// Block 0x6e, offset 0x21c
+	{value: 0x0000, lo: 0x04},
+	{value: 0x4be0, lo: 0x9e, hi: 0x9f},
+	{value: 0x4be0, lo: 0xa3, hi: 0xa3},
+	{value: 0x4be0, lo: 0xa5, hi: 0xa6},
+	{value: 0x4be0, lo: 0xaa, hi: 0xaf},
+	// Block 0x6f, offset 0x221
+	{value: 0x0000, lo: 0x05},
+	{value: 0x4be0, lo: 0x82, hi: 0x87},
+	{value: 0x4be0, lo: 0x8a, hi: 0x8f},
+	{value: 0x4be0, lo: 0x92, hi: 0x97},
+	{value: 0x4be0, lo: 0x9a, hi: 0x9c},
+	{value: 0x8100, lo: 0xa3, hi: 0xa3},
+	// Block 0x70, offset 0x227
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	// Block 0x71, offset 0x229
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xa0, hi: 0xa0},
+	// Block 0x72, offset 0x22b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb6, hi: 0xba},
+	// Block 0x73, offset 0x22d
+	{value: 0x002d, lo: 0x05},
+	{value: 0x812e, lo: 0x8d, hi: 0x8d},
+	{value: 0x8133, lo: 0x8f, hi: 0x8f},
+	{value: 0x8133, lo: 0xb8, hi: 0xb8},
+	{value: 0x8101, lo: 0xb9, hi: 0xba},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x74, offset 0x233
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0xa5, hi: 0xa5},
+	{value: 0x812e, lo: 0xa6, hi: 0xa6},
+	// Block 0x75, offset 0x236
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xa4, hi: 0xa7},
+	// Block 0x76, offset 0x238
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xab, hi: 0xac},
+	// Block 0x77, offset 0x23a
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xbd, hi: 0xbf},
+	// Block 0x78, offset 0x23c
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812e, lo: 0x86, hi: 0x87},
+	{value: 0x8133, lo: 0x88, hi: 0x8a},
+	{value: 0x812e, lo: 0x8b, hi: 0x8b},
+	{value: 0x8133, lo: 0x8c, hi: 0x8c},
+	{value: 0x812e, lo: 0x8d, hi: 0x90},
+	// Block 0x79, offset 0x242
+	{value: 0x0005, lo: 0x03},
+	{value: 0x8133, lo: 0x82, hi: 0x82},
+	{value: 0x812e, lo: 0x83, hi: 0x84},
+	{value: 0x812e, lo: 0x85, hi: 0x85},
+	// Block 0x7a, offset 0x246
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0x86, hi: 0x86},
+	{value: 0x8105, lo: 0xb0, hi: 0xb0},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x7b, offset 0x24a
+	{value: 0x17fe, lo: 0x07},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4379, lo: 0x9a, hi: 0x9a},
+	{value: 0xa000, lo: 0x9b, hi: 0x9b},
+	{value: 0x4383, lo: 0x9c, hi: 0x9c},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x438d, lo: 0xab, hi: 0xab},
+	{value: 0x8105, lo: 0xb9, hi: 0xba},
+	// Block 0x7c, offset 0x252
+	{value: 0x0000, lo: 0x06},
+	{value: 0x8133, lo: 0x80, hi: 0x82},
+	{value: 0x9900, lo: 0xa7, hi: 0xa7},
+	{value: 0x2eb5, lo: 0xae, hi: 0xae},
+	{value: 0x2ebf, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb1, hi: 0xb2},
+	{value: 0x8105, lo: 0xb3, hi: 0xb4},
+	// Block 0x7d, offset 0x259
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x80, hi: 0x80},
+	{value: 0x8103, lo: 0x8a, hi: 0x8a},
+	// Block 0x7e, offset 0x25c
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb5, hi: 0xb5},
+	{value: 0x8103, lo: 0xb6, hi: 0xb6},
+	// Block 0x7f, offset 0x25f
+	{value: 0x0002, lo: 0x01},
+	{value: 0x8103, lo: 0xa9, hi: 0xaa},
+	// Block 0x80, offset 0x261
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x81, offset 0x264
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2ec9, lo: 0x8b, hi: 0x8b},
+	{value: 0x2ed3, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x8133, lo: 0xa6, hi: 0xac},
+	{value: 0x8133, lo: 0xb0, hi: 0xb4},
+	// Block 0x82, offset 0x26c
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0x82, hi: 0x82},
+	{value: 0x8103, lo: 0x86, hi: 0x86},
+	{value: 0x8133, lo: 0x9e, hi: 0x9e},
+	// Block 0x83, offset 0x270
+	{value: 0x6a23, lo: 0x06},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb9, hi: 0xb9},
+	{value: 0x9900, lo: 0xba, hi: 0xba},
+	{value: 0x2ee7, lo: 0xbb, hi: 0xbb},
+	{value: 0x2edd, lo: 0xbc, hi: 0xbd},
+	{value: 0x2ef1, lo: 0xbe, hi: 0xbe},
+	// Block 0x84, offset 0x277
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x82, hi: 0x82},
+	{value: 0x8103, lo: 0x83, hi: 0x83},
+	// Block 0x85, offset 0x27a
+	{value: 0x0000, lo: 0x05},
+	{value: 0x9900, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb8, hi: 0xb9},
+	{value: 0x2efb, lo: 0xba, hi: 0xba},
+	{value: 0x2f05, lo: 0xbb, hi: 0xbb},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x86, offset 0x280
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0x80, hi: 0x80},
+	// Block 0x87, offset 0x282
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb6, hi: 0xb6},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	// Block 0x88, offset 0x285
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xab, hi: 0xab},
+	// Block 0x89, offset 0x287
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb9, hi: 0xb9},
+	{value: 0x8103, lo: 0xba, hi: 0xba},
+	// Block 0x8a, offset 0x28a
+	{value: 0x0000, lo: 0x04},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb5, hi: 0xb5},
+	{value: 0x2f0f, lo: 0xb8, hi: 0xb8},
+	{value: 0x8105, lo: 0xbd, hi: 0xbe},
+	// Block 0x8b, offset 0x28f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0x83, hi: 0x83},
+	// Block 0x8c, offset 0x291
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xa0, hi: 0xa0},
+	// Block 0x8d, offset 0x293
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xb4, hi: 0xb4},
+	// Block 0x8e, offset 0x295
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x87, hi: 0x87},
+	// Block 0x8f, offset 0x297
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x99, hi: 0x99},
+	// Block 0x90, offset 0x299
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0x82, hi: 0x82},
+	{value: 0x8105, lo: 0x84, hi: 0x85},
+	// Block 0x91, offset 0x29c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x97, hi: 0x97},
+	// Block 0x92, offset 0x29e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x81, hi: 0x82},
+	// Block 0x93, offset 0x2a0
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0xb0, hi: 0xb4},
+	// Block 0x94, offset 0x2a2
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb0, hi: 0xb6},
+	// Block 0x95, offset 0x2a4
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb0, hi: 0xb1},
+	// Block 0x96, offset 0x2a6
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0x9e, hi: 0x9e},
+	// Block 0x97, offset 0x2a8
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x470d, lo: 0x9e, hi: 0x9e},
+	{value: 0x4717, lo: 0x9f, hi: 0x9f},
+	{value: 0x474b, lo: 0xa0, hi: 0xa0},
+	{value: 0x4759, lo: 0xa1, hi: 0xa1},
+	{value: 0x4767, lo: 0xa2, hi: 0xa2},
+	{value: 0x4775, lo: 0xa3, hi: 0xa3},
+	{value: 0x4783, lo: 0xa4, hi: 0xa4},
+	{value: 0x812c, lo: 0xa5, hi: 0xa6},
+	{value: 0x8101, lo: 0xa7, hi: 0xa9},
+	{value: 0x8131, lo: 0xad, hi: 0xad},
+	{value: 0x812c, lo: 0xae, hi: 0xb2},
+	{value: 0x812e, lo: 0xbb, hi: 0xbf},
+	// Block 0x98, offset 0x2b5
+	{value: 0x0000, lo: 0x09},
+	{value: 0x812e, lo: 0x80, hi: 0x82},
+	{value: 0x8133, lo: 0x85, hi: 0x89},
+	{value: 0x812e, lo: 0x8a, hi: 0x8b},
+	{value: 0x8133, lo: 0xaa, hi: 0xad},
+	{value: 0x4721, lo: 0xbb, hi: 0xbb},
+	{value: 0x472b, lo: 0xbc, hi: 0xbc},
+	{value: 0x4791, lo: 0xbd, hi: 0xbd},
+	{value: 0x47ad, lo: 0xbe, hi: 0xbe},
+	{value: 0x479f, lo: 0xbf, hi: 0xbf},
+	// Block 0x99, offset 0x2bf
+	{value: 0x0000, lo: 0x01},
+	{value: 0x47bb, lo: 0x80, hi: 0x80},
+	// Block 0x9a, offset 0x2c1
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x82, hi: 0x84},
+	// Block 0x9b, offset 0x2c3
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8133, lo: 0x80, hi: 0x86},
+	{value: 0x8133, lo: 0x88, hi: 0x98},
+	{value: 0x8133, lo: 0x9b, hi: 0xa1},
+	{value: 0x8133, lo: 0xa3, hi: 0xa4},
+	{value: 0x8133, lo: 0xa6, hi: 0xaa},
+	// Block 0x9c, offset 0x2c9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x8f, hi: 0x8f},
+	// Block 0x9d, offset 0x2cb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xae, hi: 0xae},
+	// Block 0x9e, offset 0x2cd
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xac, hi: 0xaf},
+	// Block 0x9f, offset 0x2cf
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8134, lo: 0xac, hi: 0xad},
+	{value: 0x812e, lo: 0xae, hi: 0xae},
+	{value: 0x8133, lo: 0xaf, hi: 0xaf},
+	// Block 0xa0, offset 0x2d3
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x90, hi: 0x96},
+	// Block 0xa1, offset 0x2d5
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x84, hi: 0x89},
+	{value: 0x8103, lo: 0x8a, hi: 0x8a},
+	// Block 0xa2, offset 0x2d8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8100, lo: 0x93, hi: 0x93},
+}
+
+// lookup returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfkcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfkcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfkcValues[c0]
+	}
+	i := nfkcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// lookupString returns the trie value for the first UTF-8 encoding in s and
+// the width in bytes of this encoding. The size will be 0 if s does not
+// hold enough bytes to complete the encoding. len(s) must be greater than 0.
+func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) {
+	c0 := s[0]
+	switch {
+	case c0 < 0x80: // is ASCII
+		return nfkcValues[c0], 1
+	case c0 < 0xC2:
+		return 0, 1 // Illegal UTF-8: not a starter, not ASCII.
+	case c0 < 0xE0: // 2-byte UTF-8
+		if len(s) < 2 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c1), 2
+	case c0 < 0xF0: // 3-byte UTF-8
+		if len(s) < 3 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c2), 3
+	case c0 < 0xF8: // 4-byte UTF-8
+		if len(s) < 4 {
+			return 0, 0
+		}
+		i := nfkcIndex[c0]
+		c1 := s[1]
+		if c1 < 0x80 || 0xC0 <= c1 {
+			return 0, 1 // Illegal UTF-8: not a continuation byte.
+		}
+		o := uint32(i)<<6 + uint32(c1)
+		i = nfkcIndex[o]
+		c2 := s[2]
+		if c2 < 0x80 || 0xC0 <= c2 {
+			return 0, 2 // Illegal UTF-8: not a continuation byte.
+		}
+		o = uint32(i)<<6 + uint32(c2)
+		i = nfkcIndex[o]
+		c3 := s[3]
+		if c3 < 0x80 || 0xC0 <= c3 {
+			return 0, 3 // Illegal UTF-8: not a continuation byte.
+		}
+		return t.lookupValue(uint32(i), c3), 4
+	}
+	// Illegal rune
+	return 0, 1
+}
+
+// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s.
+// s must start with a full and valid UTF-8 encoded rune.
+func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 {
+	c0 := s[0]
+	if c0 < 0x80 { // is ASCII
+		return nfkcValues[c0]
+	}
+	i := nfkcIndex[c0]
+	if c0 < 0xE0 { // 2-byte UTF-8
+		return t.lookupValue(uint32(i), s[1])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[1])]
+	if c0 < 0xF0 { // 3-byte UTF-8
+		return t.lookupValue(uint32(i), s[2])
+	}
+	i = nfkcIndex[uint32(i)<<6+uint32(s[2])]
+	if c0 < 0xF8 { // 4-byte UTF-8
+		return t.lookupValue(uint32(i), s[3])
+	}
+	return 0
+}
+
+// nfkcTrie. Total size: 19260 bytes (18.81 KiB). Checksum: 1a0bbc4c8c24da49.
+type nfkcTrie struct{}
+
+func newNfkcTrie(i int) *nfkcTrie {
+	return &nfkcTrie{}
+}
+
+// lookupValue determines the type of block n and looks up the value for b.
+func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 {
+	switch {
+	case n < 95:
+		return uint16(nfkcValues[n<<6+uint32(b)])
+	default:
+		n -= 95
+		return uint16(nfkcSparse.lookup(n, b))
+	}
+}
+
+// nfkcValues: 97 blocks, 6208 entries, 12416 bytes
+// The third block is the zero block.
+var nfkcValues = [6208]uint16{
+	// Block 0x0, offset 0x0
+	0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000,
+	// Block 0x1, offset 0x40
+	0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000,
+	0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000,
+	0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000,
+	0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000,
+	0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000,
+	0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000,
+	0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000,
+	0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000,
+	0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000,
+	0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000,
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc0: 0x30b0, 0xc1: 0x30b5, 0xc2: 0x47c9, 0xc3: 0x30ba, 0xc4: 0x47d8, 0xc5: 0x47dd,
+	0xc6: 0xa000, 0xc7: 0x47e7, 0xc8: 0x3123, 0xc9: 0x3128, 0xca: 0x47ec, 0xcb: 0x313c,
+	0xcc: 0x31af, 0xcd: 0x31b4, 0xce: 0x31b9, 0xcf: 0x4800, 0xd1: 0x3245,
+	0xd2: 0x3268, 0xd3: 0x326d, 0xd4: 0x480a, 0xd5: 0x480f, 0xd6: 0x481e,
+	0xd8: 0xa000, 0xd9: 0x32f4, 0xda: 0x32f9, 0xdb: 0x32fe, 0xdc: 0x4850, 0xdd: 0x3376,
+	0xe0: 0x33bc, 0xe1: 0x33c1, 0xe2: 0x485a, 0xe3: 0x33c6,
+	0xe4: 0x4869, 0xe5: 0x486e, 0xe6: 0xa000, 0xe7: 0x4878, 0xe8: 0x342f, 0xe9: 0x3434,
+	0xea: 0x487d, 0xeb: 0x3448, 0xec: 0x34c0, 0xed: 0x34c5, 0xee: 0x34ca, 0xef: 0x4891,
+	0xf1: 0x3556, 0xf2: 0x3579, 0xf3: 0x357e, 0xf4: 0x489b, 0xf5: 0x48a0,
+	0xf6: 0x48af, 0xf8: 0xa000, 0xf9: 0x360a, 0xfa: 0x360f, 0xfb: 0x3614,
+	0xfc: 0x48e1, 0xfd: 0x3691, 0xff: 0x36aa,
+	// Block 0x4, offset 0x100
+	0x100: 0x30bf, 0x101: 0x33cb, 0x102: 0x47ce, 0x103: 0x485f, 0x104: 0x30dd, 0x105: 0x33e9,
+	0x106: 0x30f1, 0x107: 0x33fd, 0x108: 0x30f6, 0x109: 0x3402, 0x10a: 0x30fb, 0x10b: 0x3407,
+	0x10c: 0x3100, 0x10d: 0x340c, 0x10e: 0x310a, 0x10f: 0x3416,
+	0x112: 0x47f1, 0x113: 0x4882, 0x114: 0x3132, 0x115: 0x343e, 0x116: 0x3137, 0x117: 0x3443,
+	0x118: 0x3155, 0x119: 0x3461, 0x11a: 0x3146, 0x11b: 0x3452, 0x11c: 0x316e, 0x11d: 0x347a,
+	0x11e: 0x3178, 0x11f: 0x3484, 0x120: 0x317d, 0x121: 0x3489, 0x122: 0x3187, 0x123: 0x3493,
+	0x124: 0x318c, 0x125: 0x3498, 0x128: 0x31be, 0x129: 0x34cf,
+	0x12a: 0x31c3, 0x12b: 0x34d4, 0x12c: 0x31c8, 0x12d: 0x34d9, 0x12e: 0x31eb, 0x12f: 0x34f7,
+	0x130: 0x31cd, 0x132: 0x1a8a, 0x133: 0x1b17, 0x134: 0x31f5, 0x135: 0x3501,
+	0x136: 0x3209, 0x137: 0x351a, 0x139: 0x3213, 0x13a: 0x3524, 0x13b: 0x321d,
+	0x13c: 0x352e, 0x13d: 0x3218, 0x13e: 0x3529, 0x13f: 0x1cdc,
+	// Block 0x5, offset 0x140
+	0x140: 0x1d64, 0x143: 0x3240, 0x144: 0x3551, 0x145: 0x3259,
+	0x146: 0x356a, 0x147: 0x324f, 0x148: 0x3560, 0x149: 0x1d8c,
+	0x14c: 0x4814, 0x14d: 0x48a5, 0x14e: 0x3272, 0x14f: 0x3583, 0x150: 0x327c, 0x151: 0x358d,
+	0x154: 0x329a, 0x155: 0x35ab, 0x156: 0x32b3, 0x157: 0x35c4,
+	0x158: 0x32a4, 0x159: 0x35b5, 0x15a: 0x4837, 0x15b: 0x48c8, 0x15c: 0x32bd, 0x15d: 0x35ce,
+	0x15e: 0x32cc, 0x15f: 0x35dd, 0x160: 0x483c, 0x161: 0x48cd, 0x162: 0x32e5, 0x163: 0x35fb,
+	0x164: 0x32d6, 0x165: 0x35ec, 0x168: 0x4846, 0x169: 0x48d7,
+	0x16a: 0x484b, 0x16b: 0x48dc, 0x16c: 0x3303, 0x16d: 0x3619, 0x16e: 0x330d, 0x16f: 0x3623,
+	0x170: 0x3312, 0x171: 0x3628, 0x172: 0x3330, 0x173: 0x3646, 0x174: 0x3353, 0x175: 0x3669,
+	0x176: 0x337b, 0x177: 0x3696, 0x178: 0x338f, 0x179: 0x339e, 0x17a: 0x36be, 0x17b: 0x33a8,
+	0x17c: 0x36c8, 0x17d: 0x33ad, 0x17e: 0x36cd, 0x17f: 0x00a7,
+	// Block 0x6, offset 0x180
+	0x184: 0x2f2f, 0x185: 0x2f35,
+	0x186: 0x2f3b, 0x187: 0x1a9f, 0x188: 0x1aa2, 0x189: 0x1b38, 0x18a: 0x1ab7, 0x18b: 0x1aba,
+	0x18c: 0x1b6e, 0x18d: 0x30c9, 0x18e: 0x33d5, 0x18f: 0x31d7, 0x190: 0x34e3, 0x191: 0x3281,
+	0x192: 0x3592, 0x193: 0x3317, 0x194: 0x362d, 0x195: 0x3b10, 0x196: 0x3c9f, 0x197: 0x3b09,
+	0x198: 0x3c98, 0x199: 0x3b17, 0x19a: 0x3ca6, 0x19b: 0x3b02, 0x19c: 0x3c91,
+	0x19e: 0x39f1, 0x19f: 0x3b80, 0x1a0: 0x39ea, 0x1a1: 0x3b79, 0x1a2: 0x36f4, 0x1a3: 0x3706,
+	0x1a6: 0x3182, 0x1a7: 0x348e, 0x1a8: 0x31ff, 0x1a9: 0x3510,
+	0x1aa: 0x482d, 0x1ab: 0x48be, 0x1ac: 0x3ad1, 0x1ad: 0x3c60, 0x1ae: 0x3718, 0x1af: 0x371e,
+	0x1b0: 0x3506, 0x1b1: 0x1a6f, 0x1b2: 0x1a72, 0x1b3: 0x1aff, 0x1b4: 0x3169, 0x1b5: 0x3475,
+	0x1b8: 0x323b, 0x1b9: 0x354c, 0x1ba: 0x39f8, 0x1bb: 0x3b87,
+	0x1bc: 0x36ee, 0x1bd: 0x3700, 0x1be: 0x36fa, 0x1bf: 0x370c,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0x30ce, 0x1c1: 0x33da, 0x1c2: 0x30d3, 0x1c3: 0x33df, 0x1c4: 0x314b, 0x1c5: 0x3457,
+	0x1c6: 0x3150, 0x1c7: 0x345c, 0x1c8: 0x31dc, 0x1c9: 0x34e8, 0x1ca: 0x31e1, 0x1cb: 0x34ed,
+	0x1cc: 0x3286, 0x1cd: 0x3597, 0x1ce: 0x328b, 0x1cf: 0x359c, 0x1d0: 0x32a9, 0x1d1: 0x35ba,
+	0x1d2: 0x32ae, 0x1d3: 0x35bf, 0x1d4: 0x331c, 0x1d5: 0x3632, 0x1d6: 0x3321, 0x1d7: 0x3637,
+	0x1d8: 0x32c7, 0x1d9: 0x35d8, 0x1da: 0x32e0, 0x1db: 0x35f6,
+	0x1de: 0x319b, 0x1df: 0x34a7,
+	0x1e6: 0x47d3, 0x1e7: 0x4864, 0x1e8: 0x47fb, 0x1e9: 0x488c,
+	0x1ea: 0x3aa0, 0x1eb: 0x3c2f, 0x1ec: 0x3a7d, 0x1ed: 0x3c0c, 0x1ee: 0x4819, 0x1ef: 0x48aa,
+	0x1f0: 0x3a99, 0x1f1: 0x3c28, 0x1f2: 0x3385, 0x1f3: 0x36a0,
+	// Block 0x8, offset 0x200
+	0x200: 0x9933, 0x201: 0x9933, 0x202: 0x9933, 0x203: 0x9933, 0x204: 0x9933, 0x205: 0x8133,
+	0x206: 0x9933, 0x207: 0x9933, 0x208: 0x9933, 0x209: 0x9933, 0x20a: 0x9933, 0x20b: 0x9933,
+	0x20c: 0x9933, 0x20d: 0x8133, 0x20e: 0x8133, 0x20f: 0x9933, 0x210: 0x8133, 0x211: 0x9933,
+	0x212: 0x8133, 0x213: 0x9933, 0x214: 0x9933, 0x215: 0x8134, 0x216: 0x812e, 0x217: 0x812e,
+	0x218: 0x812e, 0x219: 0x812e, 0x21a: 0x8134, 0x21b: 0x992c, 0x21c: 0x812e, 0x21d: 0x812e,
+	0x21e: 0x812e, 0x21f: 0x812e, 0x220: 0x812e, 0x221: 0x812a, 0x222: 0x812a, 0x223: 0x992e,
+	0x224: 0x992e, 0x225: 0x992e, 0x226: 0x992e, 0x227: 0x992a, 0x228: 0x992a, 0x229: 0x812e,
+	0x22a: 0x812e, 0x22b: 0x812e, 0x22c: 0x812e, 0x22d: 0x992e, 0x22e: 0x992e, 0x22f: 0x812e,
+	0x230: 0x992e, 0x231: 0x992e, 0x232: 0x812e, 0x233: 0x812e, 0x234: 0x8101, 0x235: 0x8101,
+	0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812e, 0x23a: 0x812e, 0x23b: 0x812e,
+	0x23c: 0x812e, 0x23d: 0x8133, 0x23e: 0x8133, 0x23f: 0x8133,
+	// Block 0x9, offset 0x240
+	0x240: 0x4aef, 0x241: 0x4af4, 0x242: 0x9933, 0x243: 0x4af9, 0x244: 0x4bb2, 0x245: 0x9937,
+	0x246: 0x8133, 0x247: 0x812e, 0x248: 0x812e, 0x249: 0x812e, 0x24a: 0x8133, 0x24b: 0x8133,
+	0x24c: 0x8133, 0x24d: 0x812e, 0x24e: 0x812e, 0x250: 0x8133, 0x251: 0x8133,
+	0x252: 0x8133, 0x253: 0x812e, 0x254: 0x812e, 0x255: 0x812e, 0x256: 0x812e, 0x257: 0x8133,
+	0x258: 0x8134, 0x259: 0x812e, 0x25a: 0x812e, 0x25b: 0x8133, 0x25c: 0x8135, 0x25d: 0x8136,
+	0x25e: 0x8136, 0x25f: 0x8135, 0x260: 0x8136, 0x261: 0x8136, 0x262: 0x8135, 0x263: 0x8133,
+	0x264: 0x8133, 0x265: 0x8133, 0x266: 0x8133, 0x267: 0x8133, 0x268: 0x8133, 0x269: 0x8133,
+	0x26a: 0x8133, 0x26b: 0x8133, 0x26c: 0x8133, 0x26d: 0x8133, 0x26e: 0x8133, 0x26f: 0x8133,
+	0x274: 0x01ee,
+	0x27a: 0x43e6,
+	0x27e: 0x0037,
+	// Block 0xa, offset 0x280
+	0x284: 0x439b, 0x285: 0x45bc,
+	0x286: 0x372a, 0x287: 0x00ce, 0x288: 0x3748, 0x289: 0x3754, 0x28a: 0x3766,
+	0x28c: 0x3784, 0x28e: 0x3796, 0x28f: 0x37b4, 0x290: 0x3f49, 0x291: 0xa000,
+	0x295: 0xa000, 0x297: 0xa000,
+	0x299: 0xa000,
+	0x29f: 0xa000, 0x2a1: 0xa000,
+	0x2a5: 0xa000, 0x2a9: 0xa000,
+	0x2aa: 0x3778, 0x2ab: 0x37a8, 0x2ac: 0x493f, 0x2ad: 0x37d8, 0x2ae: 0x4969, 0x2af: 0x37ea,
+	0x2b0: 0x3fb1, 0x2b1: 0xa000, 0x2b5: 0xa000,
+	0x2b7: 0xa000, 0x2b9: 0xa000,
+	0x2bf: 0xa000,
+	// Block 0xb, offset 0x2c0
+	0x2c1: 0xa000, 0x2c5: 0xa000,
+	0x2c9: 0xa000, 0x2ca: 0x4981, 0x2cb: 0x499f,
+	0x2cc: 0x3808, 0x2cd: 0x3820, 0x2ce: 0x49b7, 0x2d0: 0x0242, 0x2d1: 0x0254,
+	0x2d2: 0x0230, 0x2d3: 0x444d, 0x2d4: 0x4453, 0x2d5: 0x027e, 0x2d6: 0x026c,
+	0x2f0: 0x025a, 0x2f1: 0x026f, 0x2f2: 0x0272, 0x2f4: 0x020c, 0x2f5: 0x024b,
+	0x2f9: 0x022a,
+	// Block 0xc, offset 0x300
+	0x300: 0x3862, 0x301: 0x386e, 0x303: 0x385c,
+	0x306: 0xa000, 0x307: 0x384a,
+	0x30c: 0x389e, 0x30d: 0x3886, 0x30e: 0x38b0, 0x310: 0xa000,
+	0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000,
+	0x318: 0xa000, 0x319: 0x3892, 0x31a: 0xa000,
+	0x31e: 0xa000, 0x323: 0xa000,
+	0x327: 0xa000,
+	0x32b: 0xa000, 0x32d: 0xa000,
+	0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000,
+	0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x3916, 0x33a: 0xa000,
+	0x33e: 0xa000,
+	// Block 0xd, offset 0x340
+	0x341: 0x3874, 0x342: 0x38f8,
+	0x350: 0x3850, 0x351: 0x38d4,
+	0x352: 0x3856, 0x353: 0x38da, 0x356: 0x3868, 0x357: 0x38ec,
+	0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x396a, 0x35b: 0x3970, 0x35c: 0x387a, 0x35d: 0x38fe,
+	0x35e: 0x3880, 0x35f: 0x3904, 0x362: 0x388c, 0x363: 0x3910,
+	0x364: 0x3898, 0x365: 0x391c, 0x366: 0x38a4, 0x367: 0x3928, 0x368: 0xa000, 0x369: 0xa000,
+	0x36a: 0x3976, 0x36b: 0x397c, 0x36c: 0x38ce, 0x36d: 0x3952, 0x36e: 0x38aa, 0x36f: 0x392e,
+	0x370: 0x38b6, 0x371: 0x393a, 0x372: 0x38bc, 0x373: 0x3940, 0x374: 0x38c2, 0x375: 0x3946,
+	0x378: 0x38c8, 0x379: 0x394c,
+	// Block 0xe, offset 0x380
+	0x387: 0x1e91,
+	0x391: 0x812e,
+	0x392: 0x8133, 0x393: 0x8133, 0x394: 0x8133, 0x395: 0x8133, 0x396: 0x812e, 0x397: 0x8133,
+	0x398: 0x8133, 0x399: 0x8133, 0x39a: 0x812f, 0x39b: 0x812e, 0x39c: 0x8133, 0x39d: 0x8133,
+	0x39e: 0x8133, 0x39f: 0x8133, 0x3a0: 0x8133, 0x3a1: 0x8133, 0x3a2: 0x812e, 0x3a3: 0x812e,
+	0x3a4: 0x812e, 0x3a5: 0x812e, 0x3a6: 0x812e, 0x3a7: 0x812e, 0x3a8: 0x8133, 0x3a9: 0x8133,
+	0x3aa: 0x812e, 0x3ab: 0x8133, 0x3ac: 0x8133, 0x3ad: 0x812f, 0x3ae: 0x8132, 0x3af: 0x8133,
+	0x3b0: 0x8106, 0x3b1: 0x8107, 0x3b2: 0x8108, 0x3b3: 0x8109, 0x3b4: 0x810a, 0x3b5: 0x810b,
+	0x3b6: 0x810c, 0x3b7: 0x810d, 0x3b8: 0x810e, 0x3b9: 0x810f, 0x3ba: 0x810f, 0x3bb: 0x8110,
+	0x3bc: 0x8111, 0x3bd: 0x8112, 0x3bf: 0x8113,
+	// Block 0xf, offset 0x3c0
+	0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8117,
+	0x3cc: 0x8118, 0x3cd: 0x8119, 0x3ce: 0x811a, 0x3cf: 0x811b, 0x3d0: 0x811c, 0x3d1: 0x811d,
+	0x3d2: 0x811e, 0x3d3: 0x9933, 0x3d4: 0x9933, 0x3d5: 0x992e, 0x3d6: 0x812e, 0x3d7: 0x8133,
+	0x3d8: 0x8133, 0x3d9: 0x8133, 0x3da: 0x8133, 0x3db: 0x8133, 0x3dc: 0x812e, 0x3dd: 0x8133,
+	0x3de: 0x8133, 0x3df: 0x812e,
+	0x3f0: 0x811f, 0x3f5: 0x1eb4,
+	0x3f6: 0x2143, 0x3f7: 0x217f, 0x3f8: 0x217a,
+	// Block 0x10, offset 0x400
+	0x40a: 0x8133, 0x40b: 0x8133,
+	0x40c: 0x8133, 0x40d: 0x8133, 0x40e: 0x8133, 0x40f: 0x812e, 0x410: 0x812e, 0x411: 0x812e,
+	0x412: 0x812e, 0x413: 0x812e, 0x414: 0x8133, 0x415: 0x8133, 0x416: 0x8133, 0x417: 0x8133,
+	0x418: 0x8133, 0x419: 0x8133, 0x41a: 0x8133, 0x41b: 0x8133, 0x41c: 0x8133, 0x41d: 0x8133,
+	0x41e: 0x8133, 0x41f: 0x8133, 0x420: 0x8133, 0x421: 0x8133, 0x423: 0x812e,
+	0x424: 0x8133, 0x425: 0x8133, 0x426: 0x812e, 0x427: 0x8133, 0x428: 0x8133, 0x429: 0x812e,
+	0x42a: 0x8133, 0x42b: 0x8133, 0x42c: 0x8133, 0x42d: 0x812e, 0x42e: 0x812e, 0x42f: 0x812e,
+	0x430: 0x8117, 0x431: 0x8118, 0x432: 0x8119, 0x433: 0x8133, 0x434: 0x8133, 0x435: 0x8133,
+	0x436: 0x812e, 0x437: 0x8133, 0x438: 0x8133, 0x439: 0x812e, 0x43a: 0x812e, 0x43b: 0x8133,
+	0x43c: 0x8133, 0x43d: 0x8133, 0x43e: 0x8133, 0x43f: 0x8133,
+	// Block 0x11, offset 0x440
+	0x445: 0xa000,
+	0x446: 0x2e5d, 0x447: 0xa000, 0x448: 0x2e65, 0x449: 0xa000, 0x44a: 0x2e6d, 0x44b: 0xa000,
+	0x44c: 0x2e75, 0x44d: 0xa000, 0x44e: 0x2e7d, 0x451: 0xa000,
+	0x452: 0x2e85,
+	0x474: 0x8103, 0x475: 0x9900,
+	0x47a: 0xa000, 0x47b: 0x2e8d,
+	0x47c: 0xa000, 0x47d: 0x2e95, 0x47e: 0xa000, 0x47f: 0xa000,
+	// Block 0x12, offset 0x480
+	0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x0104, 0x485: 0x0107,
+	0x486: 0x0506, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x011f, 0x48b: 0x0122,
+	0x48c: 0x0125, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e6,
+	0x492: 0x009f, 0x493: 0x0110, 0x494: 0x050a, 0x495: 0x050e, 0x496: 0x00a1, 0x497: 0x00a9,
+	0x498: 0x00ab, 0x499: 0x0516, 0x49a: 0x015b, 0x49b: 0x00ad, 0x49c: 0x051a, 0x49d: 0x0242,
+	0x49e: 0x0245, 0x49f: 0x0248, 0x4a0: 0x027e, 0x4a1: 0x0281, 0x4a2: 0x0093, 0x4a3: 0x00a5,
+	0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x0242, 0x4a7: 0x0245, 0x4a8: 0x026f, 0x4a9: 0x027e,
+	0x4aa: 0x0281,
+	0x4b8: 0x02b4,
+	// Block 0x13, offset 0x4c0
+	0x4db: 0x010a, 0x4dc: 0x0087, 0x4dd: 0x0113,
+	0x4de: 0x00d7, 0x4df: 0x0125, 0x4e0: 0x008d, 0x4e1: 0x012b, 0x4e2: 0x0131, 0x4e3: 0x013d,
+	0x4e4: 0x0146, 0x4e5: 0x0149, 0x4e6: 0x014c, 0x4e7: 0x051e, 0x4e8: 0x01c7, 0x4e9: 0x0155,
+	0x4ea: 0x0522, 0x4eb: 0x01ca, 0x4ec: 0x0161, 0x4ed: 0x015e, 0x4ee: 0x0164, 0x4ef: 0x0167,
+	0x4f0: 0x016a, 0x4f1: 0x016d, 0x4f2: 0x0176, 0x4f3: 0x018e, 0x4f4: 0x0191, 0x4f5: 0x00f2,
+	0x4f6: 0x019a, 0x4f7: 0x019d, 0x4f8: 0x0512, 0x4f9: 0x01a0, 0x4fa: 0x01a3, 0x4fb: 0x00b5,
+	0x4fc: 0x01af, 0x4fd: 0x01b2, 0x4fe: 0x01b5, 0x4ff: 0x0254,
+	// Block 0x14, offset 0x500
+	0x500: 0x8133, 0x501: 0x8133, 0x502: 0x812e, 0x503: 0x8133, 0x504: 0x8133, 0x505: 0x8133,
+	0x506: 0x8133, 0x507: 0x8133, 0x508: 0x8133, 0x509: 0x8133, 0x50a: 0x812e, 0x50b: 0x8133,
+	0x50c: 0x8133, 0x50d: 0x8136, 0x50e: 0x812b, 0x50f: 0x812e, 0x510: 0x812a, 0x511: 0x8133,
+	0x512: 0x8133, 0x513: 0x8133, 0x514: 0x8133, 0x515: 0x8133, 0x516: 0x8133, 0x517: 0x8133,
+	0x518: 0x8133, 0x519: 0x8133, 0x51a: 0x8133, 0x51b: 0x8133, 0x51c: 0x8133, 0x51d: 0x8133,
+	0x51e: 0x8133, 0x51f: 0x8133, 0x520: 0x8133, 0x521: 0x8133, 0x522: 0x8133, 0x523: 0x8133,
+	0x524: 0x8133, 0x525: 0x8133, 0x526: 0x8133, 0x527: 0x8133, 0x528: 0x8133, 0x529: 0x8133,
+	0x52a: 0x8133, 0x52b: 0x8133, 0x52c: 0x8133, 0x52d: 0x8133, 0x52e: 0x8133, 0x52f: 0x8133,
+	0x530: 0x8133, 0x531: 0x8133, 0x532: 0x8133, 0x533: 0x8133, 0x534: 0x8133, 0x535: 0x8133,
+	0x536: 0x8134, 0x537: 0x8132, 0x538: 0x8132, 0x539: 0x812e, 0x53a: 0x812d, 0x53b: 0x8133,
+	0x53c: 0x8135, 0x53d: 0x812e, 0x53e: 0x8133, 0x53f: 0x812e,
+	// Block 0x15, offset 0x540
+	0x540: 0x30d8, 0x541: 0x33e4, 0x542: 0x30e2, 0x543: 0x33ee, 0x544: 0x30e7, 0x545: 0x33f3,
+	0x546: 0x30ec, 0x547: 0x33f8, 0x548: 0x3a0d, 0x549: 0x3b9c, 0x54a: 0x3105, 0x54b: 0x3411,
+	0x54c: 0x310f, 0x54d: 0x341b, 0x54e: 0x311e, 0x54f: 0x342a, 0x550: 0x3114, 0x551: 0x3420,
+	0x552: 0x3119, 0x553: 0x3425, 0x554: 0x3a30, 0x555: 0x3bbf, 0x556: 0x3a37, 0x557: 0x3bc6,
+	0x558: 0x315a, 0x559: 0x3466, 0x55a: 0x315f, 0x55b: 0x346b, 0x55c: 0x3a45, 0x55d: 0x3bd4,
+	0x55e: 0x3164, 0x55f: 0x3470, 0x560: 0x3173, 0x561: 0x347f, 0x562: 0x3191, 0x563: 0x349d,
+	0x564: 0x31a0, 0x565: 0x34ac, 0x566: 0x3196, 0x567: 0x34a2, 0x568: 0x31a5, 0x569: 0x34b1,
+	0x56a: 0x31aa, 0x56b: 0x34b6, 0x56c: 0x31f0, 0x56d: 0x34fc, 0x56e: 0x3a4c, 0x56f: 0x3bdb,
+	0x570: 0x31fa, 0x571: 0x350b, 0x572: 0x3204, 0x573: 0x3515, 0x574: 0x320e, 0x575: 0x351f,
+	0x576: 0x4805, 0x577: 0x4896, 0x578: 0x3a53, 0x579: 0x3be2, 0x57a: 0x3227, 0x57b: 0x3538,
+	0x57c: 0x3222, 0x57d: 0x3533, 0x57e: 0x322c, 0x57f: 0x353d,
+	// Block 0x16, offset 0x580
+	0x580: 0x3231, 0x581: 0x3542, 0x582: 0x3236, 0x583: 0x3547, 0x584: 0x324a, 0x585: 0x355b,
+	0x586: 0x3254, 0x587: 0x3565, 0x588: 0x3263, 0x589: 0x3574, 0x58a: 0x325e, 0x58b: 0x356f,
+	0x58c: 0x3a76, 0x58d: 0x3c05, 0x58e: 0x3a84, 0x58f: 0x3c13, 0x590: 0x3a8b, 0x591: 0x3c1a,
+	0x592: 0x3a92, 0x593: 0x3c21, 0x594: 0x3290, 0x595: 0x35a1, 0x596: 0x3295, 0x597: 0x35a6,
+	0x598: 0x329f, 0x599: 0x35b0, 0x59a: 0x4832, 0x59b: 0x48c3, 0x59c: 0x3ad8, 0x59d: 0x3c67,
+	0x59e: 0x32b8, 0x59f: 0x35c9, 0x5a0: 0x32c2, 0x5a1: 0x35d3, 0x5a2: 0x4841, 0x5a3: 0x48d2,
+	0x5a4: 0x3adf, 0x5a5: 0x3c6e, 0x5a6: 0x3ae6, 0x5a7: 0x3c75, 0x5a8: 0x3aed, 0x5a9: 0x3c7c,
+	0x5aa: 0x32d1, 0x5ab: 0x35e2, 0x5ac: 0x32db, 0x5ad: 0x35f1, 0x5ae: 0x32ef, 0x5af: 0x3605,
+	0x5b0: 0x32ea, 0x5b1: 0x3600, 0x5b2: 0x332b, 0x5b3: 0x3641, 0x5b4: 0x333a, 0x5b5: 0x3650,
+	0x5b6: 0x3335, 0x5b7: 0x364b, 0x5b8: 0x3af4, 0x5b9: 0x3c83, 0x5ba: 0x3afb, 0x5bb: 0x3c8a,
+	0x5bc: 0x333f, 0x5bd: 0x3655, 0x5be: 0x3344, 0x5bf: 0x365a,
+	// Block 0x17, offset 0x5c0
+	0x5c0: 0x3349, 0x5c1: 0x365f, 0x5c2: 0x334e, 0x5c3: 0x3664, 0x5c4: 0x335d, 0x5c5: 0x3673,
+	0x5c6: 0x3358, 0x5c7: 0x366e, 0x5c8: 0x3362, 0x5c9: 0x367d, 0x5ca: 0x3367, 0x5cb: 0x3682,
+	0x5cc: 0x336c, 0x5cd: 0x3687, 0x5ce: 0x338a, 0x5cf: 0x36a5, 0x5d0: 0x33a3, 0x5d1: 0x36c3,
+	0x5d2: 0x33b2, 0x5d3: 0x36d2, 0x5d4: 0x33b7, 0x5d5: 0x36d7, 0x5d6: 0x34bb, 0x5d7: 0x35e7,
+	0x5d8: 0x3678, 0x5d9: 0x36b4, 0x5da: 0x1d10, 0x5db: 0x4418,
+	0x5e0: 0x47e2, 0x5e1: 0x4873, 0x5e2: 0x30c4, 0x5e3: 0x33d0,
+	0x5e4: 0x39b9, 0x5e5: 0x3b48, 0x5e6: 0x39b2, 0x5e7: 0x3b41, 0x5e8: 0x39c7, 0x5e9: 0x3b56,
+	0x5ea: 0x39c0, 0x5eb: 0x3b4f, 0x5ec: 0x39ff, 0x5ed: 0x3b8e, 0x5ee: 0x39d5, 0x5ef: 0x3b64,
+	0x5f0: 0x39ce, 0x5f1: 0x3b5d, 0x5f2: 0x39e3, 0x5f3: 0x3b72, 0x5f4: 0x39dc, 0x5f5: 0x3b6b,
+	0x5f6: 0x3a06, 0x5f7: 0x3b95, 0x5f8: 0x47f6, 0x5f9: 0x4887, 0x5fa: 0x3141, 0x5fb: 0x344d,
+	0x5fc: 0x312d, 0x5fd: 0x3439, 0x5fe: 0x3a1b, 0x5ff: 0x3baa,
+	// Block 0x18, offset 0x600
+	0x600: 0x3a14, 0x601: 0x3ba3, 0x602: 0x3a29, 0x603: 0x3bb8, 0x604: 0x3a22, 0x605: 0x3bb1,
+	0x606: 0x3a3e, 0x607: 0x3bcd, 0x608: 0x31d2, 0x609: 0x34de, 0x60a: 0x31e6, 0x60b: 0x34f2,
+	0x60c: 0x4828, 0x60d: 0x48b9, 0x60e: 0x3277, 0x60f: 0x3588, 0x610: 0x3a61, 0x611: 0x3bf0,
+	0x612: 0x3a5a, 0x613: 0x3be9, 0x614: 0x3a6f, 0x615: 0x3bfe, 0x616: 0x3a68, 0x617: 0x3bf7,
+	0x618: 0x3aca, 0x619: 0x3c59, 0x61a: 0x3aae, 0x61b: 0x3c3d, 0x61c: 0x3aa7, 0x61d: 0x3c36,
+	0x61e: 0x3abc, 0x61f: 0x3c4b, 0x620: 0x3ab5, 0x621: 0x3c44, 0x622: 0x3ac3, 0x623: 0x3c52,
+	0x624: 0x3326, 0x625: 0x363c, 0x626: 0x3308, 0x627: 0x361e, 0x628: 0x3b25, 0x629: 0x3cb4,
+	0x62a: 0x3b1e, 0x62b: 0x3cad, 0x62c: 0x3b33, 0x62d: 0x3cc2, 0x62e: 0x3b2c, 0x62f: 0x3cbb,
+	0x630: 0x3b3a, 0x631: 0x3cc9, 0x632: 0x3371, 0x633: 0x368c, 0x634: 0x3399, 0x635: 0x36b9,
+	0x636: 0x3394, 0x637: 0x36af, 0x638: 0x3380, 0x639: 0x369b,
+	// Block 0x19, offset 0x640
+	0x640: 0x4945, 0x641: 0x494b, 0x642: 0x4a5f, 0x643: 0x4a77, 0x644: 0x4a67, 0x645: 0x4a7f,
+	0x646: 0x4a6f, 0x647: 0x4a87, 0x648: 0x48eb, 0x649: 0x48f1, 0x64a: 0x49cf, 0x64b: 0x49e7,
+	0x64c: 0x49d7, 0x64d: 0x49ef, 0x64e: 0x49df, 0x64f: 0x49f7, 0x650: 0x4957, 0x651: 0x495d,
+	0x652: 0x3ef9, 0x653: 0x3f09, 0x654: 0x3f01, 0x655: 0x3f11,
+	0x658: 0x48f7, 0x659: 0x48fd, 0x65a: 0x3e29, 0x65b: 0x3e39, 0x65c: 0x3e31, 0x65d: 0x3e41,
+	0x660: 0x496f, 0x661: 0x4975, 0x662: 0x4a8f, 0x663: 0x4aa7,
+	0x664: 0x4a97, 0x665: 0x4aaf, 0x666: 0x4a9f, 0x667: 0x4ab7, 0x668: 0x4903, 0x669: 0x4909,
+	0x66a: 0x49ff, 0x66b: 0x4a17, 0x66c: 0x4a07, 0x66d: 0x4a1f, 0x66e: 0x4a0f, 0x66f: 0x4a27,
+	0x670: 0x4987, 0x671: 0x498d, 0x672: 0x3f59, 0x673: 0x3f71, 0x674: 0x3f61, 0x675: 0x3f79,
+	0x676: 0x3f69, 0x677: 0x3f81, 0x678: 0x490f, 0x679: 0x4915, 0x67a: 0x3e59, 0x67b: 0x3e71,
+	0x67c: 0x3e61, 0x67d: 0x3e79, 0x67e: 0x3e69, 0x67f: 0x3e81,
+	// Block 0x1a, offset 0x680
+	0x680: 0x4993, 0x681: 0x4999, 0x682: 0x3f89, 0x683: 0x3f99, 0x684: 0x3f91, 0x685: 0x3fa1,
+	0x688: 0x491b, 0x689: 0x4921, 0x68a: 0x3e89, 0x68b: 0x3e99,
+	0x68c: 0x3e91, 0x68d: 0x3ea1, 0x690: 0x49a5, 0x691: 0x49ab,
+	0x692: 0x3fc1, 0x693: 0x3fd9, 0x694: 0x3fc9, 0x695: 0x3fe1, 0x696: 0x3fd1, 0x697: 0x3fe9,
+	0x699: 0x4927, 0x69b: 0x3ea9, 0x69d: 0x3eb1,
+	0x69f: 0x3eb9, 0x6a0: 0x49bd, 0x6a1: 0x49c3, 0x6a2: 0x4abf, 0x6a3: 0x4ad7,
+	0x6a4: 0x4ac7, 0x6a5: 0x4adf, 0x6a6: 0x4acf, 0x6a7: 0x4ae7, 0x6a8: 0x492d, 0x6a9: 0x4933,
+	0x6aa: 0x4a2f, 0x6ab: 0x4a47, 0x6ac: 0x4a37, 0x6ad: 0x4a4f, 0x6ae: 0x4a3f, 0x6af: 0x4a57,
+	0x6b0: 0x4939, 0x6b1: 0x445f, 0x6b2: 0x37d2, 0x6b3: 0x4465, 0x6b4: 0x4963, 0x6b5: 0x446b,
+	0x6b6: 0x37e4, 0x6b7: 0x4471, 0x6b8: 0x3802, 0x6b9: 0x4477, 0x6ba: 0x381a, 0x6bb: 0x447d,
+	0x6bc: 0x49b1, 0x6bd: 0x4483,
+	// Block 0x1b, offset 0x6c0
+	0x6c0: 0x3ee1, 0x6c1: 0x3ee9, 0x6c2: 0x42c5, 0x6c3: 0x42e3, 0x6c4: 0x42cf, 0x6c5: 0x42ed,
+	0x6c6: 0x42d9, 0x6c7: 0x42f7, 0x6c8: 0x3e19, 0x6c9: 0x3e21, 0x6ca: 0x4211, 0x6cb: 0x422f,
+	0x6cc: 0x421b, 0x6cd: 0x4239, 0x6ce: 0x4225, 0x6cf: 0x4243, 0x6d0: 0x3f29, 0x6d1: 0x3f31,
+	0x6d2: 0x4301, 0x6d3: 0x431f, 0x6d4: 0x430b, 0x6d5: 0x4329, 0x6d6: 0x4315, 0x6d7: 0x4333,
+	0x6d8: 0x3e49, 0x6d9: 0x3e51, 0x6da: 0x424d, 0x6db: 0x426b, 0x6dc: 0x4257, 0x6dd: 0x4275,
+	0x6de: 0x4261, 0x6df: 0x427f, 0x6e0: 0x4001, 0x6e1: 0x4009, 0x6e2: 0x433d, 0x6e3: 0x435b,
+	0x6e4: 0x4347, 0x6e5: 0x4365, 0x6e6: 0x4351, 0x6e7: 0x436f, 0x6e8: 0x3ec1, 0x6e9: 0x3ec9,
+	0x6ea: 0x4289, 0x6eb: 0x42a7, 0x6ec: 0x4293, 0x6ed: 0x42b1, 0x6ee: 0x429d, 0x6ef: 0x42bb,
+	0x6f0: 0x37c6, 0x6f1: 0x37c0, 0x6f2: 0x3ed1, 0x6f3: 0x37cc, 0x6f4: 0x3ed9,
+	0x6f6: 0x4951, 0x6f7: 0x3ef1, 0x6f8: 0x3736, 0x6f9: 0x3730, 0x6fa: 0x3724, 0x6fb: 0x442f,
+	0x6fc: 0x373c, 0x6fd: 0x43c8, 0x6fe: 0x0257, 0x6ff: 0x43c8,
+	// Block 0x1c, offset 0x700
+	0x700: 0x43e1, 0x701: 0x45c3, 0x702: 0x3f19, 0x703: 0x37de, 0x704: 0x3f21,
+	0x706: 0x497b, 0x707: 0x3f39, 0x708: 0x3742, 0x709: 0x4435, 0x70a: 0x374e, 0x70b: 0x443b,
+	0x70c: 0x375a, 0x70d: 0x45ca, 0x70e: 0x45d1, 0x70f: 0x45d8, 0x710: 0x37f6, 0x711: 0x37f0,
+	0x712: 0x3f41, 0x713: 0x4625, 0x716: 0x37fc, 0x717: 0x3f51,
+	0x718: 0x3772, 0x719: 0x376c, 0x71a: 0x3760, 0x71b: 0x4441, 0x71d: 0x45df,
+	0x71e: 0x45e6, 0x71f: 0x45ed, 0x720: 0x382c, 0x721: 0x3826, 0x722: 0x3fa9, 0x723: 0x462d,
+	0x724: 0x380e, 0x725: 0x3814, 0x726: 0x3832, 0x727: 0x3fb9, 0x728: 0x37a2, 0x729: 0x379c,
+	0x72a: 0x3790, 0x72b: 0x444d, 0x72c: 0x378a, 0x72d: 0x45b5, 0x72e: 0x45bc, 0x72f: 0x0081,
+	0x732: 0x3ff1, 0x733: 0x3838, 0x734: 0x3ff9,
+	0x736: 0x49c9, 0x737: 0x4011, 0x738: 0x377e, 0x739: 0x4447, 0x73a: 0x37ae, 0x73b: 0x4459,
+	0x73c: 0x37ba, 0x73d: 0x439b, 0x73e: 0x43cd,
+	// Block 0x1d, offset 0x740
+	0x740: 0x1d08, 0x741: 0x1d0c, 0x742: 0x0047, 0x743: 0x1d84, 0x745: 0x1d18,
+	0x746: 0x1d1c, 0x747: 0x00ef, 0x749: 0x1d88, 0x74a: 0x008f, 0x74b: 0x0051,
+	0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00e0, 0x750: 0x0053, 0x751: 0x0053,
+	0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x1abd,
+	0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065,
+	0x760: 0x1acf, 0x761: 0x1cf8, 0x762: 0x1ad8,
+	0x764: 0x0075, 0x766: 0x023c, 0x768: 0x0075,
+	0x76a: 0x0057, 0x76b: 0x4413, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b,
+	0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0308,
+	0x776: 0x030b, 0x777: 0x030e, 0x778: 0x0311, 0x779: 0x0093, 0x77b: 0x1cc8,
+	0x77c: 0x026c, 0x77d: 0x0245, 0x77e: 0x01fd, 0x77f: 0x0224,
+	// Block 0x1e, offset 0x780
+	0x780: 0x055a, 0x785: 0x0049,
+	0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095,
+	0x790: 0x235e, 0x791: 0x236a,
+	0x792: 0x241e, 0x793: 0x2346, 0x794: 0x23ca, 0x795: 0x2352, 0x796: 0x23d0, 0x797: 0x23e8,
+	0x798: 0x23f4, 0x799: 0x2358, 0x79a: 0x23fa, 0x79b: 0x2364, 0x79c: 0x23ee, 0x79d: 0x2400,
+	0x79e: 0x2406, 0x79f: 0x1dec, 0x7a0: 0x0053, 0x7a1: 0x1a87, 0x7a2: 0x1cd4, 0x7a3: 0x1a90,
+	0x7a4: 0x006d, 0x7a5: 0x1adb, 0x7a6: 0x1d00, 0x7a7: 0x1e78, 0x7a8: 0x1a93, 0x7a9: 0x0071,
+	0x7aa: 0x1ae7, 0x7ab: 0x1d04, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b,
+	0x7b0: 0x0093, 0x7b1: 0x1b14, 0x7b2: 0x1d48, 0x7b3: 0x1b1d, 0x7b4: 0x00ad, 0x7b5: 0x1b92,
+	0x7b6: 0x1d7c, 0x7b7: 0x1e8c, 0x7b8: 0x1b20, 0x7b9: 0x00b1, 0x7ba: 0x1b95, 0x7bb: 0x1d80,
+	0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b,
+	// Block 0x1f, offset 0x7c0
+	0x7c1: 0x3d47, 0x7c3: 0xa000, 0x7c4: 0x3d4e, 0x7c5: 0xa000,
+	0x7c7: 0x3d55, 0x7c8: 0xa000, 0x7c9: 0x3d5c,
+	0x7cd: 0xa000,
+	0x7e0: 0x30a6, 0x7e1: 0xa000, 0x7e2: 0x3d6a,
+	0x7e4: 0xa000, 0x7e5: 0xa000,
+	0x7ed: 0x3d63, 0x7ee: 0x30a1, 0x7ef: 0x30ab,
+	0x7f0: 0x3d71, 0x7f1: 0x3d78, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3d7f, 0x7f5: 0x3d86,
+	0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3d8d, 0x7f9: 0x3d94, 0x7fa: 0xa000, 0x7fb: 0xa000,
+	0x7fc: 0xa000, 0x7fd: 0xa000,
+	// Block 0x20, offset 0x800
+	0x800: 0x3d9b, 0x801: 0x3da2, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3db7, 0x805: 0x3dbe,
+	0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3dc5, 0x809: 0x3dcc,
+	0x811: 0xa000,
+	0x812: 0xa000,
+	0x822: 0xa000,
+	0x828: 0xa000, 0x829: 0xa000,
+	0x82b: 0xa000, 0x82c: 0x3de1, 0x82d: 0x3de8, 0x82e: 0x3def, 0x82f: 0x3df6,
+	0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000,
+	// Block 0x21, offset 0x840
+	0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029,
+	0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x19af,
+	0x86a: 0x19b2, 0x86b: 0x19b5, 0x86c: 0x19b8, 0x86d: 0x19bb, 0x86e: 0x19be, 0x86f: 0x19c1,
+	0x870: 0x19c4, 0x871: 0x19c7, 0x872: 0x19ca, 0x873: 0x19d3, 0x874: 0x1b98, 0x875: 0x1b9c,
+	0x876: 0x1ba0, 0x877: 0x1ba4, 0x878: 0x1ba8, 0x879: 0x1bac, 0x87a: 0x1bb0, 0x87b: 0x1bb4,
+	0x87c: 0x1bb8, 0x87d: 0x1db0, 0x87e: 0x1db5, 0x87f: 0x1dba,
+	// Block 0x22, offset 0x880
+	0x880: 0x1dbf, 0x881: 0x1dc4, 0x882: 0x1dc9, 0x883: 0x1dce, 0x884: 0x1dd3, 0x885: 0x1dd8,
+	0x886: 0x1ddd, 0x887: 0x1de2, 0x888: 0x19ac, 0x889: 0x19d0, 0x88a: 0x19f4, 0x88b: 0x1a18,
+	0x88c: 0x1a3c, 0x88d: 0x1a45, 0x88e: 0x1a4b, 0x88f: 0x1a51, 0x890: 0x1a57, 0x891: 0x1c90,
+	0x892: 0x1c94, 0x893: 0x1c98, 0x894: 0x1c9c, 0x895: 0x1ca0, 0x896: 0x1ca4, 0x897: 0x1ca8,
+	0x898: 0x1cac, 0x899: 0x1cb0, 0x89a: 0x1cb4, 0x89b: 0x1cb8, 0x89c: 0x1c24, 0x89d: 0x1c28,
+	0x89e: 0x1c2c, 0x89f: 0x1c30, 0x8a0: 0x1c34, 0x8a1: 0x1c38, 0x8a2: 0x1c3c, 0x8a3: 0x1c40,
+	0x8a4: 0x1c44, 0x8a5: 0x1c48, 0x8a6: 0x1c4c, 0x8a7: 0x1c50, 0x8a8: 0x1c54, 0x8a9: 0x1c58,
+	0x8aa: 0x1c5c, 0x8ab: 0x1c60, 0x8ac: 0x1c64, 0x8ad: 0x1c68, 0x8ae: 0x1c6c, 0x8af: 0x1c70,
+	0x8b0: 0x1c74, 0x8b1: 0x1c78, 0x8b2: 0x1c7c, 0x8b3: 0x1c80, 0x8b4: 0x1c84, 0x8b5: 0x1c88,
+	0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d,
+	0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055,
+	// Block 0x23, offset 0x8c0
+	0x8c0: 0x07ba, 0x8c1: 0x07de, 0x8c2: 0x07ea, 0x8c3: 0x07fa, 0x8c4: 0x0802, 0x8c5: 0x080e,
+	0x8c6: 0x0816, 0x8c7: 0x081e, 0x8c8: 0x082a, 0x8c9: 0x087e, 0x8ca: 0x0896, 0x8cb: 0x08a6,
+	0x8cc: 0x08b6, 0x8cd: 0x08c6, 0x8ce: 0x08d6, 0x8cf: 0x08f6, 0x8d0: 0x08fa, 0x8d1: 0x08fe,
+	0x8d2: 0x0932, 0x8d3: 0x095a, 0x8d4: 0x096a, 0x8d5: 0x0972, 0x8d6: 0x0976, 0x8d7: 0x0982,
+	0x8d8: 0x099e, 0x8d9: 0x09a2, 0x8da: 0x09ba, 0x8db: 0x09be, 0x8dc: 0x09c6, 0x8dd: 0x09d6,
+	0x8de: 0x0a72, 0x8df: 0x0a86, 0x8e0: 0x0ac6, 0x8e1: 0x0ada, 0x8e2: 0x0ae2, 0x8e3: 0x0ae6,
+	0x8e4: 0x0af6, 0x8e5: 0x0b12, 0x8e6: 0x0b3e, 0x8e7: 0x0b4a, 0x8e8: 0x0b6a, 0x8e9: 0x0b76,
+	0x8ea: 0x0b7a, 0x8eb: 0x0b7e, 0x8ec: 0x0b96, 0x8ed: 0x0b9a, 0x8ee: 0x0bc6, 0x8ef: 0x0bd2,
+	0x8f0: 0x0bda, 0x8f1: 0x0be2, 0x8f2: 0x0bf2, 0x8f3: 0x0bfa, 0x8f4: 0x0c02, 0x8f5: 0x0c2e,
+	0x8f6: 0x0c32, 0x8f7: 0x0c3a, 0x8f8: 0x0c3e, 0x8f9: 0x0c46, 0x8fa: 0x0c4e, 0x8fb: 0x0c5e,
+	0x8fc: 0x0c7a, 0x8fd: 0x0cf2, 0x8fe: 0x0d06, 0x8ff: 0x0d0a,
+	// Block 0x24, offset 0x900
+	0x900: 0x0d8a, 0x901: 0x0d8e, 0x902: 0x0da2, 0x903: 0x0da6, 0x904: 0x0dae, 0x905: 0x0db6,
+	0x906: 0x0dbe, 0x907: 0x0dca, 0x908: 0x0df2, 0x909: 0x0e02, 0x90a: 0x0e16, 0x90b: 0x0e86,
+	0x90c: 0x0e92, 0x90d: 0x0ea2, 0x90e: 0x0eae, 0x90f: 0x0eba, 0x910: 0x0ec2, 0x911: 0x0ec6,
+	0x912: 0x0eca, 0x913: 0x0ece, 0x914: 0x0ed2, 0x915: 0x0f8a, 0x916: 0x0fd2, 0x917: 0x0fde,
+	0x918: 0x0fe2, 0x919: 0x0fe6, 0x91a: 0x0fea, 0x91b: 0x0ff2, 0x91c: 0x0ff6, 0x91d: 0x100a,
+	0x91e: 0x1026, 0x91f: 0x102e, 0x920: 0x106e, 0x921: 0x1072, 0x922: 0x107a, 0x923: 0x107e,
+	0x924: 0x1086, 0x925: 0x108a, 0x926: 0x10ae, 0x927: 0x10b2, 0x928: 0x10ce, 0x929: 0x10d2,
+	0x92a: 0x10d6, 0x92b: 0x10da, 0x92c: 0x10ee, 0x92d: 0x1112, 0x92e: 0x1116, 0x92f: 0x111a,
+	0x930: 0x113e, 0x931: 0x117e, 0x932: 0x1182, 0x933: 0x11a2, 0x934: 0x11b2, 0x935: 0x11ba,
+	0x936: 0x11da, 0x937: 0x11fe, 0x938: 0x1242, 0x939: 0x124a, 0x93a: 0x125e, 0x93b: 0x126a,
+	0x93c: 0x1272, 0x93d: 0x127a, 0x93e: 0x127e, 0x93f: 0x1282,
+	// Block 0x25, offset 0x940
+	0x940: 0x129a, 0x941: 0x129e, 0x942: 0x12ba, 0x943: 0x12c2, 0x944: 0x12ca, 0x945: 0x12ce,
+	0x946: 0x12da, 0x947: 0x12e2, 0x948: 0x12e6, 0x949: 0x12ea, 0x94a: 0x12f2, 0x94b: 0x12f6,
+	0x94c: 0x1396, 0x94d: 0x13aa, 0x94e: 0x13de, 0x94f: 0x13e2, 0x950: 0x13ea, 0x951: 0x1416,
+	0x952: 0x141e, 0x953: 0x1426, 0x954: 0x142e, 0x955: 0x146a, 0x956: 0x146e, 0x957: 0x1476,
+	0x958: 0x147a, 0x959: 0x147e, 0x95a: 0x14aa, 0x95b: 0x14ae, 0x95c: 0x14b6, 0x95d: 0x14ca,
+	0x95e: 0x14ce, 0x95f: 0x14ea, 0x960: 0x14f2, 0x961: 0x14f6, 0x962: 0x151a, 0x963: 0x153a,
+	0x964: 0x154e, 0x965: 0x1552, 0x966: 0x155a, 0x967: 0x1586, 0x968: 0x158a, 0x969: 0x159a,
+	0x96a: 0x15be, 0x96b: 0x15ca, 0x96c: 0x15da, 0x96d: 0x15f2, 0x96e: 0x15fa, 0x96f: 0x15fe,
+	0x970: 0x1602, 0x971: 0x1606, 0x972: 0x1612, 0x973: 0x1616, 0x974: 0x161e, 0x975: 0x163a,
+	0x976: 0x163e, 0x977: 0x1642, 0x978: 0x165a, 0x979: 0x165e, 0x97a: 0x1666, 0x97b: 0x167a,
+	0x97c: 0x167e, 0x97d: 0x1682, 0x97e: 0x168a, 0x97f: 0x168e,
+	// Block 0x26, offset 0x980
+	0x986: 0xa000, 0x98b: 0xa000,
+	0x98c: 0x4049, 0x98d: 0xa000, 0x98e: 0x4051, 0x98f: 0xa000, 0x990: 0x4059, 0x991: 0xa000,
+	0x992: 0x4061, 0x993: 0xa000, 0x994: 0x4069, 0x995: 0xa000, 0x996: 0x4071, 0x997: 0xa000,
+	0x998: 0x4079, 0x999: 0xa000, 0x99a: 0x4081, 0x99b: 0xa000, 0x99c: 0x4089, 0x99d: 0xa000,
+	0x99e: 0x4091, 0x99f: 0xa000, 0x9a0: 0x4099, 0x9a1: 0xa000, 0x9a2: 0x40a1,
+	0x9a4: 0xa000, 0x9a5: 0x40a9, 0x9a6: 0xa000, 0x9a7: 0x40b1, 0x9a8: 0xa000, 0x9a9: 0x40b9,
+	0x9af: 0xa000,
+	0x9b0: 0x40c1, 0x9b1: 0x40c9, 0x9b2: 0xa000, 0x9b3: 0x40d1, 0x9b4: 0x40d9, 0x9b5: 0xa000,
+	0x9b6: 0x40e1, 0x9b7: 0x40e9, 0x9b8: 0xa000, 0x9b9: 0x40f1, 0x9ba: 0x40f9, 0x9bb: 0xa000,
+	0x9bc: 0x4101, 0x9bd: 0x4109,
+	// Block 0x27, offset 0x9c0
+	0x9d4: 0x4041,
+	0x9d9: 0x9904, 0x9da: 0x9904, 0x9db: 0x441d, 0x9dc: 0x4423, 0x9dd: 0xa000,
+	0x9de: 0x4111, 0x9df: 0x27e4,
+	0x9e6: 0xa000,
+	0x9eb: 0xa000, 0x9ec: 0x4121, 0x9ed: 0xa000, 0x9ee: 0x4129, 0x9ef: 0xa000,
+	0x9f0: 0x4131, 0x9f1: 0xa000, 0x9f2: 0x4139, 0x9f3: 0xa000, 0x9f4: 0x4141, 0x9f5: 0xa000,
+	0x9f6: 0x4149, 0x9f7: 0xa000, 0x9f8: 0x4151, 0x9f9: 0xa000, 0x9fa: 0x4159, 0x9fb: 0xa000,
+	0x9fc: 0x4161, 0x9fd: 0xa000, 0x9fe: 0x4169, 0x9ff: 0xa000,
+	// Block 0x28, offset 0xa00
+	0xa00: 0x4171, 0xa01: 0xa000, 0xa02: 0x4179, 0xa04: 0xa000, 0xa05: 0x4181,
+	0xa06: 0xa000, 0xa07: 0x4189, 0xa08: 0xa000, 0xa09: 0x4191,
+	0xa0f: 0xa000, 0xa10: 0x4199, 0xa11: 0x41a1,
+	0xa12: 0xa000, 0xa13: 0x41a9, 0xa14: 0x41b1, 0xa15: 0xa000, 0xa16: 0x41b9, 0xa17: 0x41c1,
+	0xa18: 0xa000, 0xa19: 0x41c9, 0xa1a: 0x41d1, 0xa1b: 0xa000, 0xa1c: 0x41d9, 0xa1d: 0x41e1,
+	0xa2f: 0xa000,
+	0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x4119,
+	0xa37: 0x41e9, 0xa38: 0x41f1, 0xa39: 0x41f9, 0xa3a: 0x4201,
+	0xa3d: 0xa000, 0xa3e: 0x4209, 0xa3f: 0x27f9,
+	// Block 0x29, offset 0xa40
+	0xa40: 0x045a, 0xa41: 0x041e, 0xa42: 0x0422, 0xa43: 0x0426, 0xa44: 0x046e, 0xa45: 0x042a,
+	0xa46: 0x042e, 0xa47: 0x0432, 0xa48: 0x0436, 0xa49: 0x043a, 0xa4a: 0x043e, 0xa4b: 0x0442,
+	0xa4c: 0x0446, 0xa4d: 0x044a, 0xa4e: 0x044e, 0xa4f: 0x4afe, 0xa50: 0x4b04, 0xa51: 0x4b0a,
+	0xa52: 0x4b10, 0xa53: 0x4b16, 0xa54: 0x4b1c, 0xa55: 0x4b22, 0xa56: 0x4b28, 0xa57: 0x4b2e,
+	0xa58: 0x4b34, 0xa59: 0x4b3a, 0xa5a: 0x4b40, 0xa5b: 0x4b46, 0xa5c: 0x4b4c, 0xa5d: 0x4b52,
+	0xa5e: 0x4b58, 0xa5f: 0x4b5e, 0xa60: 0x4b64, 0xa61: 0x4b6a, 0xa62: 0x4b70, 0xa63: 0x4b76,
+	0xa64: 0x04b6, 0xa65: 0x0452, 0xa66: 0x0456, 0xa67: 0x04da, 0xa68: 0x04de, 0xa69: 0x04e2,
+	0xa6a: 0x04e6, 0xa6b: 0x04ea, 0xa6c: 0x04ee, 0xa6d: 0x04f2, 0xa6e: 0x045e, 0xa6f: 0x04f6,
+	0xa70: 0x04fa, 0xa71: 0x0462, 0xa72: 0x0466, 0xa73: 0x046a, 0xa74: 0x0472, 0xa75: 0x0476,
+	0xa76: 0x047a, 0xa77: 0x047e, 0xa78: 0x0482, 0xa79: 0x0486, 0xa7a: 0x048a, 0xa7b: 0x048e,
+	0xa7c: 0x0492, 0xa7d: 0x0496, 0xa7e: 0x049a, 0xa7f: 0x049e,
+	// Block 0x2a, offset 0xa80
+	0xa80: 0x04a2, 0xa81: 0x04a6, 0xa82: 0x04fe, 0xa83: 0x0502, 0xa84: 0x04aa, 0xa85: 0x04ae,
+	0xa86: 0x04b2, 0xa87: 0x04ba, 0xa88: 0x04be, 0xa89: 0x04c2, 0xa8a: 0x04c6, 0xa8b: 0x04ca,
+	0xa8c: 0x04ce, 0xa8d: 0x04d2, 0xa8e: 0x04d6,
+	0xa92: 0x07ba, 0xa93: 0x0816, 0xa94: 0x07c6, 0xa95: 0x0a76, 0xa96: 0x07ca, 0xa97: 0x07e2,
+	0xa98: 0x07ce, 0xa99: 0x108e, 0xa9a: 0x0802, 0xa9b: 0x07d6, 0xa9c: 0x07be, 0xa9d: 0x0afa,
+	0xa9e: 0x0a8a, 0xa9f: 0x082a,
+	// Block 0x2b, offset 0xac0
+	0xac0: 0x2184, 0xac1: 0x218a, 0xac2: 0x2190, 0xac3: 0x2196, 0xac4: 0x219c, 0xac5: 0x21a2,
+	0xac6: 0x21a8, 0xac7: 0x21ae, 0xac8: 0x21b4, 0xac9: 0x21ba, 0xaca: 0x21c0, 0xacb: 0x21c6,
+	0xacc: 0x21cc, 0xacd: 0x21d2, 0xace: 0x285d, 0xacf: 0x2866, 0xad0: 0x286f, 0xad1: 0x2878,
+	0xad2: 0x2881, 0xad3: 0x288a, 0xad4: 0x2893, 0xad5: 0x289c, 0xad6: 0x28a5, 0xad7: 0x28b7,
+	0xad8: 0x28c0, 0xad9: 0x28c9, 0xada: 0x28d2, 0xadb: 0x28db, 0xadc: 0x28ae, 0xadd: 0x2ce3,
+	0xade: 0x2c24, 0xae0: 0x21d8, 0xae1: 0x21f0, 0xae2: 0x21e4, 0xae3: 0x2238,
+	0xae4: 0x21f6, 0xae5: 0x2214, 0xae6: 0x21de, 0xae7: 0x220e, 0xae8: 0x21ea, 0xae9: 0x2220,
+	0xaea: 0x2250, 0xaeb: 0x226e, 0xaec: 0x2268, 0xaed: 0x225c, 0xaee: 0x22aa, 0xaef: 0x223e,
+	0xaf0: 0x224a, 0xaf1: 0x2262, 0xaf2: 0x2256, 0xaf3: 0x2280, 0xaf4: 0x222c, 0xaf5: 0x2274,
+	0xaf6: 0x229e, 0xaf7: 0x2286, 0xaf8: 0x221a, 0xaf9: 0x21fc, 0xafa: 0x2232, 0xafb: 0x2244,
+	0xafc: 0x227a, 0xafd: 0x2202, 0xafe: 0x22a4, 0xaff: 0x2226,
+	// Block 0x2c, offset 0xb00
+	0xb00: 0x228c, 0xb01: 0x2208, 0xb02: 0x2292, 0xb03: 0x2298, 0xb04: 0x0a2a, 0xb05: 0x0bfe,
+	0xb06: 0x0da2, 0xb07: 0x11c2,
+	0xb10: 0x1cf4, 0xb11: 0x19d6,
+	0xb12: 0x19d9, 0xb13: 0x19dc, 0xb14: 0x19df, 0xb15: 0x19e2, 0xb16: 0x19e5, 0xb17: 0x19e8,
+	0xb18: 0x19eb, 0xb19: 0x19ee, 0xb1a: 0x19f7, 0xb1b: 0x19fa, 0xb1c: 0x19fd, 0xb1d: 0x1a00,
+	0xb1e: 0x1a03, 0xb1f: 0x1a06, 0xb20: 0x0406, 0xb21: 0x040e, 0xb22: 0x0412, 0xb23: 0x041a,
+	0xb24: 0x041e, 0xb25: 0x0422, 0xb26: 0x042a, 0xb27: 0x0432, 0xb28: 0x0436, 0xb29: 0x043e,
+	0xb2a: 0x0442, 0xb2b: 0x0446, 0xb2c: 0x044a, 0xb2d: 0x044e, 0xb2e: 0x2f59, 0xb2f: 0x2f61,
+	0xb30: 0x2f69, 0xb31: 0x2f71, 0xb32: 0x2f79, 0xb33: 0x2f81, 0xb34: 0x2f89, 0xb35: 0x2f91,
+	0xb36: 0x2fa1, 0xb37: 0x2fa9, 0xb38: 0x2fb1, 0xb39: 0x2fb9, 0xb3a: 0x2fc1, 0xb3b: 0x2fc9,
+	0xb3c: 0x3014, 0xb3d: 0x2fdc, 0xb3e: 0x2f99,
+	// Block 0x2d, offset 0xb40
+	0xb40: 0x07ba, 0xb41: 0x0816, 0xb42: 0x07c6, 0xb43: 0x0a76, 0xb44: 0x081a, 0xb45: 0x08aa,
+	0xb46: 0x07c2, 0xb47: 0x08a6, 0xb48: 0x0806, 0xb49: 0x0982, 0xb4a: 0x0e02, 0xb4b: 0x0f8a,
+	0xb4c: 0x0ed2, 0xb4d: 0x0e16, 0xb4e: 0x155a, 0xb4f: 0x0a86, 0xb50: 0x0dca, 0xb51: 0x0e46,
+	0xb52: 0x0e06, 0xb53: 0x1146, 0xb54: 0x09f6, 0xb55: 0x0ffe, 0xb56: 0x1482, 0xb57: 0x115a,
+	0xb58: 0x093e, 0xb59: 0x118a, 0xb5a: 0x1096, 0xb5b: 0x0b12, 0xb5c: 0x150a, 0xb5d: 0x087a,
+	0xb5e: 0x09a6, 0xb5f: 0x0ef2, 0xb60: 0x1622, 0xb61: 0x083e, 0xb62: 0x08ce, 0xb63: 0x0e96,
+	0xb64: 0x07ca, 0xb65: 0x07e2, 0xb66: 0x07ce, 0xb67: 0x0bd6, 0xb68: 0x09ea, 0xb69: 0x097a,
+	0xb6a: 0x0b52, 0xb6b: 0x0b46, 0xb6c: 0x10e6, 0xb6d: 0x083a, 0xb6e: 0x1496, 0xb6f: 0x0996,
+	0xb70: 0x0aee, 0xb71: 0x1a09, 0xb72: 0x1a0c, 0xb73: 0x1a0f, 0xb74: 0x1a12, 0xb75: 0x1a1b,
+	0xb76: 0x1a1e, 0xb77: 0x1a21, 0xb78: 0x1a24, 0xb79: 0x1a27, 0xb7a: 0x1a2a, 0xb7b: 0x1a2d,
+	0xb7c: 0x1a30, 0xb7d: 0x1a33, 0xb7e: 0x1a36, 0xb7f: 0x1a3f,
+	// Block 0x2e, offset 0xb80
+	0xb80: 0x1df6, 0xb81: 0x1e05, 0xb82: 0x1e14, 0xb83: 0x1e23, 0xb84: 0x1e32, 0xb85: 0x1e41,
+	0xb86: 0x1e50, 0xb87: 0x1e5f, 0xb88: 0x1e6e, 0xb89: 0x22bc, 0xb8a: 0x22ce, 0xb8b: 0x22e0,
+	0xb8c: 0x1a81, 0xb8d: 0x1d34, 0xb8e: 0x1b02, 0xb8f: 0x1cd8, 0xb90: 0x05c6, 0xb91: 0x05ce,
+	0xb92: 0x05d6, 0xb93: 0x05de, 0xb94: 0x05e6, 0xb95: 0x05ea, 0xb96: 0x05ee, 0xb97: 0x05f2,
+	0xb98: 0x05f6, 0xb99: 0x05fa, 0xb9a: 0x05fe, 0xb9b: 0x0602, 0xb9c: 0x0606, 0xb9d: 0x060a,
+	0xb9e: 0x060e, 0xb9f: 0x0612, 0xba0: 0x0616, 0xba1: 0x061e, 0xba2: 0x0622, 0xba3: 0x0626,
+	0xba4: 0x062a, 0xba5: 0x062e, 0xba6: 0x0632, 0xba7: 0x0636, 0xba8: 0x063a, 0xba9: 0x063e,
+	0xbaa: 0x0642, 0xbab: 0x0646, 0xbac: 0x064a, 0xbad: 0x064e, 0xbae: 0x0652, 0xbaf: 0x0656,
+	0xbb0: 0x065a, 0xbb1: 0x065e, 0xbb2: 0x0662, 0xbb3: 0x066a, 0xbb4: 0x0672, 0xbb5: 0x067a,
+	0xbb6: 0x067e, 0xbb7: 0x0682, 0xbb8: 0x0686, 0xbb9: 0x068a, 0xbba: 0x068e, 0xbbb: 0x0692,
+	0xbbc: 0x0696, 0xbbd: 0x069a, 0xbbe: 0x069e, 0xbbf: 0x282a,
+	// Block 0x2f, offset 0xbc0
+	0xbc0: 0x2c43, 0xbc1: 0x2adf, 0xbc2: 0x2c53, 0xbc3: 0x29b7, 0xbc4: 0x3025, 0xbc5: 0x29c1,
+	0xbc6: 0x29cb, 0xbc7: 0x3069, 0xbc8: 0x2aec, 0xbc9: 0x29d5, 0xbca: 0x29df, 0xbcb: 0x29e9,
+	0xbcc: 0x2b13, 0xbcd: 0x2b20, 0xbce: 0x2af9, 0xbcf: 0x2b06, 0xbd0: 0x2fea, 0xbd1: 0x2b2d,
+	0xbd2: 0x2b3a, 0xbd3: 0x2cf5, 0xbd4: 0x27eb, 0xbd5: 0x2d08, 0xbd6: 0x2d1b, 0xbd7: 0x2c63,
+	0xbd8: 0x2b47, 0xbd9: 0x2d2e, 0xbda: 0x2d41, 0xbdb: 0x2b54, 0xbdc: 0x29f3, 0xbdd: 0x29fd,
+	0xbde: 0x2ff8, 0xbdf: 0x2b61, 0xbe0: 0x2c73, 0xbe1: 0x3036, 0xbe2: 0x2a07, 0xbe3: 0x2a11,
+	0xbe4: 0x2b6e, 0xbe5: 0x2a1b, 0xbe6: 0x2a25, 0xbe7: 0x2800, 0xbe8: 0x2807, 0xbe9: 0x2a2f,
+	0xbea: 0x2a39, 0xbeb: 0x2d54, 0xbec: 0x2b7b, 0xbed: 0x2c83, 0xbee: 0x2d67, 0xbef: 0x2b88,
+	0xbf0: 0x2a4d, 0xbf1: 0x2a43, 0xbf2: 0x307d, 0xbf3: 0x2b95, 0xbf4: 0x2d7a, 0xbf5: 0x2a57,
+	0xbf6: 0x2c93, 0xbf7: 0x2a61, 0xbf8: 0x2baf, 0xbf9: 0x2a6b, 0xbfa: 0x2bbc, 0xbfb: 0x3047,
+	0xbfc: 0x2ba2, 0xbfd: 0x2ca3, 0xbfe: 0x2bc9, 0xbff: 0x280e,
+	// Block 0x30, offset 0xc00
+	0xc00: 0x3058, 0xc01: 0x2a75, 0xc02: 0x2a7f, 0xc03: 0x2bd6, 0xc04: 0x2a89, 0xc05: 0x2a93,
+	0xc06: 0x2a9d, 0xc07: 0x2cb3, 0xc08: 0x2be3, 0xc09: 0x2815, 0xc0a: 0x2d8d, 0xc0b: 0x2fd1,
+	0xc0c: 0x2cc3, 0xc0d: 0x2bf0, 0xc0e: 0x3006, 0xc0f: 0x2aa7, 0xc10: 0x2ab1, 0xc11: 0x2bfd,
+	0xc12: 0x281c, 0xc13: 0x2c0a, 0xc14: 0x2cd3, 0xc15: 0x2823, 0xc16: 0x2da0, 0xc17: 0x2abb,
+	0xc18: 0x1de7, 0xc19: 0x1dfb, 0xc1a: 0x1e0a, 0xc1b: 0x1e19, 0xc1c: 0x1e28, 0xc1d: 0x1e37,
+	0xc1e: 0x1e46, 0xc1f: 0x1e55, 0xc20: 0x1e64, 0xc21: 0x1e73, 0xc22: 0x22c2, 0xc23: 0x22d4,
+	0xc24: 0x22e6, 0xc25: 0x22f2, 0xc26: 0x22fe, 0xc27: 0x230a, 0xc28: 0x2316, 0xc29: 0x2322,
+	0xc2a: 0x232e, 0xc2b: 0x233a, 0xc2c: 0x2376, 0xc2d: 0x2382, 0xc2e: 0x238e, 0xc2f: 0x239a,
+	0xc30: 0x23a6, 0xc31: 0x1d44, 0xc32: 0x1af6, 0xc33: 0x1a63, 0xc34: 0x1d14, 0xc35: 0x1b77,
+	0xc36: 0x1b86, 0xc37: 0x1afc, 0xc38: 0x1d2c, 0xc39: 0x1d30, 0xc3a: 0x1a8d, 0xc3b: 0x2838,
+	0xc3c: 0x2846, 0xc3d: 0x2831, 0xc3e: 0x283f, 0xc3f: 0x2c17,
+	// Block 0x31, offset 0xc40
+	0xc40: 0x1b7a, 0xc41: 0x1b62, 0xc42: 0x1d90, 0xc43: 0x1b4a, 0xc44: 0x1b23, 0xc45: 0x1a96,
+	0xc46: 0x1aa5, 0xc47: 0x1a75, 0xc48: 0x1d20, 0xc49: 0x1e82, 0xc4a: 0x1b7d, 0xc4b: 0x1b65,
+	0xc4c: 0x1d94, 0xc4d: 0x1da0, 0xc4e: 0x1b56, 0xc4f: 0x1b2c, 0xc50: 0x1a84, 0xc51: 0x1d4c,
+	0xc52: 0x1ce0, 0xc53: 0x1ccc, 0xc54: 0x1cfc, 0xc55: 0x1da4, 0xc56: 0x1b59, 0xc57: 0x1af9,
+	0xc58: 0x1b2f, 0xc59: 0x1b0e, 0xc5a: 0x1b71, 0xc5b: 0x1da8, 0xc5c: 0x1b5c, 0xc5d: 0x1af0,
+	0xc5e: 0x1b32, 0xc5f: 0x1d6c, 0xc60: 0x1d24, 0xc61: 0x1b44, 0xc62: 0x1d54, 0xc63: 0x1d70,
+	0xc64: 0x1d28, 0xc65: 0x1b47, 0xc66: 0x1d58, 0xc67: 0x2418, 0xc68: 0x242c, 0xc69: 0x1ac6,
+	0xc6a: 0x1d50, 0xc6b: 0x1ce4, 0xc6c: 0x1cd0, 0xc6d: 0x1d78, 0xc6e: 0x284d, 0xc6f: 0x28e4,
+	0xc70: 0x1b89, 0xc71: 0x1b74, 0xc72: 0x1dac, 0xc73: 0x1b5f, 0xc74: 0x1b80, 0xc75: 0x1b68,
+	0xc76: 0x1d98, 0xc77: 0x1b4d, 0xc78: 0x1b26, 0xc79: 0x1ab1, 0xc7a: 0x1b83, 0xc7b: 0x1b6b,
+	0xc7c: 0x1d9c, 0xc7d: 0x1b50, 0xc7e: 0x1b29, 0xc7f: 0x1ab4,
+	// Block 0x32, offset 0xc80
+	0xc80: 0x1d5c, 0xc81: 0x1ce8, 0xc82: 0x1e7d, 0xc83: 0x1a66, 0xc84: 0x1aea, 0xc85: 0x1aed,
+	0xc86: 0x2425, 0xc87: 0x1cc4, 0xc88: 0x1af3, 0xc89: 0x1a78, 0xc8a: 0x1b11, 0xc8b: 0x1a7b,
+	0xc8c: 0x1b1a, 0xc8d: 0x1a99, 0xc8e: 0x1a9c, 0xc8f: 0x1b35, 0xc90: 0x1b3b, 0xc91: 0x1b3e,
+	0xc92: 0x1d60, 0xc93: 0x1b41, 0xc94: 0x1b53, 0xc95: 0x1d68, 0xc96: 0x1d74, 0xc97: 0x1ac0,
+	0xc98: 0x1e87, 0xc99: 0x1cec, 0xc9a: 0x1ac3, 0xc9b: 0x1b8c, 0xc9c: 0x1ad5, 0xc9d: 0x1ae4,
+	0xc9e: 0x2412, 0xc9f: 0x240c, 0xca0: 0x1df1, 0xca1: 0x1e00, 0xca2: 0x1e0f, 0xca3: 0x1e1e,
+	0xca4: 0x1e2d, 0xca5: 0x1e3c, 0xca6: 0x1e4b, 0xca7: 0x1e5a, 0xca8: 0x1e69, 0xca9: 0x22b6,
+	0xcaa: 0x22c8, 0xcab: 0x22da, 0xcac: 0x22ec, 0xcad: 0x22f8, 0xcae: 0x2304, 0xcaf: 0x2310,
+	0xcb0: 0x231c, 0xcb1: 0x2328, 0xcb2: 0x2334, 0xcb3: 0x2370, 0xcb4: 0x237c, 0xcb5: 0x2388,
+	0xcb6: 0x2394, 0xcb7: 0x23a0, 0xcb8: 0x23ac, 0xcb9: 0x23b2, 0xcba: 0x23b8, 0xcbb: 0x23be,
+	0xcbc: 0x23c4, 0xcbd: 0x23d6, 0xcbe: 0x23dc, 0xcbf: 0x1d40,
+	// Block 0x33, offset 0xcc0
+	0xcc0: 0x1472, 0xcc1: 0x0df6, 0xcc2: 0x14ce, 0xcc3: 0x149a, 0xcc4: 0x0f52, 0xcc5: 0x07e6,
+	0xcc6: 0x09da, 0xcc7: 0x1726, 0xcc8: 0x1726, 0xcc9: 0x0b06, 0xcca: 0x155a, 0xccb: 0x0a3e,
+	0xccc: 0x0b02, 0xccd: 0x0cea, 0xcce: 0x10ca, 0xccf: 0x125a, 0xcd0: 0x1392, 0xcd1: 0x13ce,
+	0xcd2: 0x1402, 0xcd3: 0x1516, 0xcd4: 0x0e6e, 0xcd5: 0x0efa, 0xcd6: 0x0fa6, 0xcd7: 0x103e,
+	0xcd8: 0x135a, 0xcd9: 0x1542, 0xcda: 0x166e, 0xcdb: 0x080a, 0xcdc: 0x09ae, 0xcdd: 0x0e82,
+	0xcde: 0x0fca, 0xcdf: 0x138e, 0xce0: 0x16be, 0xce1: 0x0bae, 0xce2: 0x0f72, 0xce3: 0x137e,
+	0xce4: 0x1412, 0xce5: 0x0d1e, 0xce6: 0x12b6, 0xce7: 0x13da, 0xce8: 0x0c1a, 0xce9: 0x0e0a,
+	0xcea: 0x0f12, 0xceb: 0x1016, 0xcec: 0x1522, 0xced: 0x084a, 0xcee: 0x08e2, 0xcef: 0x094e,
+	0xcf0: 0x0d86, 0xcf1: 0x0e7a, 0xcf2: 0x0fc6, 0xcf3: 0x10ea, 0xcf4: 0x1272, 0xcf5: 0x1386,
+	0xcf6: 0x139e, 0xcf7: 0x14c2, 0xcf8: 0x15ea, 0xcf9: 0x169e, 0xcfa: 0x16ba, 0xcfb: 0x1126,
+	0xcfc: 0x1166, 0xcfd: 0x121e, 0xcfe: 0x133e, 0xcff: 0x1576,
+	// Block 0x34, offset 0xd00
+	0xd00: 0x16c6, 0xd01: 0x1446, 0xd02: 0x0ac2, 0xd03: 0x0c36, 0xd04: 0x11d6, 0xd05: 0x1296,
+	0xd06: 0x0ffa, 0xd07: 0x112e, 0xd08: 0x1492, 0xd09: 0x15e2, 0xd0a: 0x0abe, 0xd0b: 0x0b8a,
+	0xd0c: 0x0e72, 0xd0d: 0x0f26, 0xd0e: 0x0f5a, 0xd0f: 0x120e, 0xd10: 0x1236, 0xd11: 0x15a2,
+	0xd12: 0x094a, 0xd13: 0x12a2, 0xd14: 0x08ee, 0xd15: 0x08ea, 0xd16: 0x1192, 0xd17: 0x1222,
+	0xd18: 0x1356, 0xd19: 0x15aa, 0xd1a: 0x1462, 0xd1b: 0x0d22, 0xd1c: 0x0e6e, 0xd1d: 0x1452,
+	0xd1e: 0x07f2, 0xd1f: 0x0b5e, 0xd20: 0x0c8e, 0xd21: 0x102a, 0xd22: 0x10aa, 0xd23: 0x096e,
+	0xd24: 0x1136, 0xd25: 0x085a, 0xd26: 0x0c72, 0xd27: 0x07d2, 0xd28: 0x0ee6, 0xd29: 0x0d9e,
+	0xd2a: 0x120a, 0xd2b: 0x09c2, 0xd2c: 0x0aae, 0xd2d: 0x10f6, 0xd2e: 0x135e, 0xd2f: 0x1436,
+	0xd30: 0x0eb2, 0xd31: 0x14f2, 0xd32: 0x0ede, 0xd33: 0x0d32, 0xd34: 0x1316, 0xd35: 0x0d52,
+	0xd36: 0x10a6, 0xd37: 0x0826, 0xd38: 0x08a2, 0xd39: 0x08e6, 0xd3a: 0x0e4e, 0xd3b: 0x11f6,
+	0xd3c: 0x12ee, 0xd3d: 0x1442, 0xd3e: 0x1556, 0xd3f: 0x0956,
+	// Block 0x35, offset 0xd40
+	0xd40: 0x0a0a, 0xd41: 0x0b12, 0xd42: 0x0c2a, 0xd43: 0x0dba, 0xd44: 0x0f76, 0xd45: 0x113a,
+	0xd46: 0x1592, 0xd47: 0x1676, 0xd48: 0x16ca, 0xd49: 0x16e2, 0xd4a: 0x0932, 0xd4b: 0x0dee,
+	0xd4c: 0x0e9e, 0xd4d: 0x14e6, 0xd4e: 0x0bf6, 0xd4f: 0x0cd2, 0xd50: 0x0cee, 0xd51: 0x0d7e,
+	0xd52: 0x0f66, 0xd53: 0x0fb2, 0xd54: 0x1062, 0xd55: 0x1186, 0xd56: 0x122a, 0xd57: 0x128e,
+	0xd58: 0x14d6, 0xd59: 0x1366, 0xd5a: 0x14fe, 0xd5b: 0x157a, 0xd5c: 0x090a, 0xd5d: 0x0936,
+	0xd5e: 0x0a1e, 0xd5f: 0x0fa2, 0xd60: 0x13ee, 0xd61: 0x1436, 0xd62: 0x0c16, 0xd63: 0x0c86,
+	0xd64: 0x0d4a, 0xd65: 0x0eaa, 0xd66: 0x11d2, 0xd67: 0x101e, 0xd68: 0x0836, 0xd69: 0x0a7a,
+	0xd6a: 0x0b5e, 0xd6b: 0x0bc2, 0xd6c: 0x0c92, 0xd6d: 0x103a, 0xd6e: 0x1056, 0xd6f: 0x1266,
+	0xd70: 0x1286, 0xd71: 0x155e, 0xd72: 0x15de, 0xd73: 0x15ee, 0xd74: 0x162a, 0xd75: 0x084e,
+	0xd76: 0x117a, 0xd77: 0x154a, 0xd78: 0x15c6, 0xd79: 0x0caa, 0xd7a: 0x0812, 0xd7b: 0x0872,
+	0xd7c: 0x0b62, 0xd7d: 0x0b82, 0xd7e: 0x0daa, 0xd7f: 0x0e6e,
+	// Block 0x36, offset 0xd80
+	0xd80: 0x0fbe, 0xd81: 0x10c6, 0xd82: 0x1372, 0xd83: 0x1512, 0xd84: 0x171e, 0xd85: 0x0dde,
+	0xd86: 0x159e, 0xd87: 0x092e, 0xd88: 0x0e2a, 0xd89: 0x0e36, 0xd8a: 0x0f0a, 0xd8b: 0x0f42,
+	0xd8c: 0x1046, 0xd8d: 0x10a2, 0xd8e: 0x1122, 0xd8f: 0x1206, 0xd90: 0x1636, 0xd91: 0x08aa,
+	0xd92: 0x0cfe, 0xd93: 0x15ae, 0xd94: 0x0862, 0xd95: 0x0ba6, 0xd96: 0x0f2a, 0xd97: 0x14da,
+	0xd98: 0x0c62, 0xd99: 0x0cb2, 0xd9a: 0x0e3e, 0xd9b: 0x102a, 0xd9c: 0x15b6, 0xd9d: 0x0912,
+	0xd9e: 0x09fa, 0xd9f: 0x0b92, 0xda0: 0x0dce, 0xda1: 0x0e1a, 0xda2: 0x0e5a, 0xda3: 0x0eee,
+	0xda4: 0x1042, 0xda5: 0x10b6, 0xda6: 0x1252, 0xda7: 0x13f2, 0xda8: 0x13fe, 0xda9: 0x1552,
+	0xdaa: 0x15d2, 0xdab: 0x097e, 0xdac: 0x0f46, 0xdad: 0x09fe, 0xdae: 0x0fc2, 0xdaf: 0x1066,
+	0xdb0: 0x1382, 0xdb1: 0x15ba, 0xdb2: 0x16a6, 0xdb3: 0x16ce, 0xdb4: 0x0e32, 0xdb5: 0x0f22,
+	0xdb6: 0x12be, 0xdb7: 0x11b2, 0xdb8: 0x11be, 0xdb9: 0x11e2, 0xdba: 0x1012, 0xdbb: 0x0f9a,
+	0xdbc: 0x145e, 0xdbd: 0x082e, 0xdbe: 0x1326, 0xdbf: 0x0916,
+	// Block 0x37, offset 0xdc0
+	0xdc0: 0x0906, 0xdc1: 0x0c06, 0xdc2: 0x0d26, 0xdc3: 0x11ee, 0xdc4: 0x0b4e, 0xdc5: 0x0efe,
+	0xdc6: 0x0dea, 0xdc7: 0x14e2, 0xdc8: 0x13e2, 0xdc9: 0x15a6, 0xdca: 0x141e, 0xdcb: 0x0c22,
+	0xdcc: 0x0882, 0xdcd: 0x0a56, 0xdd0: 0x0aaa,
+	0xdd2: 0x0dda, 0xdd5: 0x08f2, 0xdd6: 0x101a, 0xdd7: 0x10de,
+	0xdd8: 0x1142, 0xdd9: 0x115e, 0xdda: 0x1162, 0xddb: 0x1176, 0xddc: 0x15f6, 0xddd: 0x11e6,
+	0xdde: 0x126a, 0xde0: 0x138a, 0xde2: 0x144e,
+	0xde5: 0x1502, 0xde6: 0x152e,
+	0xdea: 0x164a, 0xdeb: 0x164e, 0xdec: 0x1652, 0xded: 0x16b6, 0xdee: 0x1526, 0xdef: 0x15c2,
+	0xdf0: 0x0852, 0xdf1: 0x0876, 0xdf2: 0x088a, 0xdf3: 0x0946, 0xdf4: 0x0952, 0xdf5: 0x0992,
+	0xdf6: 0x0a46, 0xdf7: 0x0a62, 0xdf8: 0x0a6a, 0xdf9: 0x0aa6, 0xdfa: 0x0ab2, 0xdfb: 0x0b8e,
+	0xdfc: 0x0b96, 0xdfd: 0x0c9e, 0xdfe: 0x0cc6, 0xdff: 0x0cce,
+	// Block 0x38, offset 0xe00
+	0xe00: 0x0ce6, 0xe01: 0x0d92, 0xe02: 0x0dc2, 0xe03: 0x0de2, 0xe04: 0x0e52, 0xe05: 0x0f16,
+	0xe06: 0x0f32, 0xe07: 0x0f62, 0xe08: 0x0fb6, 0xe09: 0x0fd6, 0xe0a: 0x104a, 0xe0b: 0x112a,
+	0xe0c: 0x1146, 0xe0d: 0x114e, 0xe0e: 0x114a, 0xe0f: 0x1152, 0xe10: 0x1156, 0xe11: 0x115a,
+	0xe12: 0x116e, 0xe13: 0x1172, 0xe14: 0x1196, 0xe15: 0x11aa, 0xe16: 0x11c6, 0xe17: 0x122a,
+	0xe18: 0x1232, 0xe19: 0x123a, 0xe1a: 0x124e, 0xe1b: 0x1276, 0xe1c: 0x12c6, 0xe1d: 0x12fa,
+	0xe1e: 0x12fa, 0xe1f: 0x1362, 0xe20: 0x140a, 0xe21: 0x1422, 0xe22: 0x1456, 0xe23: 0x145a,
+	0xe24: 0x149e, 0xe25: 0x14a2, 0xe26: 0x14fa, 0xe27: 0x1502, 0xe28: 0x15d6, 0xe29: 0x161a,
+	0xe2a: 0x1632, 0xe2b: 0x0c96, 0xe2c: 0x184b, 0xe2d: 0x12de,
+	0xe30: 0x07da, 0xe31: 0x08de, 0xe32: 0x089e, 0xe33: 0x0846, 0xe34: 0x0886, 0xe35: 0x08b2,
+	0xe36: 0x0942, 0xe37: 0x095e, 0xe38: 0x0a46, 0xe39: 0x0a32, 0xe3a: 0x0a42, 0xe3b: 0x0a5e,
+	0xe3c: 0x0aaa, 0xe3d: 0x0aba, 0xe3e: 0x0afe, 0xe3f: 0x0b0a,
+	// Block 0x39, offset 0xe40
+	0xe40: 0x0b26, 0xe41: 0x0b36, 0xe42: 0x0c1e, 0xe43: 0x0c26, 0xe44: 0x0c56, 0xe45: 0x0c76,
+	0xe46: 0x0ca6, 0xe47: 0x0cbe, 0xe48: 0x0cae, 0xe49: 0x0cce, 0xe4a: 0x0cc2, 0xe4b: 0x0ce6,
+	0xe4c: 0x0d02, 0xe4d: 0x0d5a, 0xe4e: 0x0d66, 0xe4f: 0x0d6e, 0xe50: 0x0d96, 0xe51: 0x0dda,
+	0xe52: 0x0e0a, 0xe53: 0x0e0e, 0xe54: 0x0e22, 0xe55: 0x0ea2, 0xe56: 0x0eb2, 0xe57: 0x0f0a,
+	0xe58: 0x0f56, 0xe59: 0x0f4e, 0xe5a: 0x0f62, 0xe5b: 0x0f7e, 0xe5c: 0x0fb6, 0xe5d: 0x110e,
+	0xe5e: 0x0fda, 0xe5f: 0x100e, 0xe60: 0x101a, 0xe61: 0x105a, 0xe62: 0x1076, 0xe63: 0x109a,
+	0xe64: 0x10be, 0xe65: 0x10c2, 0xe66: 0x10de, 0xe67: 0x10e2, 0xe68: 0x10f2, 0xe69: 0x1106,
+	0xe6a: 0x1102, 0xe6b: 0x1132, 0xe6c: 0x11ae, 0xe6d: 0x11c6, 0xe6e: 0x11de, 0xe6f: 0x1216,
+	0xe70: 0x122a, 0xe71: 0x1246, 0xe72: 0x1276, 0xe73: 0x132a, 0xe74: 0x1352, 0xe75: 0x13c6,
+	0xe76: 0x140e, 0xe77: 0x141a, 0xe78: 0x1422, 0xe79: 0x143a, 0xe7a: 0x144e, 0xe7b: 0x143e,
+	0xe7c: 0x1456, 0xe7d: 0x1452, 0xe7e: 0x144a, 0xe7f: 0x145a,
+	// Block 0x3a, offset 0xe80
+	0xe80: 0x1466, 0xe81: 0x14a2, 0xe82: 0x14de, 0xe83: 0x150e, 0xe84: 0x1546, 0xe85: 0x1566,
+	0xe86: 0x15b2, 0xe87: 0x15d6, 0xe88: 0x15f6, 0xe89: 0x160a, 0xe8a: 0x161a, 0xe8b: 0x1626,
+	0xe8c: 0x1632, 0xe8d: 0x1686, 0xe8e: 0x1726, 0xe8f: 0x17e2, 0xe90: 0x17dd, 0xe91: 0x180f,
+	0xe92: 0x0702, 0xe93: 0x072a, 0xe94: 0x072e, 0xe95: 0x1891, 0xe96: 0x18be, 0xe97: 0x1936,
+	0xe98: 0x1712, 0xe99: 0x1722,
+	// Block 0x3b, offset 0xec0
+	0xec0: 0x1b05, 0xec1: 0x1b08, 0xec2: 0x1b0b, 0xec3: 0x1d38, 0xec4: 0x1d3c, 0xec5: 0x1b8f,
+	0xec6: 0x1b8f,
+	0xed3: 0x1ea5, 0xed4: 0x1e96, 0xed5: 0x1e9b, 0xed6: 0x1eaa, 0xed7: 0x1ea0,
+	0xedd: 0x44d1,
+	0xede: 0x8116, 0xedf: 0x4543, 0xee0: 0x0320, 0xee1: 0x0308, 0xee2: 0x0311, 0xee3: 0x0314,
+	0xee4: 0x0317, 0xee5: 0x031a, 0xee6: 0x031d, 0xee7: 0x0323, 0xee8: 0x0326, 0xee9: 0x0017,
+	0xeea: 0x4531, 0xeeb: 0x4537, 0xeec: 0x4635, 0xeed: 0x463d, 0xeee: 0x4489, 0xeef: 0x448f,
+	0xef0: 0x4495, 0xef1: 0x449b, 0xef2: 0x44a7, 0xef3: 0x44ad, 0xef4: 0x44b3, 0xef5: 0x44bf,
+	0xef6: 0x44c5, 0xef8: 0x44cb, 0xef9: 0x44d7, 0xefa: 0x44dd, 0xefb: 0x44e3,
+	0xefc: 0x44ef, 0xefe: 0x44f5,
+	// Block 0x3c, offset 0xf00
+	0xf00: 0x44fb, 0xf01: 0x4501, 0xf03: 0x4507, 0xf04: 0x450d,
+	0xf06: 0x4519, 0xf07: 0x451f, 0xf08: 0x4525, 0xf09: 0x452b, 0xf0a: 0x453d, 0xf0b: 0x44b9,
+	0xf0c: 0x44a1, 0xf0d: 0x44e9, 0xf0e: 0x4513, 0xf0f: 0x1eaf, 0xf10: 0x038c, 0xf11: 0x038c,
+	0xf12: 0x0395, 0xf13: 0x0395, 0xf14: 0x0395, 0xf15: 0x0395, 0xf16: 0x0398, 0xf17: 0x0398,
+	0xf18: 0x0398, 0xf19: 0x0398, 0xf1a: 0x039e, 0xf1b: 0x039e, 0xf1c: 0x039e, 0xf1d: 0x039e,
+	0xf1e: 0x0392, 0xf1f: 0x0392, 0xf20: 0x0392, 0xf21: 0x0392, 0xf22: 0x039b, 0xf23: 0x039b,
+	0xf24: 0x039b, 0xf25: 0x039b, 0xf26: 0x038f, 0xf27: 0x038f, 0xf28: 0x038f, 0xf29: 0x038f,
+	0xf2a: 0x03c2, 0xf2b: 0x03c2, 0xf2c: 0x03c2, 0xf2d: 0x03c2, 0xf2e: 0x03c5, 0xf2f: 0x03c5,
+	0xf30: 0x03c5, 0xf31: 0x03c5, 0xf32: 0x03a4, 0xf33: 0x03a4, 0xf34: 0x03a4, 0xf35: 0x03a4,
+	0xf36: 0x03a1, 0xf37: 0x03a1, 0xf38: 0x03a1, 0xf39: 0x03a1, 0xf3a: 0x03a7, 0xf3b: 0x03a7,
+	0xf3c: 0x03a7, 0xf3d: 0x03a7, 0xf3e: 0x03aa, 0xf3f: 0x03aa,
+	// Block 0x3d, offset 0xf40
+	0xf40: 0x03aa, 0xf41: 0x03aa, 0xf42: 0x03b3, 0xf43: 0x03b3, 0xf44: 0x03b0, 0xf45: 0x03b0,
+	0xf46: 0x03b6, 0xf47: 0x03b6, 0xf48: 0x03ad, 0xf49: 0x03ad, 0xf4a: 0x03bc, 0xf4b: 0x03bc,
+	0xf4c: 0x03b9, 0xf4d: 0x03b9, 0xf4e: 0x03c8, 0xf4f: 0x03c8, 0xf50: 0x03c8, 0xf51: 0x03c8,
+	0xf52: 0x03ce, 0xf53: 0x03ce, 0xf54: 0x03ce, 0xf55: 0x03ce, 0xf56: 0x03d4, 0xf57: 0x03d4,
+	0xf58: 0x03d4, 0xf59: 0x03d4, 0xf5a: 0x03d1, 0xf5b: 0x03d1, 0xf5c: 0x03d1, 0xf5d: 0x03d1,
+	0xf5e: 0x03d7, 0xf5f: 0x03d7, 0xf60: 0x03da, 0xf61: 0x03da, 0xf62: 0x03da, 0xf63: 0x03da,
+	0xf64: 0x45af, 0xf65: 0x45af, 0xf66: 0x03e0, 0xf67: 0x03e0, 0xf68: 0x03e0, 0xf69: 0x03e0,
+	0xf6a: 0x03dd, 0xf6b: 0x03dd, 0xf6c: 0x03dd, 0xf6d: 0x03dd, 0xf6e: 0x03fb, 0xf6f: 0x03fb,
+	0xf70: 0x45a9, 0xf71: 0x45a9,
+	// Block 0x3e, offset 0xf80
+	0xf93: 0x03cb, 0xf94: 0x03cb, 0xf95: 0x03cb, 0xf96: 0x03cb, 0xf97: 0x03e9,
+	0xf98: 0x03e9, 0xf99: 0x03e6, 0xf9a: 0x03e6, 0xf9b: 0x03ec, 0xf9c: 0x03ec, 0xf9d: 0x217f,
+	0xf9e: 0x03f2, 0xf9f: 0x03f2, 0xfa0: 0x03e3, 0xfa1: 0x03e3, 0xfa2: 0x03ef, 0xfa3: 0x03ef,
+	0xfa4: 0x03f8, 0xfa5: 0x03f8, 0xfa6: 0x03f8, 0xfa7: 0x03f8, 0xfa8: 0x0380, 0xfa9: 0x0380,
+	0xfaa: 0x26da, 0xfab: 0x26da, 0xfac: 0x274a, 0xfad: 0x274a, 0xfae: 0x2719, 0xfaf: 0x2719,
+	0xfb0: 0x2735, 0xfb1: 0x2735, 0xfb2: 0x272e, 0xfb3: 0x272e, 0xfb4: 0x273c, 0xfb5: 0x273c,
+	0xfb6: 0x2743, 0xfb7: 0x2743, 0xfb8: 0x2743, 0xfb9: 0x2720, 0xfba: 0x2720, 0xfbb: 0x2720,
+	0xfbc: 0x03f5, 0xfbd: 0x03f5, 0xfbe: 0x03f5, 0xfbf: 0x03f5,
+	// Block 0x3f, offset 0xfc0
+	0xfc0: 0x26e1, 0xfc1: 0x26e8, 0xfc2: 0x2704, 0xfc3: 0x2720, 0xfc4: 0x2727, 0xfc5: 0x1eb9,
+	0xfc6: 0x1ebe, 0xfc7: 0x1ec3, 0xfc8: 0x1ed2, 0xfc9: 0x1ee1, 0xfca: 0x1ee6, 0xfcb: 0x1eeb,
+	0xfcc: 0x1ef0, 0xfcd: 0x1ef5, 0xfce: 0x1f04, 0xfcf: 0x1f13, 0xfd0: 0x1f18, 0xfd1: 0x1f1d,
+	0xfd2: 0x1f2c, 0xfd3: 0x1f3b, 0xfd4: 0x1f40, 0xfd5: 0x1f45, 0xfd6: 0x1f4a, 0xfd7: 0x1f59,
+	0xfd8: 0x1f5e, 0xfd9: 0x1f6d, 0xfda: 0x1f72, 0xfdb: 0x1f77, 0xfdc: 0x1f86, 0xfdd: 0x1f8b,
+	0xfde: 0x1f90, 0xfdf: 0x1f9a, 0xfe0: 0x1fd6, 0xfe1: 0x1fe5, 0xfe2: 0x1ff4, 0xfe3: 0x1ff9,
+	0xfe4: 0x1ffe, 0xfe5: 0x2008, 0xfe6: 0x2017, 0xfe7: 0x201c, 0xfe8: 0x202b, 0xfe9: 0x2030,
+	0xfea: 0x2035, 0xfeb: 0x2044, 0xfec: 0x2049, 0xfed: 0x2058, 0xfee: 0x205d, 0xfef: 0x2062,
+	0xff0: 0x2067, 0xff1: 0x206c, 0xff2: 0x2071, 0xff3: 0x2076, 0xff4: 0x207b, 0xff5: 0x2080,
+	0xff6: 0x2085, 0xff7: 0x208a, 0xff8: 0x208f, 0xff9: 0x2094, 0xffa: 0x2099, 0xffb: 0x209e,
+	0xffc: 0x20a3, 0xffd: 0x20a8, 0xffe: 0x20ad, 0xfff: 0x20b7,
+	// Block 0x40, offset 0x1000
+	0x1000: 0x20bc, 0x1001: 0x20c1, 0x1002: 0x20c6, 0x1003: 0x20d0, 0x1004: 0x20d5, 0x1005: 0x20df,
+	0x1006: 0x20e4, 0x1007: 0x20e9, 0x1008: 0x20ee, 0x1009: 0x20f3, 0x100a: 0x20f8, 0x100b: 0x20fd,
+	0x100c: 0x2102, 0x100d: 0x2107, 0x100e: 0x2116, 0x100f: 0x2125, 0x1010: 0x212a, 0x1011: 0x212f,
+	0x1012: 0x2134, 0x1013: 0x2139, 0x1014: 0x213e, 0x1015: 0x2148, 0x1016: 0x214d, 0x1017: 0x2152,
+	0x1018: 0x2161, 0x1019: 0x2170, 0x101a: 0x2175, 0x101b: 0x4561, 0x101c: 0x4567, 0x101d: 0x459d,
+	0x101e: 0x45f4, 0x101f: 0x45fb, 0x1020: 0x4602, 0x1021: 0x4609, 0x1022: 0x4610, 0x1023: 0x4617,
+	0x1024: 0x26f6, 0x1025: 0x26fd, 0x1026: 0x2704, 0x1027: 0x270b, 0x1028: 0x2720, 0x1029: 0x2727,
+	0x102a: 0x1ec8, 0x102b: 0x1ecd, 0x102c: 0x1ed2, 0x102d: 0x1ed7, 0x102e: 0x1ee1, 0x102f: 0x1ee6,
+	0x1030: 0x1efa, 0x1031: 0x1eff, 0x1032: 0x1f04, 0x1033: 0x1f09, 0x1034: 0x1f13, 0x1035: 0x1f18,
+	0x1036: 0x1f22, 0x1037: 0x1f27, 0x1038: 0x1f2c, 0x1039: 0x1f31, 0x103a: 0x1f3b, 0x103b: 0x1f40,
+	0x103c: 0x206c, 0x103d: 0x2071, 0x103e: 0x2080, 0x103f: 0x2085,
+	// Block 0x41, offset 0x1040
+	0x1040: 0x208a, 0x1041: 0x209e, 0x1042: 0x20a3, 0x1043: 0x20a8, 0x1044: 0x20ad, 0x1045: 0x20c6,
+	0x1046: 0x20d0, 0x1047: 0x20d5, 0x1048: 0x20da, 0x1049: 0x20ee, 0x104a: 0x210c, 0x104b: 0x2111,
+	0x104c: 0x2116, 0x104d: 0x211b, 0x104e: 0x2125, 0x104f: 0x212a, 0x1050: 0x459d, 0x1051: 0x2157,
+	0x1052: 0x215c, 0x1053: 0x2161, 0x1054: 0x2166, 0x1055: 0x2170, 0x1056: 0x2175, 0x1057: 0x26e1,
+	0x1058: 0x26e8, 0x1059: 0x26ef, 0x105a: 0x2704, 0x105b: 0x2712, 0x105c: 0x1eb9, 0x105d: 0x1ebe,
+	0x105e: 0x1ec3, 0x105f: 0x1ed2, 0x1060: 0x1edc, 0x1061: 0x1eeb, 0x1062: 0x1ef0, 0x1063: 0x1ef5,
+	0x1064: 0x1f04, 0x1065: 0x1f0e, 0x1066: 0x1f2c, 0x1067: 0x1f45, 0x1068: 0x1f4a, 0x1069: 0x1f59,
+	0x106a: 0x1f5e, 0x106b: 0x1f6d, 0x106c: 0x1f77, 0x106d: 0x1f86, 0x106e: 0x1f8b, 0x106f: 0x1f90,
+	0x1070: 0x1f9a, 0x1071: 0x1fd6, 0x1072: 0x1fdb, 0x1073: 0x1fe5, 0x1074: 0x1ff4, 0x1075: 0x1ff9,
+	0x1076: 0x1ffe, 0x1077: 0x2008, 0x1078: 0x2017, 0x1079: 0x202b, 0x107a: 0x2030, 0x107b: 0x2035,
+	0x107c: 0x2044, 0x107d: 0x2049, 0x107e: 0x2058, 0x107f: 0x205d,
+	// Block 0x42, offset 0x1080
+	0x1080: 0x2062, 0x1081: 0x2067, 0x1082: 0x2076, 0x1083: 0x207b, 0x1084: 0x208f, 0x1085: 0x2094,
+	0x1086: 0x2099, 0x1087: 0x209e, 0x1088: 0x20a3, 0x1089: 0x20b7, 0x108a: 0x20bc, 0x108b: 0x20c1,
+	0x108c: 0x20c6, 0x108d: 0x20cb, 0x108e: 0x20df, 0x108f: 0x20e4, 0x1090: 0x20e9, 0x1091: 0x20ee,
+	0x1092: 0x20fd, 0x1093: 0x2102, 0x1094: 0x2107, 0x1095: 0x2116, 0x1096: 0x2120, 0x1097: 0x212f,
+	0x1098: 0x2134, 0x1099: 0x4591, 0x109a: 0x2148, 0x109b: 0x214d, 0x109c: 0x2152, 0x109d: 0x2161,
+	0x109e: 0x216b, 0x109f: 0x2704, 0x10a0: 0x2712, 0x10a1: 0x1ed2, 0x10a2: 0x1edc, 0x10a3: 0x1f04,
+	0x10a4: 0x1f0e, 0x10a5: 0x1f2c, 0x10a6: 0x1f36, 0x10a7: 0x1f9a, 0x10a8: 0x1f9f, 0x10a9: 0x1fc2,
+	0x10aa: 0x1fc7, 0x10ab: 0x209e, 0x10ac: 0x20a3, 0x10ad: 0x20c6, 0x10ae: 0x2116, 0x10af: 0x2120,
+	0x10b0: 0x2161, 0x10b1: 0x216b, 0x10b2: 0x4645, 0x10b3: 0x464d, 0x10b4: 0x4655, 0x10b5: 0x2021,
+	0x10b6: 0x2026, 0x10b7: 0x203a, 0x10b8: 0x203f, 0x10b9: 0x204e, 0x10ba: 0x2053, 0x10bb: 0x1fa4,
+	0x10bc: 0x1fa9, 0x10bd: 0x1fcc, 0x10be: 0x1fd1, 0x10bf: 0x1f63,
+	// Block 0x43, offset 0x10c0
+	0x10c0: 0x1f68, 0x10c1: 0x1f4f, 0x10c2: 0x1f54, 0x10c3: 0x1f7c, 0x10c4: 0x1f81, 0x10c5: 0x1fea,
+	0x10c6: 0x1fef, 0x10c7: 0x200d, 0x10c8: 0x2012, 0x10c9: 0x1fae, 0x10ca: 0x1fb3, 0x10cb: 0x1fb8,
+	0x10cc: 0x1fc2, 0x10cd: 0x1fbd, 0x10ce: 0x1f95, 0x10cf: 0x1fe0, 0x10d0: 0x2003, 0x10d1: 0x2021,
+	0x10d2: 0x2026, 0x10d3: 0x203a, 0x10d4: 0x203f, 0x10d5: 0x204e, 0x10d6: 0x2053, 0x10d7: 0x1fa4,
+	0x10d8: 0x1fa9, 0x10d9: 0x1fcc, 0x10da: 0x1fd1, 0x10db: 0x1f63, 0x10dc: 0x1f68, 0x10dd: 0x1f4f,
+	0x10de: 0x1f54, 0x10df: 0x1f7c, 0x10e0: 0x1f81, 0x10e1: 0x1fea, 0x10e2: 0x1fef, 0x10e3: 0x200d,
+	0x10e4: 0x2012, 0x10e5: 0x1fae, 0x10e6: 0x1fb3, 0x10e7: 0x1fb8, 0x10e8: 0x1fc2, 0x10e9: 0x1fbd,
+	0x10ea: 0x1f95, 0x10eb: 0x1fe0, 0x10ec: 0x2003, 0x10ed: 0x1fae, 0x10ee: 0x1fb3, 0x10ef: 0x1fb8,
+	0x10f0: 0x1fc2, 0x10f1: 0x1f9f, 0x10f2: 0x1fc7, 0x10f3: 0x201c, 0x10f4: 0x1f86, 0x10f5: 0x1f8b,
+	0x10f6: 0x1f90, 0x10f7: 0x1fae, 0x10f8: 0x1fb3, 0x10f9: 0x1fb8, 0x10fa: 0x201c, 0x10fb: 0x202b,
+	0x10fc: 0x4549, 0x10fd: 0x4549,
+	// Block 0x44, offset 0x1100
+	0x1110: 0x2441, 0x1111: 0x2456,
+	0x1112: 0x2456, 0x1113: 0x245d, 0x1114: 0x2464, 0x1115: 0x2479, 0x1116: 0x2480, 0x1117: 0x2487,
+	0x1118: 0x24aa, 0x1119: 0x24aa, 0x111a: 0x24cd, 0x111b: 0x24c6, 0x111c: 0x24e2, 0x111d: 0x24d4,
+	0x111e: 0x24db, 0x111f: 0x24fe, 0x1120: 0x24fe, 0x1121: 0x24f7, 0x1122: 0x2505, 0x1123: 0x2505,
+	0x1124: 0x252f, 0x1125: 0x252f, 0x1126: 0x254b, 0x1127: 0x2513, 0x1128: 0x2513, 0x1129: 0x250c,
+	0x112a: 0x2521, 0x112b: 0x2521, 0x112c: 0x2528, 0x112d: 0x2528, 0x112e: 0x2552, 0x112f: 0x2560,
+	0x1130: 0x2560, 0x1131: 0x2567, 0x1132: 0x2567, 0x1133: 0x256e, 0x1134: 0x2575, 0x1135: 0x257c,
+	0x1136: 0x2583, 0x1137: 0x2583, 0x1138: 0x258a, 0x1139: 0x2598, 0x113a: 0x25a6, 0x113b: 0x259f,
+	0x113c: 0x25ad, 0x113d: 0x25ad, 0x113e: 0x25c2, 0x113f: 0x25c9,
+	// Block 0x45, offset 0x1140
+	0x1140: 0x25fa, 0x1141: 0x2608, 0x1142: 0x2601, 0x1143: 0x25e5, 0x1144: 0x25e5, 0x1145: 0x260f,
+	0x1146: 0x260f, 0x1147: 0x2616, 0x1148: 0x2616, 0x1149: 0x2640, 0x114a: 0x2647, 0x114b: 0x264e,
+	0x114c: 0x2624, 0x114d: 0x2632, 0x114e: 0x2655, 0x114f: 0x265c,
+	0x1152: 0x262b, 0x1153: 0x26b0, 0x1154: 0x26b7, 0x1155: 0x268d, 0x1156: 0x2694, 0x1157: 0x2678,
+	0x1158: 0x2678, 0x1159: 0x267f, 0x115a: 0x26a9, 0x115b: 0x26a2, 0x115c: 0x26cc, 0x115d: 0x26cc,
+	0x115e: 0x243a, 0x115f: 0x244f, 0x1160: 0x2448, 0x1161: 0x2472, 0x1162: 0x246b, 0x1163: 0x2495,
+	0x1164: 0x248e, 0x1165: 0x24b8, 0x1166: 0x249c, 0x1167: 0x24b1, 0x1168: 0x24e9, 0x1169: 0x2536,
+	0x116a: 0x251a, 0x116b: 0x2559, 0x116c: 0x25f3, 0x116d: 0x261d, 0x116e: 0x26c5, 0x116f: 0x26be,
+	0x1170: 0x26d3, 0x1171: 0x266a, 0x1172: 0x25d0, 0x1173: 0x269b, 0x1174: 0x25c2, 0x1175: 0x25fa,
+	0x1176: 0x2591, 0x1177: 0x25de, 0x1178: 0x2671, 0x1179: 0x2663, 0x117a: 0x25ec, 0x117b: 0x25d7,
+	0x117c: 0x25ec, 0x117d: 0x2671, 0x117e: 0x24a3, 0x117f: 0x24bf,
+	// Block 0x46, offset 0x1180
+	0x1180: 0x2639, 0x1181: 0x25b4, 0x1182: 0x2433, 0x1183: 0x25d7, 0x1184: 0x257c, 0x1185: 0x254b,
+	0x1186: 0x24f0, 0x1187: 0x2686,
+	0x11b0: 0x2544, 0x11b1: 0x25bb, 0x11b2: 0x28f6, 0x11b3: 0x28ed, 0x11b4: 0x2923, 0x11b5: 0x2911,
+	0x11b6: 0x28ff, 0x11b7: 0x291a, 0x11b8: 0x292c, 0x11b9: 0x253d, 0x11ba: 0x2db3, 0x11bb: 0x2c33,
+	0x11bc: 0x2908,
+	// Block 0x47, offset 0x11c0
+	0x11d0: 0x0019, 0x11d1: 0x057e,
+	0x11d2: 0x0582, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x05ba,
+	0x11d8: 0x05be, 0x11d9: 0x1c8c,
+	0x11e0: 0x8133, 0x11e1: 0x8133, 0x11e2: 0x8133, 0x11e3: 0x8133,
+	0x11e4: 0x8133, 0x11e5: 0x8133, 0x11e6: 0x8133, 0x11e7: 0x812e, 0x11e8: 0x812e, 0x11e9: 0x812e,
+	0x11ea: 0x812e, 0x11eb: 0x812e, 0x11ec: 0x812e, 0x11ed: 0x812e, 0x11ee: 0x8133, 0x11ef: 0x8133,
+	0x11f0: 0x19a0, 0x11f1: 0x053a, 0x11f2: 0x0536, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011,
+	0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x05b2, 0x11fa: 0x05b6, 0x11fb: 0x05a6,
+	0x11fc: 0x05aa, 0x11fd: 0x058e, 0x11fe: 0x0592, 0x11ff: 0x0586,
+	// Block 0x48, offset 0x1200
+	0x1200: 0x058a, 0x1201: 0x0596, 0x1202: 0x059a, 0x1203: 0x059e, 0x1204: 0x05a2,
+	0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x43aa, 0x120a: 0x43aa, 0x120b: 0x43aa,
+	0x120c: 0x43aa, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x057e,
+	0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003,
+	0x1218: 0x053a, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x05b2,
+	0x121e: 0x05b6, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b,
+	0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009,
+	0x122a: 0x000b, 0x122b: 0x0041,
+	0x1230: 0x43eb, 0x1231: 0x456d, 0x1232: 0x43f0, 0x1234: 0x43f5,
+	0x1236: 0x43fa, 0x1237: 0x4573, 0x1238: 0x43ff, 0x1239: 0x4579, 0x123a: 0x4404, 0x123b: 0x457f,
+	0x123c: 0x4409, 0x123d: 0x4585, 0x123e: 0x440e, 0x123f: 0x458b,
+	// Block 0x49, offset 0x1240
+	0x1240: 0x0329, 0x1241: 0x454f, 0x1242: 0x454f, 0x1243: 0x4555, 0x1244: 0x4555, 0x1245: 0x4597,
+	0x1246: 0x4597, 0x1247: 0x455b, 0x1248: 0x455b, 0x1249: 0x45a3, 0x124a: 0x45a3, 0x124b: 0x45a3,
+	0x124c: 0x45a3, 0x124d: 0x032c, 0x124e: 0x032c, 0x124f: 0x032f, 0x1250: 0x032f, 0x1251: 0x032f,
+	0x1252: 0x032f, 0x1253: 0x0332, 0x1254: 0x0332, 0x1255: 0x0335, 0x1256: 0x0335, 0x1257: 0x0335,
+	0x1258: 0x0335, 0x1259: 0x0338, 0x125a: 0x0338, 0x125b: 0x0338, 0x125c: 0x0338, 0x125d: 0x033b,
+	0x125e: 0x033b, 0x125f: 0x033b, 0x1260: 0x033b, 0x1261: 0x033e, 0x1262: 0x033e, 0x1263: 0x033e,
+	0x1264: 0x033e, 0x1265: 0x0341, 0x1266: 0x0341, 0x1267: 0x0341, 0x1268: 0x0341, 0x1269: 0x0344,
+	0x126a: 0x0344, 0x126b: 0x0347, 0x126c: 0x0347, 0x126d: 0x034a, 0x126e: 0x034a, 0x126f: 0x034d,
+	0x1270: 0x034d, 0x1271: 0x0350, 0x1272: 0x0350, 0x1273: 0x0350, 0x1274: 0x0350, 0x1275: 0x0353,
+	0x1276: 0x0353, 0x1277: 0x0353, 0x1278: 0x0353, 0x1279: 0x0356, 0x127a: 0x0356, 0x127b: 0x0356,
+	0x127c: 0x0356, 0x127d: 0x0359, 0x127e: 0x0359, 0x127f: 0x0359,
+	// Block 0x4a, offset 0x1280
+	0x1280: 0x0359, 0x1281: 0x035c, 0x1282: 0x035c, 0x1283: 0x035c, 0x1284: 0x035c, 0x1285: 0x035f,
+	0x1286: 0x035f, 0x1287: 0x035f, 0x1288: 0x035f, 0x1289: 0x0362, 0x128a: 0x0362, 0x128b: 0x0362,
+	0x128c: 0x0362, 0x128d: 0x0365, 0x128e: 0x0365, 0x128f: 0x0365, 0x1290: 0x0365, 0x1291: 0x0368,
+	0x1292: 0x0368, 0x1293: 0x0368, 0x1294: 0x0368, 0x1295: 0x036b, 0x1296: 0x036b, 0x1297: 0x036b,
+	0x1298: 0x036b, 0x1299: 0x036e, 0x129a: 0x036e, 0x129b: 0x036e, 0x129c: 0x036e, 0x129d: 0x0371,
+	0x129e: 0x0371, 0x129f: 0x0371, 0x12a0: 0x0371, 0x12a1: 0x0374, 0x12a2: 0x0374, 0x12a3: 0x0374,
+	0x12a4: 0x0374, 0x12a5: 0x0377, 0x12a6: 0x0377, 0x12a7: 0x0377, 0x12a8: 0x0377, 0x12a9: 0x037a,
+	0x12aa: 0x037a, 0x12ab: 0x037a, 0x12ac: 0x037a, 0x12ad: 0x037d, 0x12ae: 0x037d, 0x12af: 0x0380,
+	0x12b0: 0x0380, 0x12b1: 0x0383, 0x12b2: 0x0383, 0x12b3: 0x0383, 0x12b4: 0x0383, 0x12b5: 0x2f41,
+	0x12b6: 0x2f41, 0x12b7: 0x2f49, 0x12b8: 0x2f49, 0x12b9: 0x2f51, 0x12ba: 0x2f51, 0x12bb: 0x20b2,
+	0x12bc: 0x20b2,
+	// Block 0x4b, offset 0x12c0
+	0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b,
+	0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097,
+	0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3,
+	0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af,
+	0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb,
+	0x12de: 0x00bd, 0x12df: 0x056e, 0x12e0: 0x0572, 0x12e1: 0x0582, 0x12e2: 0x0596, 0x12e3: 0x059a,
+	0x12e4: 0x057e, 0x12e5: 0x06a6, 0x12e6: 0x069e, 0x12e7: 0x05c2, 0x12e8: 0x05ca, 0x12e9: 0x05d2,
+	0x12ea: 0x05da, 0x12eb: 0x05e2, 0x12ec: 0x0666, 0x12ed: 0x066e, 0x12ee: 0x0676, 0x12ef: 0x061a,
+	0x12f0: 0x06aa, 0x12f1: 0x05c6, 0x12f2: 0x05ce, 0x12f3: 0x05d6, 0x12f4: 0x05de, 0x12f5: 0x05e6,
+	0x12f6: 0x05ea, 0x12f7: 0x05ee, 0x12f8: 0x05f2, 0x12f9: 0x05f6, 0x12fa: 0x05fa, 0x12fb: 0x05fe,
+	0x12fc: 0x0602, 0x12fd: 0x0606, 0x12fe: 0x060a, 0x12ff: 0x060e,
+	// Block 0x4c, offset 0x1300
+	0x1300: 0x0612, 0x1301: 0x0616, 0x1302: 0x061e, 0x1303: 0x0622, 0x1304: 0x0626, 0x1305: 0x062a,
+	0x1306: 0x062e, 0x1307: 0x0632, 0x1308: 0x0636, 0x1309: 0x063a, 0x130a: 0x063e, 0x130b: 0x0642,
+	0x130c: 0x0646, 0x130d: 0x064a, 0x130e: 0x064e, 0x130f: 0x0652, 0x1310: 0x0656, 0x1311: 0x065a,
+	0x1312: 0x065e, 0x1313: 0x0662, 0x1314: 0x066a, 0x1315: 0x0672, 0x1316: 0x067a, 0x1317: 0x067e,
+	0x1318: 0x0682, 0x1319: 0x0686, 0x131a: 0x068a, 0x131b: 0x068e, 0x131c: 0x0692, 0x131d: 0x06a2,
+	0x131e: 0x4bb9, 0x131f: 0x4bbf, 0x1320: 0x04b6, 0x1321: 0x0406, 0x1322: 0x040a, 0x1323: 0x4b7c,
+	0x1324: 0x040e, 0x1325: 0x4b82, 0x1326: 0x4b88, 0x1327: 0x0412, 0x1328: 0x0416, 0x1329: 0x041a,
+	0x132a: 0x4b8e, 0x132b: 0x4b94, 0x132c: 0x4b9a, 0x132d: 0x4ba0, 0x132e: 0x4ba6, 0x132f: 0x4bac,
+	0x1330: 0x045a, 0x1331: 0x041e, 0x1332: 0x0422, 0x1333: 0x0426, 0x1334: 0x046e, 0x1335: 0x042a,
+	0x1336: 0x042e, 0x1337: 0x0432, 0x1338: 0x0436, 0x1339: 0x043a, 0x133a: 0x043e, 0x133b: 0x0442,
+	0x133c: 0x0446, 0x133d: 0x044a, 0x133e: 0x044e,
+	// Block 0x4d, offset 0x1340
+	0x1342: 0x4afe, 0x1343: 0x4b04, 0x1344: 0x4b0a, 0x1345: 0x4b10,
+	0x1346: 0x4b16, 0x1347: 0x4b1c, 0x134a: 0x4b22, 0x134b: 0x4b28,
+	0x134c: 0x4b2e, 0x134d: 0x4b34, 0x134e: 0x4b3a, 0x134f: 0x4b40,
+	0x1352: 0x4b46, 0x1353: 0x4b4c, 0x1354: 0x4b52, 0x1355: 0x4b58, 0x1356: 0x4b5e, 0x1357: 0x4b64,
+	0x135a: 0x4b6a, 0x135b: 0x4b70, 0x135c: 0x4b76,
+	0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x43a5,
+	0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x053e, 0x1368: 0x0562, 0x1369: 0x0542,
+	0x136a: 0x0546, 0x136b: 0x054a, 0x136c: 0x054e, 0x136d: 0x0566, 0x136e: 0x056a,
+	// Block 0x4e, offset 0x1380
+	0x1381: 0x01f1, 0x1382: 0x01f4, 0x1383: 0x00d4, 0x1384: 0x01be, 0x1385: 0x010d,
+	0x1387: 0x01d3, 0x1388: 0x174e, 0x1389: 0x01d9, 0x138a: 0x01d6, 0x138b: 0x0116,
+	0x138c: 0x0119, 0x138d: 0x0526, 0x138e: 0x011c, 0x138f: 0x0128, 0x1390: 0x01e5, 0x1391: 0x013a,
+	0x1392: 0x0134, 0x1393: 0x012e, 0x1394: 0x01c1, 0x1395: 0x00e0, 0x1396: 0x01c4, 0x1397: 0x0143,
+	0x1398: 0x0194, 0x1399: 0x01e8, 0x139a: 0x01eb, 0x139b: 0x0152, 0x139c: 0x1756, 0x139d: 0x1742,
+	0x139e: 0x0158, 0x139f: 0x175b, 0x13a0: 0x01a9, 0x13a1: 0x1760, 0x13a2: 0x00da, 0x13a3: 0x0170,
+	0x13a4: 0x0173, 0x13a5: 0x00a3, 0x13a6: 0x017c, 0x13a7: 0x1765, 0x13a8: 0x0182, 0x13a9: 0x0185,
+	0x13aa: 0x0188, 0x13ab: 0x01e2, 0x13ac: 0x01dc, 0x13ad: 0x1752, 0x13ae: 0x01df, 0x13af: 0x0197,
+	0x13b0: 0x0576, 0x13b2: 0x01ac, 0x13b3: 0x01cd, 0x13b4: 0x01d0, 0x13b5: 0x01bb,
+	0x13b6: 0x00f5, 0x13b7: 0x00f8, 0x13b8: 0x00fb, 0x13b9: 0x176a, 0x13ba: 0x176f,
+	// Block 0x4f, offset 0x13c0
+	0x13c0: 0x0063, 0x13c1: 0x0065, 0x13c2: 0x0067, 0x13c3: 0x0069, 0x13c4: 0x006b, 0x13c5: 0x006d,
+	0x13c6: 0x006f, 0x13c7: 0x0071, 0x13c8: 0x0073, 0x13c9: 0x0075, 0x13ca: 0x0083, 0x13cb: 0x0085,
+	0x13cc: 0x0087, 0x13cd: 0x0089, 0x13ce: 0x008b, 0x13cf: 0x008d, 0x13d0: 0x008f, 0x13d1: 0x0091,
+	0x13d2: 0x0093, 0x13d3: 0x0095, 0x13d4: 0x0097, 0x13d5: 0x0099, 0x13d6: 0x009b, 0x13d7: 0x009d,
+	0x13d8: 0x009f, 0x13d9: 0x00a1, 0x13da: 0x00a3, 0x13db: 0x00a5, 0x13dc: 0x00a7, 0x13dd: 0x00a9,
+	0x13de: 0x00ab, 0x13df: 0x00ad, 0x13e0: 0x00af, 0x13e1: 0x00b1, 0x13e2: 0x00b3, 0x13e3: 0x00b5,
+	0x13e4: 0x00e3, 0x13e5: 0x0101, 0x13e8: 0x01f7, 0x13e9: 0x01fa,
+	0x13ea: 0x01fd, 0x13eb: 0x0200, 0x13ec: 0x0203, 0x13ed: 0x0206, 0x13ee: 0x0209, 0x13ef: 0x020c,
+	0x13f0: 0x020f, 0x13f1: 0x0212, 0x13f2: 0x0215, 0x13f3: 0x0218, 0x13f4: 0x021b, 0x13f5: 0x021e,
+	0x13f6: 0x0221, 0x13f7: 0x0224, 0x13f8: 0x0227, 0x13f9: 0x020c, 0x13fa: 0x022a, 0x13fb: 0x022d,
+	0x13fc: 0x0230, 0x13fd: 0x0233, 0x13fe: 0x0236, 0x13ff: 0x0239,
+	// Block 0x50, offset 0x1400
+	0x1400: 0x0281, 0x1401: 0x0284, 0x1402: 0x0287, 0x1403: 0x0552, 0x1404: 0x024b, 0x1405: 0x0254,
+	0x1406: 0x025a, 0x1407: 0x027e, 0x1408: 0x026f, 0x1409: 0x026c, 0x140a: 0x028a, 0x140b: 0x028d,
+	0x140e: 0x0021, 0x140f: 0x0023, 0x1410: 0x0025, 0x1411: 0x0027,
+	0x1412: 0x0029, 0x1413: 0x002b, 0x1414: 0x002d, 0x1415: 0x002f, 0x1416: 0x0031, 0x1417: 0x0033,
+	0x1418: 0x0021, 0x1419: 0x0023, 0x141a: 0x0025, 0x141b: 0x0027, 0x141c: 0x0029, 0x141d: 0x002b,
+	0x141e: 0x002d, 0x141f: 0x002f, 0x1420: 0x0031, 0x1421: 0x0033, 0x1422: 0x0021, 0x1423: 0x0023,
+	0x1424: 0x0025, 0x1425: 0x0027, 0x1426: 0x0029, 0x1427: 0x002b, 0x1428: 0x002d, 0x1429: 0x002f,
+	0x142a: 0x0031, 0x142b: 0x0033, 0x142c: 0x0021, 0x142d: 0x0023, 0x142e: 0x0025, 0x142f: 0x0027,
+	0x1430: 0x0029, 0x1431: 0x002b, 0x1432: 0x002d, 0x1433: 0x002f, 0x1434: 0x0031, 0x1435: 0x0033,
+	0x1436: 0x0021, 0x1437: 0x0023, 0x1438: 0x0025, 0x1439: 0x0027, 0x143a: 0x0029, 0x143b: 0x002b,
+	0x143c: 0x002d, 0x143d: 0x002f, 0x143e: 0x0031, 0x143f: 0x0033,
+	// Block 0x51, offset 0x1440
+	0x1440: 0x8133, 0x1441: 0x8133, 0x1442: 0x8133, 0x1443: 0x8133, 0x1444: 0x8133, 0x1445: 0x8133,
+	0x1446: 0x8133, 0x1448: 0x8133, 0x1449: 0x8133, 0x144a: 0x8133, 0x144b: 0x8133,
+	0x144c: 0x8133, 0x144d: 0x8133, 0x144e: 0x8133, 0x144f: 0x8133, 0x1450: 0x8133, 0x1451: 0x8133,
+	0x1452: 0x8133, 0x1453: 0x8133, 0x1454: 0x8133, 0x1455: 0x8133, 0x1456: 0x8133, 0x1457: 0x8133,
+	0x1458: 0x8133, 0x145b: 0x8133, 0x145c: 0x8133, 0x145d: 0x8133,
+	0x145e: 0x8133, 0x145f: 0x8133, 0x1460: 0x8133, 0x1461: 0x8133, 0x1463: 0x8133,
+	0x1464: 0x8133, 0x1466: 0x8133, 0x1467: 0x8133, 0x1468: 0x8133, 0x1469: 0x8133,
+	0x146a: 0x8133,
+	0x1470: 0x0290, 0x1471: 0x0293, 0x1472: 0x0296, 0x1473: 0x0299, 0x1474: 0x029c, 0x1475: 0x029f,
+	0x1476: 0x02a2, 0x1477: 0x02a5, 0x1478: 0x02a8, 0x1479: 0x02ab, 0x147a: 0x02ae, 0x147b: 0x02b1,
+	0x147c: 0x02b7, 0x147d: 0x02ba, 0x147e: 0x02bd, 0x147f: 0x02c0,
+	// Block 0x52, offset 0x1480
+	0x1480: 0x02c3, 0x1481: 0x02c6, 0x1482: 0x02c9, 0x1483: 0x02cc, 0x1484: 0x02cf, 0x1485: 0x02d2,
+	0x1486: 0x02d5, 0x1487: 0x02db, 0x1488: 0x02e1, 0x1489: 0x02e4, 0x148a: 0x1736, 0x148b: 0x0302,
+	0x148c: 0x02ea, 0x148d: 0x02ed, 0x148e: 0x0305, 0x148f: 0x02f9, 0x1490: 0x02ff, 0x1491: 0x0290,
+	0x1492: 0x0293, 0x1493: 0x0296, 0x1494: 0x0299, 0x1495: 0x029c, 0x1496: 0x029f, 0x1497: 0x02a2,
+	0x1498: 0x02a5, 0x1499: 0x02a8, 0x149a: 0x02ab, 0x149b: 0x02ae, 0x149c: 0x02b7, 0x149d: 0x02ba,
+	0x149e: 0x02c0, 0x149f: 0x02c6, 0x14a0: 0x02c9, 0x14a1: 0x02cc, 0x14a2: 0x02cf, 0x14a3: 0x02d2,
+	0x14a4: 0x02d5, 0x14a5: 0x02d8, 0x14a6: 0x02db, 0x14a7: 0x02f3, 0x14a8: 0x02ea, 0x14a9: 0x02e7,
+	0x14aa: 0x02f0, 0x14ab: 0x02f6, 0x14ac: 0x1732, 0x14ad: 0x02fc,
+	// Block 0x53, offset 0x14c0
+	0x14c0: 0x032c, 0x14c1: 0x032f, 0x14c2: 0x033b, 0x14c3: 0x0344, 0x14c5: 0x037d,
+	0x14c6: 0x034d, 0x14c7: 0x033e, 0x14c8: 0x035c, 0x14c9: 0x0383, 0x14ca: 0x036e, 0x14cb: 0x0371,
+	0x14cc: 0x0374, 0x14cd: 0x0377, 0x14ce: 0x0350, 0x14cf: 0x0362, 0x14d0: 0x0368, 0x14d1: 0x0356,
+	0x14d2: 0x036b, 0x14d3: 0x034a, 0x14d4: 0x0353, 0x14d5: 0x0335, 0x14d6: 0x0338, 0x14d7: 0x0341,
+	0x14d8: 0x0347, 0x14d9: 0x0359, 0x14da: 0x035f, 0x14db: 0x0365, 0x14dc: 0x0386, 0x14dd: 0x03d7,
+	0x14de: 0x03bf, 0x14df: 0x0389, 0x14e1: 0x032f, 0x14e2: 0x033b,
+	0x14e4: 0x037a, 0x14e7: 0x033e, 0x14e9: 0x0383,
+	0x14ea: 0x036e, 0x14eb: 0x0371, 0x14ec: 0x0374, 0x14ed: 0x0377, 0x14ee: 0x0350, 0x14ef: 0x0362,
+	0x14f0: 0x0368, 0x14f1: 0x0356, 0x14f2: 0x036b, 0x14f4: 0x0353, 0x14f5: 0x0335,
+	0x14f6: 0x0338, 0x14f7: 0x0341, 0x14f9: 0x0359, 0x14fb: 0x0365,
+	// Block 0x54, offset 0x1500
+	0x1502: 0x033b,
+	0x1507: 0x033e, 0x1509: 0x0383, 0x150b: 0x0371,
+	0x150d: 0x0377, 0x150e: 0x0350, 0x150f: 0x0362, 0x1511: 0x0356,
+	0x1512: 0x036b, 0x1514: 0x0353, 0x1517: 0x0341,
+	0x1519: 0x0359, 0x151b: 0x0365, 0x151d: 0x03d7,
+	0x151f: 0x0389, 0x1521: 0x032f, 0x1522: 0x033b,
+	0x1524: 0x037a, 0x1527: 0x033e, 0x1528: 0x035c, 0x1529: 0x0383,
+	0x152a: 0x036e, 0x152c: 0x0374, 0x152d: 0x0377, 0x152e: 0x0350, 0x152f: 0x0362,
+	0x1530: 0x0368, 0x1531: 0x0356, 0x1532: 0x036b, 0x1534: 0x0353, 0x1535: 0x0335,
+	0x1536: 0x0338, 0x1537: 0x0341, 0x1539: 0x0359, 0x153a: 0x035f, 0x153b: 0x0365,
+	0x153c: 0x0386, 0x153e: 0x03bf,
+	// Block 0x55, offset 0x1540
+	0x1540: 0x032c, 0x1541: 0x032f, 0x1542: 0x033b, 0x1543: 0x0344, 0x1544: 0x037a, 0x1545: 0x037d,
+	0x1546: 0x034d, 0x1547: 0x033e, 0x1548: 0x035c, 0x1549: 0x0383, 0x154b: 0x0371,
+	0x154c: 0x0374, 0x154d: 0x0377, 0x154e: 0x0350, 0x154f: 0x0362, 0x1550: 0x0368, 0x1551: 0x0356,
+	0x1552: 0x036b, 0x1553: 0x034a, 0x1554: 0x0353, 0x1555: 0x0335, 0x1556: 0x0338, 0x1557: 0x0341,
+	0x1558: 0x0347, 0x1559: 0x0359, 0x155a: 0x035f, 0x155b: 0x0365,
+	0x1561: 0x032f, 0x1562: 0x033b, 0x1563: 0x0344,
+	0x1565: 0x037d, 0x1566: 0x034d, 0x1567: 0x033e, 0x1568: 0x035c, 0x1569: 0x0383,
+	0x156b: 0x0371, 0x156c: 0x0374, 0x156d: 0x0377, 0x156e: 0x0350, 0x156f: 0x0362,
+	0x1570: 0x0368, 0x1571: 0x0356, 0x1572: 0x036b, 0x1573: 0x034a, 0x1574: 0x0353, 0x1575: 0x0335,
+	0x1576: 0x0338, 0x1577: 0x0341, 0x1578: 0x0347, 0x1579: 0x0359, 0x157a: 0x035f, 0x157b: 0x0365,
+	// Block 0x56, offset 0x1580
+	0x1580: 0x19a6, 0x1581: 0x19a3, 0x1582: 0x19a9, 0x1583: 0x19cd, 0x1584: 0x19f1, 0x1585: 0x1a15,
+	0x1586: 0x1a39, 0x1587: 0x1a42, 0x1588: 0x1a48, 0x1589: 0x1a4e, 0x158a: 0x1a54,
+	0x1590: 0x1bbc, 0x1591: 0x1bc0,
+	0x1592: 0x1bc4, 0x1593: 0x1bc8, 0x1594: 0x1bcc, 0x1595: 0x1bd0, 0x1596: 0x1bd4, 0x1597: 0x1bd8,
+	0x1598: 0x1bdc, 0x1599: 0x1be0, 0x159a: 0x1be4, 0x159b: 0x1be8, 0x159c: 0x1bec, 0x159d: 0x1bf0,
+	0x159e: 0x1bf4, 0x159f: 0x1bf8, 0x15a0: 0x1bfc, 0x15a1: 0x1c00, 0x15a2: 0x1c04, 0x15a3: 0x1c08,
+	0x15a4: 0x1c0c, 0x15a5: 0x1c10, 0x15a6: 0x1c14, 0x15a7: 0x1c18, 0x15a8: 0x1c1c, 0x15a9: 0x1c20,
+	0x15aa: 0x2855, 0x15ab: 0x0047, 0x15ac: 0x0065, 0x15ad: 0x1a69, 0x15ae: 0x1ae1,
+	0x15b0: 0x0043, 0x15b1: 0x0045, 0x15b2: 0x0047, 0x15b3: 0x0049, 0x15b4: 0x004b, 0x15b5: 0x004d,
+	0x15b6: 0x004f, 0x15b7: 0x0051, 0x15b8: 0x0053, 0x15b9: 0x0055, 0x15ba: 0x0057, 0x15bb: 0x0059,
+	0x15bc: 0x005b, 0x15bd: 0x005d, 0x15be: 0x005f, 0x15bf: 0x0061,
+	// Block 0x57, offset 0x15c0
+	0x15c0: 0x27dd, 0x15c1: 0x27f2, 0x15c2: 0x05fe,
+	0x15d0: 0x0d0a, 0x15d1: 0x0b42,
+	0x15d2: 0x09ce, 0x15d3: 0x4705, 0x15d4: 0x0816, 0x15d5: 0x0aea, 0x15d6: 0x142a, 0x15d7: 0x0afa,
+	0x15d8: 0x0822, 0x15d9: 0x0dd2, 0x15da: 0x0faa, 0x15db: 0x0daa, 0x15dc: 0x0922, 0x15dd: 0x0c66,
+	0x15de: 0x08ba, 0x15df: 0x0db2, 0x15e0: 0x090e, 0x15e1: 0x1212, 0x15e2: 0x107e, 0x15e3: 0x1486,
+	0x15e4: 0x0ace, 0x15e5: 0x0a06, 0x15e6: 0x0f5e, 0x15e7: 0x0d16, 0x15e8: 0x0d42, 0x15e9: 0x07ba,
+	0x15ea: 0x07c6, 0x15eb: 0x1506, 0x15ec: 0x0bd6, 0x15ed: 0x07e2, 0x15ee: 0x09ea, 0x15ef: 0x0d36,
+	0x15f0: 0x14ae, 0x15f1: 0x0d0e, 0x15f2: 0x116a, 0x15f3: 0x11a6, 0x15f4: 0x09f2, 0x15f5: 0x0f3e,
+	0x15f6: 0x0e06, 0x15f7: 0x0e02, 0x15f8: 0x1092, 0x15f9: 0x0926, 0x15fa: 0x0a52, 0x15fb: 0x153e,
+	// Block 0x58, offset 0x1600
+	0x1600: 0x07f6, 0x1601: 0x07ee, 0x1602: 0x07fe, 0x1603: 0x1774, 0x1604: 0x0842, 0x1605: 0x0852,
+	0x1606: 0x0856, 0x1607: 0x085e, 0x1608: 0x0866, 0x1609: 0x086a, 0x160a: 0x0876, 0x160b: 0x086e,
+	0x160c: 0x06ae, 0x160d: 0x1788, 0x160e: 0x088a, 0x160f: 0x088e, 0x1610: 0x0892, 0x1611: 0x08ae,
+	0x1612: 0x1779, 0x1613: 0x06b2, 0x1614: 0x089a, 0x1615: 0x08ba, 0x1616: 0x1783, 0x1617: 0x08ca,
+	0x1618: 0x08d2, 0x1619: 0x0832, 0x161a: 0x08da, 0x161b: 0x08de, 0x161c: 0x195e, 0x161d: 0x08fa,
+	0x161e: 0x0902, 0x161f: 0x06ba, 0x1620: 0x091a, 0x1621: 0x091e, 0x1622: 0x0926, 0x1623: 0x092a,
+	0x1624: 0x06be, 0x1625: 0x0942, 0x1626: 0x0946, 0x1627: 0x0952, 0x1628: 0x095e, 0x1629: 0x0962,
+	0x162a: 0x0966, 0x162b: 0x096e, 0x162c: 0x098e, 0x162d: 0x0992, 0x162e: 0x099a, 0x162f: 0x09aa,
+	0x1630: 0x09b2, 0x1631: 0x09b6, 0x1632: 0x09b6, 0x1633: 0x09b6, 0x1634: 0x1797, 0x1635: 0x0f8e,
+	0x1636: 0x09ca, 0x1637: 0x09d2, 0x1638: 0x179c, 0x1639: 0x09de, 0x163a: 0x09e6, 0x163b: 0x09ee,
+	0x163c: 0x0a16, 0x163d: 0x0a02, 0x163e: 0x0a0e, 0x163f: 0x0a12,
+	// Block 0x59, offset 0x1640
+	0x1640: 0x0a1a, 0x1641: 0x0a22, 0x1642: 0x0a26, 0x1643: 0x0a2e, 0x1644: 0x0a36, 0x1645: 0x0a3a,
+	0x1646: 0x0a3a, 0x1647: 0x0a42, 0x1648: 0x0a4a, 0x1649: 0x0a4e, 0x164a: 0x0a5a, 0x164b: 0x0a7e,
+	0x164c: 0x0a62, 0x164d: 0x0a82, 0x164e: 0x0a66, 0x164f: 0x0a6e, 0x1650: 0x0906, 0x1651: 0x0aca,
+	0x1652: 0x0a92, 0x1653: 0x0a96, 0x1654: 0x0a9a, 0x1655: 0x0a8e, 0x1656: 0x0aa2, 0x1657: 0x0a9e,
+	0x1658: 0x0ab6, 0x1659: 0x17a1, 0x165a: 0x0ad2, 0x165b: 0x0ad6, 0x165c: 0x0ade, 0x165d: 0x0aea,
+	0x165e: 0x0af2, 0x165f: 0x0b0e, 0x1660: 0x17a6, 0x1661: 0x17ab, 0x1662: 0x0b1a, 0x1663: 0x0b1e,
+	0x1664: 0x0b22, 0x1665: 0x0b16, 0x1666: 0x0b2a, 0x1667: 0x06c2, 0x1668: 0x06c6, 0x1669: 0x0b32,
+	0x166a: 0x0b3a, 0x166b: 0x0b3a, 0x166c: 0x17b0, 0x166d: 0x0b56, 0x166e: 0x0b5a, 0x166f: 0x0b5e,
+	0x1670: 0x0b66, 0x1671: 0x17b5, 0x1672: 0x0b6e, 0x1673: 0x0b72, 0x1674: 0x0c4a, 0x1675: 0x0b7a,
+	0x1676: 0x06ca, 0x1677: 0x0b86, 0x1678: 0x0b96, 0x1679: 0x0ba2, 0x167a: 0x0b9e, 0x167b: 0x17bf,
+	0x167c: 0x0baa, 0x167d: 0x17c4, 0x167e: 0x0bb6, 0x167f: 0x0bb2,
+	// Block 0x5a, offset 0x1680
+	0x1680: 0x0bba, 0x1681: 0x0bca, 0x1682: 0x0bce, 0x1683: 0x06ce, 0x1684: 0x0bde, 0x1685: 0x0be6,
+	0x1686: 0x0bea, 0x1687: 0x0bee, 0x1688: 0x06d2, 0x1689: 0x17c9, 0x168a: 0x06d6, 0x168b: 0x0c0a,
+	0x168c: 0x0c0e, 0x168d: 0x0c12, 0x168e: 0x0c1a, 0x168f: 0x1990, 0x1690: 0x0c32, 0x1691: 0x17d3,
+	0x1692: 0x17d3, 0x1693: 0x12d2, 0x1694: 0x0c42, 0x1695: 0x0c42, 0x1696: 0x06da, 0x1697: 0x17f6,
+	0x1698: 0x18c8, 0x1699: 0x0c52, 0x169a: 0x0c5a, 0x169b: 0x06de, 0x169c: 0x0c6e, 0x169d: 0x0c7e,
+	0x169e: 0x0c82, 0x169f: 0x0c8a, 0x16a0: 0x0c9a, 0x16a1: 0x06e6, 0x16a2: 0x06e2, 0x16a3: 0x0c9e,
+	0x16a4: 0x17d8, 0x16a5: 0x0ca2, 0x16a6: 0x0cb6, 0x16a7: 0x0cba, 0x16a8: 0x0cbe, 0x16a9: 0x0cba,
+	0x16aa: 0x0cca, 0x16ab: 0x0cce, 0x16ac: 0x0cde, 0x16ad: 0x0cd6, 0x16ae: 0x0cda, 0x16af: 0x0ce2,
+	0x16b0: 0x0ce6, 0x16b1: 0x0cea, 0x16b2: 0x0cf6, 0x16b3: 0x0cfa, 0x16b4: 0x0d12, 0x16b5: 0x0d1a,
+	0x16b6: 0x0d2a, 0x16b7: 0x0d3e, 0x16b8: 0x17e7, 0x16b9: 0x0d3a, 0x16ba: 0x0d2e, 0x16bb: 0x0d46,
+	0x16bc: 0x0d4e, 0x16bd: 0x0d62, 0x16be: 0x17ec, 0x16bf: 0x0d6a,
+	// Block 0x5b, offset 0x16c0
+	0x16c0: 0x0d5e, 0x16c1: 0x0d56, 0x16c2: 0x06ea, 0x16c3: 0x0d72, 0x16c4: 0x0d7a, 0x16c5: 0x0d82,
+	0x16c6: 0x0d76, 0x16c7: 0x06ee, 0x16c8: 0x0d92, 0x16c9: 0x0d9a, 0x16ca: 0x17f1, 0x16cb: 0x0dc6,
+	0x16cc: 0x0dfa, 0x16cd: 0x0dd6, 0x16ce: 0x06fa, 0x16cf: 0x0de2, 0x16d0: 0x06f6, 0x16d1: 0x06f2,
+	0x16d2: 0x08be, 0x16d3: 0x08c2, 0x16d4: 0x0dfe, 0x16d5: 0x0de6, 0x16d6: 0x12a6, 0x16d7: 0x075e,
+	0x16d8: 0x0e0a, 0x16d9: 0x0e0e, 0x16da: 0x0e12, 0x16db: 0x0e26, 0x16dc: 0x0e1e, 0x16dd: 0x180a,
+	0x16de: 0x06fe, 0x16df: 0x0e3a, 0x16e0: 0x0e2e, 0x16e1: 0x0e4a, 0x16e2: 0x0e52, 0x16e3: 0x1814,
+	0x16e4: 0x0e56, 0x16e5: 0x0e42, 0x16e6: 0x0e5e, 0x16e7: 0x0702, 0x16e8: 0x0e62, 0x16e9: 0x0e66,
+	0x16ea: 0x0e6a, 0x16eb: 0x0e76, 0x16ec: 0x1819, 0x16ed: 0x0e7e, 0x16ee: 0x0706, 0x16ef: 0x0e8a,
+	0x16f0: 0x181e, 0x16f1: 0x0e8e, 0x16f2: 0x070a, 0x16f3: 0x0e9a, 0x16f4: 0x0ea6, 0x16f5: 0x0eb2,
+	0x16f6: 0x0eb6, 0x16f7: 0x1823, 0x16f8: 0x17ba, 0x16f9: 0x1828, 0x16fa: 0x0ed6, 0x16fb: 0x182d,
+	0x16fc: 0x0ee2, 0x16fd: 0x0eea, 0x16fe: 0x0eda, 0x16ff: 0x0ef6,
+	// Block 0x5c, offset 0x1700
+	0x1700: 0x0f06, 0x1701: 0x0f16, 0x1702: 0x0f0a, 0x1703: 0x0f0e, 0x1704: 0x0f1a, 0x1705: 0x0f1e,
+	0x1706: 0x1832, 0x1707: 0x0f02, 0x1708: 0x0f36, 0x1709: 0x0f3a, 0x170a: 0x070e, 0x170b: 0x0f4e,
+	0x170c: 0x0f4a, 0x170d: 0x1837, 0x170e: 0x0f2e, 0x170f: 0x0f6a, 0x1710: 0x183c, 0x1711: 0x1841,
+	0x1712: 0x0f6e, 0x1713: 0x0f82, 0x1714: 0x0f7e, 0x1715: 0x0f7a, 0x1716: 0x0712, 0x1717: 0x0f86,
+	0x1718: 0x0f96, 0x1719: 0x0f92, 0x171a: 0x0f9e, 0x171b: 0x177e, 0x171c: 0x0fae, 0x171d: 0x1846,
+	0x171e: 0x0fba, 0x171f: 0x1850, 0x1720: 0x0fce, 0x1721: 0x0fda, 0x1722: 0x0fee, 0x1723: 0x1855,
+	0x1724: 0x1002, 0x1725: 0x1006, 0x1726: 0x185a, 0x1727: 0x185f, 0x1728: 0x1022, 0x1729: 0x1032,
+	0x172a: 0x0716, 0x172b: 0x1036, 0x172c: 0x071a, 0x172d: 0x071a, 0x172e: 0x104e, 0x172f: 0x1052,
+	0x1730: 0x105a, 0x1731: 0x105e, 0x1732: 0x106a, 0x1733: 0x071e, 0x1734: 0x1082, 0x1735: 0x1864,
+	0x1736: 0x109e, 0x1737: 0x1869, 0x1738: 0x10aa, 0x1739: 0x17ce, 0x173a: 0x10ba, 0x173b: 0x186e,
+	0x173c: 0x1873, 0x173d: 0x1878, 0x173e: 0x0722, 0x173f: 0x0726,
+	// Block 0x5d, offset 0x1740
+	0x1740: 0x10f2, 0x1741: 0x1882, 0x1742: 0x187d, 0x1743: 0x1887, 0x1744: 0x188c, 0x1745: 0x10fa,
+	0x1746: 0x10fe, 0x1747: 0x10fe, 0x1748: 0x1106, 0x1749: 0x072e, 0x174a: 0x110a, 0x174b: 0x0732,
+	0x174c: 0x0736, 0x174d: 0x1896, 0x174e: 0x111e, 0x174f: 0x1126, 0x1750: 0x1132, 0x1751: 0x073a,
+	0x1752: 0x189b, 0x1753: 0x1156, 0x1754: 0x18a0, 0x1755: 0x18a5, 0x1756: 0x1176, 0x1757: 0x118e,
+	0x1758: 0x073e, 0x1759: 0x1196, 0x175a: 0x119a, 0x175b: 0x119e, 0x175c: 0x18aa, 0x175d: 0x18af,
+	0x175e: 0x18af, 0x175f: 0x11b6, 0x1760: 0x0742, 0x1761: 0x18b4, 0x1762: 0x11ca, 0x1763: 0x11ce,
+	0x1764: 0x0746, 0x1765: 0x18b9, 0x1766: 0x11ea, 0x1767: 0x074a, 0x1768: 0x11fa, 0x1769: 0x11f2,
+	0x176a: 0x1202, 0x176b: 0x18c3, 0x176c: 0x121a, 0x176d: 0x074e, 0x176e: 0x1226, 0x176f: 0x122e,
+	0x1770: 0x123e, 0x1771: 0x0752, 0x1772: 0x18cd, 0x1773: 0x18d2, 0x1774: 0x0756, 0x1775: 0x18d7,
+	0x1776: 0x1256, 0x1777: 0x18dc, 0x1778: 0x1262, 0x1779: 0x126e, 0x177a: 0x1276, 0x177b: 0x18e1,
+	0x177c: 0x18e6, 0x177d: 0x128a, 0x177e: 0x18eb, 0x177f: 0x1292,
+	// Block 0x5e, offset 0x1780
+	0x1780: 0x17fb, 0x1781: 0x075a, 0x1782: 0x12aa, 0x1783: 0x12ae, 0x1784: 0x0762, 0x1785: 0x12b2,
+	0x1786: 0x0b2e, 0x1787: 0x18f0, 0x1788: 0x18f5, 0x1789: 0x1800, 0x178a: 0x1805, 0x178b: 0x12d2,
+	0x178c: 0x12d6, 0x178d: 0x14ee, 0x178e: 0x0766, 0x178f: 0x1302, 0x1790: 0x12fe, 0x1791: 0x1306,
+	0x1792: 0x093a, 0x1793: 0x130a, 0x1794: 0x130e, 0x1795: 0x1312, 0x1796: 0x131a, 0x1797: 0x18fa,
+	0x1798: 0x1316, 0x1799: 0x131e, 0x179a: 0x1332, 0x179b: 0x1336, 0x179c: 0x1322, 0x179d: 0x133a,
+	0x179e: 0x134e, 0x179f: 0x1362, 0x17a0: 0x132e, 0x17a1: 0x1342, 0x17a2: 0x1346, 0x17a3: 0x134a,
+	0x17a4: 0x18ff, 0x17a5: 0x1909, 0x17a6: 0x1904, 0x17a7: 0x076a, 0x17a8: 0x136a, 0x17a9: 0x136e,
+	0x17aa: 0x1376, 0x17ab: 0x191d, 0x17ac: 0x137a, 0x17ad: 0x190e, 0x17ae: 0x076e, 0x17af: 0x0772,
+	0x17b0: 0x1913, 0x17b1: 0x1918, 0x17b2: 0x0776, 0x17b3: 0x139a, 0x17b4: 0x139e, 0x17b5: 0x13a2,
+	0x17b6: 0x13a6, 0x17b7: 0x13b2, 0x17b8: 0x13ae, 0x17b9: 0x13ba, 0x17ba: 0x13b6, 0x17bb: 0x13c6,
+	0x17bc: 0x13be, 0x17bd: 0x13c2, 0x17be: 0x13ca, 0x17bf: 0x077a,
+	// Block 0x5f, offset 0x17c0
+	0x17c0: 0x13d2, 0x17c1: 0x13d6, 0x17c2: 0x077e, 0x17c3: 0x13e6, 0x17c4: 0x13ea, 0x17c5: 0x1922,
+	0x17c6: 0x13f6, 0x17c7: 0x13fa, 0x17c8: 0x0782, 0x17c9: 0x1406, 0x17ca: 0x06b6, 0x17cb: 0x1927,
+	0x17cc: 0x192c, 0x17cd: 0x0786, 0x17ce: 0x078a, 0x17cf: 0x1432, 0x17d0: 0x144a, 0x17d1: 0x1466,
+	0x17d2: 0x1476, 0x17d3: 0x1931, 0x17d4: 0x148a, 0x17d5: 0x148e, 0x17d6: 0x14a6, 0x17d7: 0x14b2,
+	0x17d8: 0x193b, 0x17d9: 0x178d, 0x17da: 0x14be, 0x17db: 0x14ba, 0x17dc: 0x14c6, 0x17dd: 0x1792,
+	0x17de: 0x14d2, 0x17df: 0x14de, 0x17e0: 0x1940, 0x17e1: 0x1945, 0x17e2: 0x151e, 0x17e3: 0x152a,
+	0x17e4: 0x1532, 0x17e5: 0x194a, 0x17e6: 0x1536, 0x17e7: 0x1562, 0x17e8: 0x156e, 0x17e9: 0x1572,
+	0x17ea: 0x156a, 0x17eb: 0x157e, 0x17ec: 0x1582, 0x17ed: 0x194f, 0x17ee: 0x158e, 0x17ef: 0x078e,
+	0x17f0: 0x1596, 0x17f1: 0x1954, 0x17f2: 0x0792, 0x17f3: 0x15ce, 0x17f4: 0x0bbe, 0x17f5: 0x15e6,
+	0x17f6: 0x1959, 0x17f7: 0x1963, 0x17f8: 0x0796, 0x17f9: 0x079a, 0x17fa: 0x160e, 0x17fb: 0x1968,
+	0x17fc: 0x079e, 0x17fd: 0x196d, 0x17fe: 0x1626, 0x17ff: 0x1626,
+	// Block 0x60, offset 0x1800
+	0x1800: 0x162e, 0x1801: 0x1972, 0x1802: 0x1646, 0x1803: 0x07a2, 0x1804: 0x1656, 0x1805: 0x1662,
+	0x1806: 0x166a, 0x1807: 0x1672, 0x1808: 0x07a6, 0x1809: 0x1977, 0x180a: 0x1686, 0x180b: 0x16a2,
+	0x180c: 0x16ae, 0x180d: 0x07aa, 0x180e: 0x07ae, 0x180f: 0x16b2, 0x1810: 0x197c, 0x1811: 0x07b2,
+	0x1812: 0x1981, 0x1813: 0x1986, 0x1814: 0x198b, 0x1815: 0x16d6, 0x1816: 0x07b6, 0x1817: 0x16ea,
+	0x1818: 0x16f2, 0x1819: 0x16f6, 0x181a: 0x16fe, 0x181b: 0x1706, 0x181c: 0x170e, 0x181d: 0x1995,
+}
+
+// nfkcIndex: 22 blocks, 1408 entries, 2816 bytes
+// Block 0 is the zero block.
+var nfkcIndex = [1408]uint16{
+	// Block 0x0, offset 0x0
+	// Block 0x1, offset 0x40
+	// Block 0x2, offset 0x80
+	// Block 0x3, offset 0xc0
+	0xc2: 0x5f, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x60, 0xc7: 0x04,
+	0xc8: 0x05, 0xca: 0x61, 0xcb: 0x62, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09,
+	0xd0: 0x0a, 0xd1: 0x63, 0xd2: 0x64, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x65,
+	0xd8: 0x66, 0xd9: 0x0d, 0xdb: 0x67, 0xdc: 0x68, 0xdd: 0x69, 0xdf: 0x6a,
+	0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05,
+	0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a,
+	0xf0: 0x13,
+	// Block 0x4, offset 0x100
+	0x120: 0x6b, 0x121: 0x6c, 0x122: 0x6d, 0x123: 0x0e, 0x124: 0x6e, 0x125: 0x6f, 0x126: 0x70, 0x127: 0x71,
+	0x128: 0x72, 0x129: 0x73, 0x12a: 0x74, 0x12b: 0x75, 0x12c: 0x70, 0x12d: 0x76, 0x12e: 0x77, 0x12f: 0x78,
+	0x130: 0x74, 0x131: 0x79, 0x132: 0x7a, 0x133: 0x7b, 0x134: 0x7c, 0x135: 0x7d, 0x137: 0x7e,
+	0x138: 0x7f, 0x139: 0x80, 0x13a: 0x81, 0x13b: 0x82, 0x13c: 0x83, 0x13d: 0x84, 0x13e: 0x85, 0x13f: 0x86,
+	// Block 0x5, offset 0x140
+	0x140: 0x87, 0x142: 0x88, 0x143: 0x89, 0x144: 0x8a, 0x145: 0x8b, 0x146: 0x8c, 0x147: 0x8d,
+	0x14d: 0x8e,
+	0x15c: 0x8f, 0x15f: 0x90,
+	0x162: 0x91, 0x164: 0x92,
+	0x168: 0x93, 0x169: 0x94, 0x16a: 0x95, 0x16b: 0x96, 0x16c: 0x0f, 0x16d: 0x97, 0x16e: 0x98, 0x16f: 0x99,
+	0x170: 0x9a, 0x173: 0x9b, 0x174: 0x9c, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12,
+	0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a,
+	// Block 0x6, offset 0x180
+	0x180: 0x9d, 0x181: 0x9e, 0x182: 0x9f, 0x183: 0xa0, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0xa1, 0x187: 0xa2,
+	0x188: 0xa3, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0xa4, 0x18c: 0xa5,
+	0x191: 0x1f, 0x192: 0x20, 0x193: 0xa6,
+	0x1a8: 0xa7, 0x1a9: 0xa8, 0x1ab: 0xa9,
+	0x1b1: 0xaa, 0x1b3: 0xab, 0x1b5: 0xac, 0x1b7: 0xad,
+	0x1ba: 0xae, 0x1bb: 0xaf, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xb0,
+	// Block 0x7, offset 0x1c0
+	0x1c0: 0xb1, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xb2, 0x1c5: 0x27, 0x1c6: 0x28,
+	0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30,
+	// Block 0x8, offset 0x200
+	0x219: 0xb3, 0x21a: 0xb4, 0x21b: 0xb5, 0x21d: 0xb6, 0x21f: 0xb7,
+	0x220: 0xb8, 0x223: 0xb9, 0x224: 0xba, 0x225: 0xbb, 0x226: 0xbc, 0x227: 0xbd,
+	0x22a: 0xbe, 0x22b: 0xbf, 0x22d: 0xc0, 0x22f: 0xc1,
+	0x230: 0xc2, 0x231: 0xc3, 0x232: 0xc4, 0x233: 0xc5, 0x234: 0xc6, 0x235: 0xc7, 0x236: 0xc8, 0x237: 0xc2,
+	0x238: 0xc3, 0x239: 0xc4, 0x23a: 0xc5, 0x23b: 0xc6, 0x23c: 0xc7, 0x23d: 0xc8, 0x23e: 0xc2, 0x23f: 0xc3,
+	// Block 0x9, offset 0x240
+	0x240: 0xc4, 0x241: 0xc5, 0x242: 0xc6, 0x243: 0xc7, 0x244: 0xc8, 0x245: 0xc2, 0x246: 0xc3, 0x247: 0xc4,
+	0x248: 0xc5, 0x249: 0xc6, 0x24a: 0xc7, 0x24b: 0xc8, 0x24c: 0xc2, 0x24d: 0xc3, 0x24e: 0xc4, 0x24f: 0xc5,
+	0x250: 0xc6, 0x251: 0xc7, 0x252: 0xc8, 0x253: 0xc2, 0x254: 0xc3, 0x255: 0xc4, 0x256: 0xc5, 0x257: 0xc6,
+	0x258: 0xc7, 0x259: 0xc8, 0x25a: 0xc2, 0x25b: 0xc3, 0x25c: 0xc4, 0x25d: 0xc5, 0x25e: 0xc6, 0x25f: 0xc7,
+	0x260: 0xc8, 0x261: 0xc2, 0x262: 0xc3, 0x263: 0xc4, 0x264: 0xc5, 0x265: 0xc6, 0x266: 0xc7, 0x267: 0xc8,
+	0x268: 0xc2, 0x269: 0xc3, 0x26a: 0xc4, 0x26b: 0xc5, 0x26c: 0xc6, 0x26d: 0xc7, 0x26e: 0xc8, 0x26f: 0xc2,
+	0x270: 0xc3, 0x271: 0xc4, 0x272: 0xc5, 0x273: 0xc6, 0x274: 0xc7, 0x275: 0xc8, 0x276: 0xc2, 0x277: 0xc3,
+	0x278: 0xc4, 0x279: 0xc5, 0x27a: 0xc6, 0x27b: 0xc7, 0x27c: 0xc8, 0x27d: 0xc2, 0x27e: 0xc3, 0x27f: 0xc4,
+	// Block 0xa, offset 0x280
+	0x280: 0xc5, 0x281: 0xc6, 0x282: 0xc7, 0x283: 0xc8, 0x284: 0xc2, 0x285: 0xc3, 0x286: 0xc4, 0x287: 0xc5,
+	0x288: 0xc6, 0x289: 0xc7, 0x28a: 0xc8, 0x28b: 0xc2, 0x28c: 0xc3, 0x28d: 0xc4, 0x28e: 0xc5, 0x28f: 0xc6,
+	0x290: 0xc7, 0x291: 0xc8, 0x292: 0xc2, 0x293: 0xc3, 0x294: 0xc4, 0x295: 0xc5, 0x296: 0xc6, 0x297: 0xc7,
+	0x298: 0xc8, 0x299: 0xc2, 0x29a: 0xc3, 0x29b: 0xc4, 0x29c: 0xc5, 0x29d: 0xc6, 0x29e: 0xc7, 0x29f: 0xc8,
+	0x2a0: 0xc2, 0x2a1: 0xc3, 0x2a2: 0xc4, 0x2a3: 0xc5, 0x2a4: 0xc6, 0x2a5: 0xc7, 0x2a6: 0xc8, 0x2a7: 0xc2,
+	0x2a8: 0xc3, 0x2a9: 0xc4, 0x2aa: 0xc5, 0x2ab: 0xc6, 0x2ac: 0xc7, 0x2ad: 0xc8, 0x2ae: 0xc2, 0x2af: 0xc3,
+	0x2b0: 0xc4, 0x2b1: 0xc5, 0x2b2: 0xc6, 0x2b3: 0xc7, 0x2b4: 0xc8, 0x2b5: 0xc2, 0x2b6: 0xc3, 0x2b7: 0xc4,
+	0x2b8: 0xc5, 0x2b9: 0xc6, 0x2ba: 0xc7, 0x2bb: 0xc8, 0x2bc: 0xc2, 0x2bd: 0xc3, 0x2be: 0xc4, 0x2bf: 0xc5,
+	// Block 0xb, offset 0x2c0
+	0x2c0: 0xc6, 0x2c1: 0xc7, 0x2c2: 0xc8, 0x2c3: 0xc2, 0x2c4: 0xc3, 0x2c5: 0xc4, 0x2c6: 0xc5, 0x2c7: 0xc6,
+	0x2c8: 0xc7, 0x2c9: 0xc8, 0x2ca: 0xc2, 0x2cb: 0xc3, 0x2cc: 0xc4, 0x2cd: 0xc5, 0x2ce: 0xc6, 0x2cf: 0xc7,
+	0x2d0: 0xc8, 0x2d1: 0xc2, 0x2d2: 0xc3, 0x2d3: 0xc4, 0x2d4: 0xc5, 0x2d5: 0xc6, 0x2d6: 0xc7, 0x2d7: 0xc8,
+	0x2d8: 0xc2, 0x2d9: 0xc3, 0x2da: 0xc4, 0x2db: 0xc5, 0x2dc: 0xc6, 0x2dd: 0xc7, 0x2de: 0xc9,
+	// Block 0xc, offset 0x300
+	0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34,
+	0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c,
+	0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44,
+	0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xca, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b,
+	// Block 0xd, offset 0x340
+	0x347: 0xcb,
+	0x34b: 0xcc, 0x34d: 0xcd,
+	0x35e: 0x4c,
+	0x368: 0xce, 0x36b: 0xcf,
+	0x374: 0xd0,
+	0x37a: 0xd1, 0x37b: 0xd2, 0x37d: 0xd3, 0x37e: 0xd4,
+	// Block 0xe, offset 0x380
+	0x381: 0xd5, 0x382: 0xd6, 0x384: 0xd7, 0x385: 0xbc, 0x387: 0xd8,
+	0x388: 0xd9, 0x38b: 0xda, 0x38c: 0xdb, 0x38d: 0xdc,
+	0x391: 0xdd, 0x392: 0xde, 0x393: 0xdf, 0x396: 0xe0, 0x397: 0xe1,
+	0x398: 0xe2, 0x39a: 0xe3, 0x39c: 0xe4,
+	0x3a0: 0xe5, 0x3a4: 0xe6, 0x3a5: 0xe7, 0x3a7: 0xe8,
+	0x3a8: 0xe9, 0x3a9: 0xea, 0x3aa: 0xeb,
+	0x3b0: 0xe2, 0x3b5: 0xec, 0x3b6: 0xed,
+	0x3bd: 0xee,
+	// Block 0xf, offset 0x3c0
+	0x3eb: 0xef, 0x3ec: 0xf0,
+	0x3ff: 0xf1,
+	// Block 0x10, offset 0x400
+	0x432: 0xf2,
+	// Block 0x11, offset 0x440
+	0x445: 0xf3, 0x446: 0xf4, 0x447: 0xf5,
+	0x449: 0xf6,
+	0x450: 0xf7, 0x451: 0xf8, 0x452: 0xf9, 0x453: 0xfa, 0x454: 0xfb, 0x455: 0xfc, 0x456: 0xfd, 0x457: 0xfe,
+	0x458: 0xff, 0x459: 0x100, 0x45a: 0x4d, 0x45b: 0x101, 0x45c: 0x102, 0x45d: 0x103, 0x45e: 0x104, 0x45f: 0x4e,
+	// Block 0x12, offset 0x480
+	0x480: 0x4f, 0x481: 0x50, 0x482: 0x105, 0x484: 0xf0,
+	0x48a: 0x106, 0x48b: 0x107,
+	0x493: 0x108,
+	0x4a3: 0x109, 0x4a5: 0x10a,
+	0x4b8: 0x51, 0x4b9: 0x52, 0x4ba: 0x53,
+	// Block 0x13, offset 0x4c0
+	0x4c4: 0x54, 0x4c5: 0x10b, 0x4c6: 0x10c,
+	0x4c8: 0x55, 0x4c9: 0x10d,
+	0x4ef: 0x10e,
+	// Block 0x14, offset 0x500
+	0x520: 0x56, 0x521: 0x57, 0x522: 0x58, 0x523: 0x59, 0x524: 0x5a, 0x525: 0x5b, 0x526: 0x5c, 0x527: 0x5d,
+	0x528: 0x5e,
+	// Block 0x15, offset 0x540
+	0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d,
+	0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11,
+	0x56f: 0x12,
+}
+
+// nfkcSparseOffset: 176 entries, 352 bytes
+var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1c, 0x26, 0x36, 0x38, 0x3d, 0x48, 0x57, 0x64, 0x6c, 0x71, 0x76, 0x78, 0x7c, 0x84, 0x8b, 0x8e, 0x96, 0x9a, 0x9e, 0xa0, 0xa2, 0xab, 0xaf, 0xb6, 0xbb, 0xbe, 0xc8, 0xcb, 0xd2, 0xda, 0xde, 0xe0, 0xe4, 0xe8, 0xee, 0xff, 0x10b, 0x10d, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11d, 0x11f, 0x121, 0x124, 0x127, 0x129, 0x12c, 0x12f, 0x133, 0x139, 0x140, 0x149, 0x14b, 0x14e, 0x150, 0x15b, 0x166, 0x174, 0x182, 0x192, 0x1a0, 0x1a7, 0x1ad, 0x1bc, 0x1c0, 0x1c2, 0x1c6, 0x1c8, 0x1cb, 0x1cd, 0x1d0, 0x1d2, 0x1d5, 0x1d7, 0x1d9, 0x1db, 0x1e7, 0x1f1, 0x1fb, 0x1fe, 0x202, 0x204, 0x206, 0x20b, 0x20e, 0x211, 0x213, 0x215, 0x217, 0x219, 0x21f, 0x222, 0x227, 0x229, 0x230, 0x236, 0x23c, 0x244, 0x24a, 0x250, 0x256, 0x25a, 0x25c, 0x25e, 0x260, 0x262, 0x268, 0x26b, 0x26d, 0x26f, 0x271, 0x277, 0x27b, 0x27f, 0x287, 0x28e, 0x291, 0x294, 0x296, 0x299, 0x2a1, 0x2a5, 0x2ac, 0x2af, 0x2b5, 0x2b7, 0x2b9, 0x2bc, 0x2be, 0x2c1, 0x2c6, 0x2c8, 0x2ca, 0x2cc, 0x2ce, 0x2d0, 0x2d3, 0x2d5, 0x2d7, 0x2d9, 0x2db, 0x2dd, 0x2df, 0x2ec, 0x2f6, 0x2f8, 0x2fa, 0x2fe, 0x303, 0x30f, 0x314, 0x31d, 0x323, 0x328, 0x32c, 0x331, 0x335, 0x345, 0x353, 0x361, 0x36f, 0x371, 0x373, 0x375, 0x379, 0x37b, 0x37e, 0x389, 0x38b, 0x395}
+
+// nfkcSparseValues: 919 entries, 3676 bytes
+var nfkcSparseValues = [919]valueRange{
+	// Block 0x0, offset 0x0
+	{value: 0x0002, lo: 0x0d},
+	{value: 0x0001, lo: 0xa0, hi: 0xa0},
+	{value: 0x43b9, lo: 0xa8, hi: 0xa8},
+	{value: 0x0083, lo: 0xaa, hi: 0xaa},
+	{value: 0x43a5, lo: 0xaf, hi: 0xaf},
+	{value: 0x0025, lo: 0xb2, hi: 0xb3},
+	{value: 0x439b, lo: 0xb4, hi: 0xb4},
+	{value: 0x0260, lo: 0xb5, hi: 0xb5},
+	{value: 0x43d2, lo: 0xb8, hi: 0xb8},
+	{value: 0x0023, lo: 0xb9, hi: 0xb9},
+	{value: 0x009f, lo: 0xba, hi: 0xba},
+	{value: 0x234c, lo: 0xbc, hi: 0xbc},
+	{value: 0x2340, lo: 0xbd, hi: 0xbd},
+	{value: 0x23e2, lo: 0xbe, hi: 0xbe},
+	// Block 0x1, offset 0xe
+	{value: 0x0091, lo: 0x03},
+	{value: 0x4823, lo: 0xa0, hi: 0xa1},
+	{value: 0x4855, lo: 0xaf, hi: 0xb0},
+	{value: 0xa000, lo: 0xb7, hi: 0xb7},
+	// Block 0x2, offset 0x12
+	{value: 0x0004, lo: 0x09},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x0091, lo: 0xb0, hi: 0xb0},
+	{value: 0x0140, lo: 0xb1, hi: 0xb1},
+	{value: 0x0095, lo: 0xb2, hi: 0xb2},
+	{value: 0x00a5, lo: 0xb3, hi: 0xb3},
+	{value: 0x0179, lo: 0xb4, hi: 0xb4},
+	{value: 0x017f, lo: 0xb5, hi: 0xb5},
+	{value: 0x018b, lo: 0xb6, hi: 0xb6},
+	{value: 0x00af, lo: 0xb7, hi: 0xb8},
+	// Block 0x3, offset 0x1c
+	{value: 0x000a, lo: 0x09},
+	{value: 0x43af, lo: 0x98, hi: 0x98},
+	{value: 0x43b4, lo: 0x99, hi: 0x9a},
+	{value: 0x43d7, lo: 0x9b, hi: 0x9b},
+	{value: 0x43a0, lo: 0x9c, hi: 0x9c},
+	{value: 0x43c3, lo: 0x9d, hi: 0x9d},
+	{value: 0x0137, lo: 0xa0, hi: 0xa0},
+	{value: 0x0099, lo: 0xa1, hi: 0xa1},
+	{value: 0x00a7, lo: 0xa2, hi: 0xa3},
+	{value: 0x01b8, lo: 0xa4, hi: 0xa4},
+	// Block 0x4, offset 0x26
+	{value: 0x0000, lo: 0x0f},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0xa000, lo: 0x8d, hi: 0x8d},
+	{value: 0x38e6, lo: 0x90, hi: 0x90},
+	{value: 0x38f2, lo: 0x91, hi: 0x91},
+	{value: 0x38e0, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x96, hi: 0x96},
+	{value: 0x3958, lo: 0x97, hi: 0x97},
+	{value: 0x3922, lo: 0x9c, hi: 0x9c},
+	{value: 0x390a, lo: 0x9d, hi: 0x9d},
+	{value: 0x3934, lo: 0x9e, hi: 0x9e},
+	{value: 0xa000, lo: 0xb4, hi: 0xb5},
+	{value: 0x395e, lo: 0xb6, hi: 0xb6},
+	{value: 0x3964, lo: 0xb7, hi: 0xb7},
+	// Block 0x5, offset 0x36
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x83, hi: 0x87},
+	// Block 0x6, offset 0x38
+	{value: 0x0001, lo: 0x04},
+	{value: 0x8114, lo: 0x81, hi: 0x82},
+	{value: 0x8133, lo: 0x84, hi: 0x84},
+	{value: 0x812e, lo: 0x85, hi: 0x85},
+	{value: 0x810e, lo: 0x87, hi: 0x87},
+	// Block 0x7, offset 0x3d
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8133, lo: 0x90, hi: 0x97},
+	{value: 0x811a, lo: 0x98, hi: 0x98},
+	{value: 0x811b, lo: 0x99, hi: 0x99},
+	{value: 0x811c, lo: 0x9a, hi: 0x9a},
+	{value: 0x3982, lo: 0xa2, hi: 0xa2},
+	{value: 0x3988, lo: 0xa3, hi: 0xa3},
+	{value: 0x3994, lo: 0xa4, hi: 0xa4},
+	{value: 0x398e, lo: 0xa5, hi: 0xa5},
+	{value: 0x399a, lo: 0xa6, hi: 0xa6},
+	{value: 0xa000, lo: 0xa7, hi: 0xa7},
+	// Block 0x8, offset 0x48
+	{value: 0x0000, lo: 0x0e},
+	{value: 0x39ac, lo: 0x80, hi: 0x80},
+	{value: 0xa000, lo: 0x81, hi: 0x81},
+	{value: 0x39a0, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x39a6, lo: 0x93, hi: 0x93},
+	{value: 0xa000, lo: 0x95, hi: 0x95},
+	{value: 0x8133, lo: 0x96, hi: 0x9c},
+	{value: 0x8133, lo: 0x9f, hi: 0xa2},
+	{value: 0x812e, lo: 0xa3, hi: 0xa3},
+	{value: 0x8133, lo: 0xa4, hi: 0xa4},
+	{value: 0x8133, lo: 0xa7, hi: 0xa8},
+	{value: 0x812e, lo: 0xaa, hi: 0xaa},
+	{value: 0x8133, lo: 0xab, hi: 0xac},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	// Block 0x9, offset 0x57
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x8120, lo: 0x91, hi: 0x91},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	{value: 0x812e, lo: 0xb1, hi: 0xb1},
+	{value: 0x8133, lo: 0xb2, hi: 0xb3},
+	{value: 0x812e, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb5, hi: 0xb6},
+	{value: 0x812e, lo: 0xb7, hi: 0xb9},
+	{value: 0x8133, lo: 0xba, hi: 0xba},
+	{value: 0x812e, lo: 0xbb, hi: 0xbc},
+	{value: 0x8133, lo: 0xbd, hi: 0xbd},
+	{value: 0x812e, lo: 0xbe, hi: 0xbe},
+	{value: 0x8133, lo: 0xbf, hi: 0xbf},
+	// Block 0xa, offset 0x64
+	{value: 0x0005, lo: 0x07},
+	{value: 0x8133, lo: 0x80, hi: 0x80},
+	{value: 0x8133, lo: 0x81, hi: 0x81},
+	{value: 0x812e, lo: 0x82, hi: 0x83},
+	{value: 0x812e, lo: 0x84, hi: 0x85},
+	{value: 0x812e, lo: 0x86, hi: 0x87},
+	{value: 0x812e, lo: 0x88, hi: 0x89},
+	{value: 0x8133, lo: 0x8a, hi: 0x8a},
+	// Block 0xb, offset 0x6c
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8133, lo: 0xab, hi: 0xb1},
+	{value: 0x812e, lo: 0xb2, hi: 0xb2},
+	{value: 0x8133, lo: 0xb3, hi: 0xb3},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	// Block 0xc, offset 0x71
+	{value: 0x0000, lo: 0x04},
+	{value: 0x8133, lo: 0x96, hi: 0x99},
+	{value: 0x8133, lo: 0x9b, hi: 0xa3},
+	{value: 0x8133, lo: 0xa5, hi: 0xa7},
+	{value: 0x8133, lo: 0xa9, hi: 0xad},
+	// Block 0xd, offset 0x76
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x99, hi: 0x9b},
+	// Block 0xe, offset 0x78
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8133, lo: 0x98, hi: 0x98},
+	{value: 0x812e, lo: 0x99, hi: 0x9b},
+	{value: 0x8133, lo: 0x9c, hi: 0x9f},
+	// Block 0xf, offset 0x7c
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0xa8, hi: 0xa8},
+	{value: 0x4019, lo: 0xa9, hi: 0xa9},
+	{value: 0xa000, lo: 0xb0, hi: 0xb0},
+	{value: 0x4021, lo: 0xb1, hi: 0xb1},
+	{value: 0xa000, lo: 0xb3, hi: 0xb3},
+	{value: 0x4029, lo: 0xb4, hi: 0xb4},
+	{value: 0x9903, lo: 0xbc, hi: 0xbc},
+	// Block 0x10, offset 0x84
+	{value: 0x0008, lo: 0x06},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x8133, lo: 0x91, hi: 0x91},
+	{value: 0x812e, lo: 0x92, hi: 0x92},
+	{value: 0x8133, lo: 0x93, hi: 0x93},
+	{value: 0x8133, lo: 0x94, hi: 0x94},
+	{value: 0x465d, lo: 0x98, hi: 0x9f},
+	// Block 0x11, offset 0x8b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x12, offset 0x8e
+	{value: 0x0008, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2dd5, lo: 0x8b, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x469d, lo: 0x9c, hi: 0x9d},
+	{value: 0x46ad, lo: 0x9f, hi: 0x9f},
+	{value: 0x8133, lo: 0xbe, hi: 0xbe},
+	// Block 0x13, offset 0x96
+	{value: 0x0000, lo: 0x03},
+	{value: 0x46d5, lo: 0xb3, hi: 0xb3},
+	{value: 0x46dd, lo: 0xb6, hi: 0xb6},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	// Block 0x14, offset 0x9a
+	{value: 0x0008, lo: 0x03},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x46b5, lo: 0x99, hi: 0x9b},
+	{value: 0x46cd, lo: 0x9e, hi: 0x9e},
+	// Block 0x15, offset 0x9e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	// Block 0x16, offset 0xa0
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	// Block 0x17, offset 0xa2
+	{value: 0x0000, lo: 0x08},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2ded, lo: 0x88, hi: 0x88},
+	{value: 0x2de5, lo: 0x8b, hi: 0x8b},
+	{value: 0x2df5, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x96, hi: 0x97},
+	{value: 0x46e5, lo: 0x9c, hi: 0x9c},
+	{value: 0x46ed, lo: 0x9d, hi: 0x9d},
+	// Block 0x18, offset 0xab
+	{value: 0x0000, lo: 0x03},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0x2dfd, lo: 0x94, hi: 0x94},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x19, offset 0xaf
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2e05, lo: 0x8a, hi: 0x8a},
+	{value: 0x2e15, lo: 0x8b, hi: 0x8b},
+	{value: 0x2e0d, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1a, offset 0xb6
+	{value: 0x1801, lo: 0x04},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x4031, lo: 0x88, hi: 0x88},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x8121, lo: 0x95, hi: 0x96},
+	// Block 0x1b, offset 0xbb
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbc, hi: 0xbc},
+	{value: 0xa000, lo: 0xbf, hi: 0xbf},
+	// Block 0x1c, offset 0xbe
+	{value: 0x0000, lo: 0x09},
+	{value: 0x2e1d, lo: 0x80, hi: 0x80},
+	{value: 0x9900, lo: 0x82, hi: 0x82},
+	{value: 0xa000, lo: 0x86, hi: 0x86},
+	{value: 0x2e25, lo: 0x87, hi: 0x87},
+	{value: 0x2e2d, lo: 0x88, hi: 0x88},
+	{value: 0x3091, lo: 0x8a, hi: 0x8a},
+	{value: 0x2f19, lo: 0x8b, hi: 0x8b},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x95, hi: 0x96},
+	// Block 0x1d, offset 0xc8
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x1e, offset 0xcb
+	{value: 0x0000, lo: 0x06},
+	{value: 0xa000, lo: 0x86, hi: 0x87},
+	{value: 0x2e35, lo: 0x8a, hi: 0x8a},
+	{value: 0x2e45, lo: 0x8b, hi: 0x8b},
+	{value: 0x2e3d, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	// Block 0x1f, offset 0xd2
+	{value: 0x6ab3, lo: 0x07},
+	{value: 0x9905, lo: 0x8a, hi: 0x8a},
+	{value: 0x9900, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4039, lo: 0x9a, hi: 0x9a},
+	{value: 0x3099, lo: 0x9c, hi: 0x9c},
+	{value: 0x2f24, lo: 0x9d, hi: 0x9d},
+	{value: 0x2e4d, lo: 0x9e, hi: 0x9f},
+	// Block 0x20, offset 0xda
+	{value: 0x0000, lo: 0x03},
+	{value: 0x2751, lo: 0xb3, hi: 0xb3},
+	{value: 0x8123, lo: 0xb8, hi: 0xb9},
+	{value: 0x8105, lo: 0xba, hi: 0xba},
+	// Block 0x21, offset 0xde
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8124, lo: 0x88, hi: 0x8b},
+	// Block 0x22, offset 0xe0
+	{value: 0x0000, lo: 0x03},
+	{value: 0x2766, lo: 0xb3, hi: 0xb3},
+	{value: 0x8125, lo: 0xb8, hi: 0xb9},
+	{value: 0x8105, lo: 0xba, hi: 0xba},
+	// Block 0x23, offset 0xe4
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8126, lo: 0x88, hi: 0x8b},
+	{value: 0x2758, lo: 0x9c, hi: 0x9c},
+	{value: 0x275f, lo: 0x9d, hi: 0x9d},
+	// Block 0x24, offset 0xe8
+	{value: 0x0000, lo: 0x05},
+	{value: 0x03fe, lo: 0x8c, hi: 0x8c},
+	{value: 0x812e, lo: 0x98, hi: 0x99},
+	{value: 0x812e, lo: 0xb5, hi: 0xb5},
+	{value: 0x812e, lo: 0xb7, hi: 0xb7},
+	{value: 0x812c, lo: 0xb9, hi: 0xb9},
+	// Block 0x25, offset 0xee
+	{value: 0x0000, lo: 0x10},
+	{value: 0x2774, lo: 0x83, hi: 0x83},
+	{value: 0x277b, lo: 0x8d, hi: 0x8d},
+	{value: 0x2782, lo: 0x92, hi: 0x92},
+	{value: 0x2789, lo: 0x97, hi: 0x97},
+	{value: 0x2790, lo: 0x9c, hi: 0x9c},
+	{value: 0x276d, lo: 0xa9, hi: 0xa9},
+	{value: 0x8127, lo: 0xb1, hi: 0xb1},
+	{value: 0x8128, lo: 0xb2, hi: 0xb2},
+	{value: 0x4bc5, lo: 0xb3, hi: 0xb3},
+	{value: 0x8129, lo: 0xb4, hi: 0xb4},
+	{value: 0x4bce, lo: 0xb5, hi: 0xb5},
+	{value: 0x46f5, lo: 0xb6, hi: 0xb6},
+	{value: 0x4735, lo: 0xb7, hi: 0xb7},
+	{value: 0x46fd, lo: 0xb8, hi: 0xb8},
+	{value: 0x4740, lo: 0xb9, hi: 0xb9},
+	{value: 0x8128, lo: 0xba, hi: 0xbd},
+	// Block 0x26, offset 0xff
+	{value: 0x0000, lo: 0x0b},
+	{value: 0x8128, lo: 0x80, hi: 0x80},
+	{value: 0x4bd7, lo: 0x81, hi: 0x81},
+	{value: 0x8133, lo: 0x82, hi: 0x83},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0x86, hi: 0x87},
+	{value: 0x279e, lo: 0x93, hi: 0x93},
+	{value: 0x27a5, lo: 0x9d, hi: 0x9d},
+	{value: 0x27ac, lo: 0xa2, hi: 0xa2},
+	{value: 0x27b3, lo: 0xa7, hi: 0xa7},
+	{value: 0x27ba, lo: 0xac, hi: 0xac},
+	{value: 0x2797, lo: 0xb9, hi: 0xb9},
+	// Block 0x27, offset 0x10b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x86, hi: 0x86},
+	// Block 0x28, offset 0x10d
+	{value: 0x0000, lo: 0x05},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x2e55, lo: 0xa6, hi: 0xa6},
+	{value: 0x9900, lo: 0xae, hi: 0xae},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	{value: 0x8105, lo: 0xb9, hi: 0xba},
+	// Block 0x29, offset 0x113
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x8d, hi: 0x8d},
+	// Block 0x2a, offset 0x115
+	{value: 0x0000, lo: 0x01},
+	{value: 0x0402, lo: 0xbc, hi: 0xbc},
+	// Block 0x2b, offset 0x117
+	{value: 0x0000, lo: 0x01},
+	{value: 0xa000, lo: 0x80, hi: 0x92},
+	// Block 0x2c, offset 0x119
+	{value: 0x0000, lo: 0x01},
+	{value: 0xb900, lo: 0xa1, hi: 0xb5},
+	// Block 0x2d, offset 0x11b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0xa8, hi: 0xbf},
+	// Block 0x2e, offset 0x11d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x9900, lo: 0x80, hi: 0x82},
+	// Block 0x2f, offset 0x11f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x9d, hi: 0x9f},
+	// Block 0x30, offset 0x121
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x94, hi: 0x95},
+	{value: 0x8105, lo: 0xb4, hi: 0xb4},
+	// Block 0x31, offset 0x124
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x92, hi: 0x92},
+	{value: 0x8133, lo: 0x9d, hi: 0x9d},
+	// Block 0x32, offset 0x127
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8132, lo: 0xa9, hi: 0xa9},
+	// Block 0x33, offset 0x129
+	{value: 0x0004, lo: 0x02},
+	{value: 0x812f, lo: 0xb9, hi: 0xba},
+	{value: 0x812e, lo: 0xbb, hi: 0xbb},
+	// Block 0x34, offset 0x12c
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x97, hi: 0x97},
+	{value: 0x812e, lo: 0x98, hi: 0x98},
+	// Block 0x35, offset 0x12f
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0xa0, hi: 0xa0},
+	{value: 0x8133, lo: 0xb5, hi: 0xbc},
+	{value: 0x812e, lo: 0xbf, hi: 0xbf},
+	// Block 0x36, offset 0x133
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8133, lo: 0xb0, hi: 0xb4},
+	{value: 0x812e, lo: 0xb5, hi: 0xba},
+	{value: 0x8133, lo: 0xbb, hi: 0xbc},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	{value: 0x812e, lo: 0xbf, hi: 0xbf},
+	// Block 0x37, offset 0x139
+	{value: 0x0000, lo: 0x06},
+	{value: 0x812e, lo: 0x80, hi: 0x80},
+	{value: 0x8133, lo: 0x81, hi: 0x82},
+	{value: 0x812e, lo: 0x83, hi: 0x84},
+	{value: 0x8133, lo: 0x85, hi: 0x89},
+	{value: 0x812e, lo: 0x8a, hi: 0x8a},
+	{value: 0x8133, lo: 0x8b, hi: 0x8e},
+	// Block 0x38, offset 0x140
+	{value: 0x0000, lo: 0x08},
+	{value: 0x2e9d, lo: 0x80, hi: 0x80},
+	{value: 0x2ea5, lo: 0x81, hi: 0x81},
+	{value: 0xa000, lo: 0x82, hi: 0x82},
+	{value: 0x2ead, lo: 0x83, hi: 0x83},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0xab, hi: 0xab},
+	{value: 0x812e, lo: 0xac, hi: 0xac},
+	{value: 0x8133, lo: 0xad, hi: 0xb3},
+	// Block 0x39, offset 0x149
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xaa, hi: 0xab},
+	// Block 0x3a, offset 0x14b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xa6, hi: 0xa6},
+	{value: 0x8105, lo: 0xb2, hi: 0xb3},
+	// Block 0x3b, offset 0x14e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	// Block 0x3c, offset 0x150
+	{value: 0x0000, lo: 0x0a},
+	{value: 0x8133, lo: 0x90, hi: 0x92},
+	{value: 0x8101, lo: 0x94, hi: 0x94},
+	{value: 0x812e, lo: 0x95, hi: 0x99},
+	{value: 0x8133, lo: 0x9a, hi: 0x9b},
+	{value: 0x812e, lo: 0x9c, hi: 0x9f},
+	{value: 0x8133, lo: 0xa0, hi: 0xa0},
+	{value: 0x8101, lo: 0xa2, hi: 0xa8},
+	{value: 0x812e, lo: 0xad, hi: 0xad},
+	{value: 0x8133, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb8, hi: 0xb9},
+	// Block 0x3d, offset 0x15b
+	{value: 0x0002, lo: 0x0a},
+	{value: 0x0043, lo: 0xac, hi: 0xac},
+	{value: 0x00d1, lo: 0xad, hi: 0xad},
+	{value: 0x0045, lo: 0xae, hi: 0xae},
+	{value: 0x0049, lo: 0xb0, hi: 0xb1},
+	{value: 0x00ec, lo: 0xb2, hi: 0xb2},
+	{value: 0x004f, lo: 0xb3, hi: 0xba},
+	{value: 0x005f, lo: 0xbc, hi: 0xbc},
+	{value: 0x00fe, lo: 0xbd, hi: 0xbd},
+	{value: 0x0061, lo: 0xbe, hi: 0xbe},
+	{value: 0x0065, lo: 0xbf, hi: 0xbf},
+	// Block 0x3e, offset 0x166
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x0001, lo: 0x80, hi: 0x8a},
+	{value: 0x0532, lo: 0x91, hi: 0x91},
+	{value: 0x43dc, lo: 0x97, hi: 0x97},
+	{value: 0x001d, lo: 0xa4, hi: 0xa4},
+	{value: 0x19a0, lo: 0xa5, hi: 0xa5},
+	{value: 0x1c8c, lo: 0xa6, hi: 0xa6},
+	{value: 0x0001, lo: 0xaf, hi: 0xaf},
+	{value: 0x27c1, lo: 0xb3, hi: 0xb3},
+	{value: 0x2935, lo: 0xb4, hi: 0xb4},
+	{value: 0x27c8, lo: 0xb6, hi: 0xb6},
+	{value: 0x293f, lo: 0xb7, hi: 0xb7},
+	{value: 0x199a, lo: 0xbc, hi: 0xbc},
+	{value: 0x43aa, lo: 0xbe, hi: 0xbe},
+	// Block 0x3f, offset 0x174
+	{value: 0x0002, lo: 0x0d},
+	{value: 0x1a60, lo: 0x87, hi: 0x87},
+	{value: 0x1a5d, lo: 0x88, hi: 0x88},
+	{value: 0x199d, lo: 0x89, hi: 0x89},
+	{value: 0x2ac5, lo: 0x97, hi: 0x97},
+	{value: 0x0001, lo: 0x9f, hi: 0x9f},
+	{value: 0x0021, lo: 0xb0, hi: 0xb0},
+	{value: 0x0093, lo: 0xb1, hi: 0xb1},
+	{value: 0x0029, lo: 0xb4, hi: 0xb9},
+	{value: 0x0017, lo: 0xba, hi: 0xba},
+	{value: 0x055e, lo: 0xbb, hi: 0xbb},
+	{value: 0x003b, lo: 0xbc, hi: 0xbc},
+	{value: 0x0011, lo: 0xbd, hi: 0xbe},
+	{value: 0x009d, lo: 0xbf, hi: 0xbf},
+	// Block 0x40, offset 0x182
+	{value: 0x0002, lo: 0x0f},
+	{value: 0x0021, lo: 0x80, hi: 0x89},
+	{value: 0x0017, lo: 0x8a, hi: 0x8a},
+	{value: 0x055e, lo: 0x8b, hi: 0x8b},
+	{value: 0x003b, lo: 0x8c, hi: 0x8c},
+	{value: 0x0011, lo: 0x8d, hi: 0x8e},
+	{value: 0x0083, lo: 0x90, hi: 0x90},
+	{value: 0x008b, lo: 0x91, hi: 0x91},
+	{value: 0x009f, lo: 0x92, hi: 0x92},
+	{value: 0x00b1, lo: 0x93, hi: 0x93},
+	{value: 0x011f, lo: 0x94, hi: 0x94},
+	{value: 0x0091, lo: 0x95, hi: 0x95},
+	{value: 0x0097, lo: 0x96, hi: 0x99},
+	{value: 0x00a1, lo: 0x9a, hi: 0x9a},
+	{value: 0x00a7, lo: 0x9b, hi: 0x9c},
+	{value: 0x1ac9, lo: 0xa8, hi: 0xa8},
+	// Block 0x41, offset 0x192
+	{value: 0x0000, lo: 0x0d},
+	{value: 0x8133, lo: 0x90, hi: 0x91},
+	{value: 0x8101, lo: 0x92, hi: 0x93},
+	{value: 0x8133, lo: 0x94, hi: 0x97},
+	{value: 0x8101, lo: 0x98, hi: 0x9a},
+	{value: 0x8133, lo: 0x9b, hi: 0x9c},
+	{value: 0x8133, lo: 0xa1, hi: 0xa1},
+	{value: 0x8101, lo: 0xa5, hi: 0xa6},
+	{value: 0x8133, lo: 0xa7, hi: 0xa7},
+	{value: 0x812e, lo: 0xa8, hi: 0xa8},
+	{value: 0x8133, lo: 0xa9, hi: 0xa9},
+	{value: 0x8101, lo: 0xaa, hi: 0xab},
+	{value: 0x812e, lo: 0xac, hi: 0xaf},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	// Block 0x42, offset 0x1a0
+	{value: 0x0007, lo: 0x06},
+	{value: 0x22b0, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	{value: 0x3cfa, lo: 0x9a, hi: 0x9b},
+	{value: 0x3d08, lo: 0xae, hi: 0xae},
+	// Block 0x43, offset 0x1a7
+	{value: 0x000e, lo: 0x05},
+	{value: 0x3d0f, lo: 0x8d, hi: 0x8e},
+	{value: 0x3d16, lo: 0x8f, hi: 0x8f},
+	{value: 0xa000, lo: 0x90, hi: 0x90},
+	{value: 0xa000, lo: 0x92, hi: 0x92},
+	{value: 0xa000, lo: 0x94, hi: 0x94},
+	// Block 0x44, offset 0x1ad
+	{value: 0x017a, lo: 0x0e},
+	{value: 0xa000, lo: 0x83, hi: 0x83},
+	{value: 0x3d24, lo: 0x84, hi: 0x84},
+	{value: 0xa000, lo: 0x88, hi: 0x88},
+	{value: 0x3d2b, lo: 0x89, hi: 0x89},
+	{value: 0xa000, lo: 0x8b, hi: 0x8b},
+	{value: 0x3d32, lo: 0x8c, hi: 0x8c},
+	{value: 0xa000, lo: 0xa3, hi: 0xa3},
+	{value: 0x3d39, lo: 0xa4, hi: 0xa4},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x3d40, lo: 0xa6, hi: 0xa6},
+	{value: 0x27cf, lo: 0xac, hi: 0xad},
+	{value: 0x27d6, lo: 0xaf, hi: 0xaf},
+	{value: 0x2953, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xbc, hi: 0xbc},
+	// Block 0x45, offset 0x1bc
+	{value: 0x0007, lo: 0x03},
+	{value: 0x3da9, lo: 0xa0, hi: 0xa1},
+	{value: 0x3dd3, lo: 0xa2, hi: 0xa3},
+	{value: 0x3dfd, lo: 0xaa, hi: 0xad},
+	// Block 0x46, offset 0x1c0
+	{value: 0x0004, lo: 0x01},
+	{value: 0x0586, lo: 0xa9, hi: 0xaa},
+	// Block 0x47, offset 0x1c2
+	{value: 0x0002, lo: 0x03},
+	{value: 0x0057, lo: 0x80, hi: 0x8f},
+	{value: 0x0083, lo: 0x90, hi: 0xa9},
+	{value: 0x0021, lo: 0xaa, hi: 0xaa},
+	// Block 0x48, offset 0x1c6
+	{value: 0x0000, lo: 0x01},
+	{value: 0x2ad2, lo: 0x8c, hi: 0x8c},
+	// Block 0x49, offset 0x1c8
+	{value: 0x0266, lo: 0x02},
+	{value: 0x1cbc, lo: 0xb4, hi: 0xb4},
+	{value: 0x1a5a, lo: 0xb5, hi: 0xb6},
+	// Block 0x4a, offset 0x1cb
+	{value: 0x0000, lo: 0x01},
+	{value: 0x461e, lo: 0x9c, hi: 0x9c},
+	// Block 0x4b, offset 0x1cd
+	{value: 0x0000, lo: 0x02},
+	{value: 0x0095, lo: 0xbc, hi: 0xbc},
+	{value: 0x006d, lo: 0xbd, hi: 0xbd},
+	// Block 0x4c, offset 0x1d0
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xaf, hi: 0xb1},
+	// Block 0x4d, offset 0x1d2
+	{value: 0x0000, lo: 0x02},
+	{value: 0x057a, lo: 0xaf, hi: 0xaf},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x4e, offset 0x1d5
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xa0, hi: 0xbf},
+	// Block 0x4f, offset 0x1d7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x0ebe, lo: 0x9f, hi: 0x9f},
+	// Block 0x50, offset 0x1d9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x172a, lo: 0xb3, hi: 0xb3},
+	// Block 0x51, offset 0x1db
+	{value: 0x0004, lo: 0x0b},
+	{value: 0x1692, lo: 0x80, hi: 0x82},
+	{value: 0x16aa, lo: 0x83, hi: 0x83},
+	{value: 0x16c2, lo: 0x84, hi: 0x85},
+	{value: 0x16d2, lo: 0x86, hi: 0x89},
+	{value: 0x16e6, lo: 0x8a, hi: 0x8c},
+	{value: 0x16fa, lo: 0x8d, hi: 0x8d},
+	{value: 0x1702, lo: 0x8e, hi: 0x8e},
+	{value: 0x170a, lo: 0x8f, hi: 0x90},
+	{value: 0x1716, lo: 0x91, hi: 0x93},
+	{value: 0x1726, lo: 0x94, hi: 0x94},
+	{value: 0x172e, lo: 0x95, hi: 0x95},
+	// Block 0x52, offset 0x1e7
+	{value: 0x0004, lo: 0x09},
+	{value: 0x0001, lo: 0x80, hi: 0x80},
+	{value: 0x812d, lo: 0xaa, hi: 0xaa},
+	{value: 0x8132, lo: 0xab, hi: 0xab},
+	{value: 0x8134, lo: 0xac, hi: 0xac},
+	{value: 0x812f, lo: 0xad, hi: 0xad},
+	{value: 0x8130, lo: 0xae, hi: 0xae},
+	{value: 0x8130, lo: 0xaf, hi: 0xaf},
+	{value: 0x05ae, lo: 0xb6, hi: 0xb6},
+	{value: 0x0982, lo: 0xb8, hi: 0xba},
+	// Block 0x53, offset 0x1f1
+	{value: 0x0006, lo: 0x09},
+	{value: 0x0406, lo: 0xb1, hi: 0xb1},
+	{value: 0x040a, lo: 0xb2, hi: 0xb2},
+	{value: 0x4b7c, lo: 0xb3, hi: 0xb3},
+	{value: 0x040e, lo: 0xb4, hi: 0xb4},
+	{value: 0x4b82, lo: 0xb5, hi: 0xb6},
+	{value: 0x0412, lo: 0xb7, hi: 0xb7},
+	{value: 0x0416, lo: 0xb8, hi: 0xb8},
+	{value: 0x041a, lo: 0xb9, hi: 0xb9},
+	{value: 0x4b8e, lo: 0xba, hi: 0xbf},
+	// Block 0x54, offset 0x1fb
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0xaf, hi: 0xaf},
+	{value: 0x8133, lo: 0xb4, hi: 0xbd},
+	// Block 0x55, offset 0x1fe
+	{value: 0x0000, lo: 0x03},
+	{value: 0x02d8, lo: 0x9c, hi: 0x9c},
+	{value: 0x02de, lo: 0x9d, hi: 0x9d},
+	{value: 0x8133, lo: 0x9e, hi: 0x9f},
+	// Block 0x56, offset 0x202
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb0, hi: 0xb1},
+	// Block 0x57, offset 0x204
+	{value: 0x0000, lo: 0x01},
+	{value: 0x173e, lo: 0xb0, hi: 0xb0},
+	// Block 0x58, offset 0x206
+	{value: 0x0006, lo: 0x04},
+	{value: 0x0047, lo: 0xb2, hi: 0xb3},
+	{value: 0x0063, lo: 0xb4, hi: 0xb4},
+	{value: 0x00dd, lo: 0xb8, hi: 0xb8},
+	{value: 0x00e9, lo: 0xb9, hi: 0xb9},
+	// Block 0x59, offset 0x20b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x86, hi: 0x86},
+	{value: 0x8105, lo: 0xac, hi: 0xac},
+	// Block 0x5a, offset 0x20e
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x84, hi: 0x84},
+	{value: 0x8133, lo: 0xa0, hi: 0xb1},
+	// Block 0x5b, offset 0x211
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xab, hi: 0xad},
+	// Block 0x5c, offset 0x213
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x93, hi: 0x93},
+	// Block 0x5d, offset 0x215
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0xb3, hi: 0xb3},
+	// Block 0x5e, offset 0x217
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x80, hi: 0x80},
+	// Block 0x5f, offset 0x219
+	{value: 0x0000, lo: 0x05},
+	{value: 0x8133, lo: 0xb0, hi: 0xb0},
+	{value: 0x8133, lo: 0xb2, hi: 0xb3},
+	{value: 0x812e, lo: 0xb4, hi: 0xb4},
+	{value: 0x8133, lo: 0xb7, hi: 0xb8},
+	{value: 0x8133, lo: 0xbe, hi: 0xbf},
+	// Block 0x60, offset 0x21f
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x81, hi: 0x81},
+	{value: 0x8105, lo: 0xb6, hi: 0xb6},
+	// Block 0x61, offset 0x222
+	{value: 0x000c, lo: 0x04},
+	{value: 0x173a, lo: 0x9c, hi: 0x9d},
+	{value: 0x014f, lo: 0x9e, hi: 0x9e},
+	{value: 0x174a, lo: 0x9f, hi: 0x9f},
+	{value: 0x01a6, lo: 0xa9, hi: 0xa9},
+	// Block 0x62, offset 0x227
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xad, hi: 0xad},
+	// Block 0x63, offset 0x229
+	{value: 0x0000, lo: 0x06},
+	{value: 0xe500, lo: 0x80, hi: 0x80},
+	{value: 0xc600, lo: 0x81, hi: 0x9b},
+	{value: 0xe500, lo: 0x9c, hi: 0x9c},
+	{value: 0xc600, lo: 0x9d, hi: 0xb7},
+	{value: 0xe500, lo: 0xb8, hi: 0xb8},
+	{value: 0xc600, lo: 0xb9, hi: 0xbf},
+	// Block 0x64, offset 0x230
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x93},
+	{value: 0xe500, lo: 0x94, hi: 0x94},
+	{value: 0xc600, lo: 0x95, hi: 0xaf},
+	{value: 0xe500, lo: 0xb0, hi: 0xb0},
+	{value: 0xc600, lo: 0xb1, hi: 0xbf},
+	// Block 0x65, offset 0x236
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8b},
+	{value: 0xe500, lo: 0x8c, hi: 0x8c},
+	{value: 0xc600, lo: 0x8d, hi: 0xa7},
+	{value: 0xe500, lo: 0xa8, hi: 0xa8},
+	{value: 0xc600, lo: 0xa9, hi: 0xbf},
+	// Block 0x66, offset 0x23c
+	{value: 0x0000, lo: 0x07},
+	{value: 0xc600, lo: 0x80, hi: 0x83},
+	{value: 0xe500, lo: 0x84, hi: 0x84},
+	{value: 0xc600, lo: 0x85, hi: 0x9f},
+	{value: 0xe500, lo: 0xa0, hi: 0xa0},
+	{value: 0xc600, lo: 0xa1, hi: 0xbb},
+	{value: 0xe500, lo: 0xbc, hi: 0xbc},
+	{value: 0xc600, lo: 0xbd, hi: 0xbf},
+	// Block 0x67, offset 0x244
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x97},
+	{value: 0xe500, lo: 0x98, hi: 0x98},
+	{value: 0xc600, lo: 0x99, hi: 0xb3},
+	{value: 0xe500, lo: 0xb4, hi: 0xb4},
+	{value: 0xc600, lo: 0xb5, hi: 0xbf},
+	// Block 0x68, offset 0x24a
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x8f},
+	{value: 0xe500, lo: 0x90, hi: 0x90},
+	{value: 0xc600, lo: 0x91, hi: 0xab},
+	{value: 0xe500, lo: 0xac, hi: 0xac},
+	{value: 0xc600, lo: 0xad, hi: 0xbf},
+	// Block 0x69, offset 0x250
+	{value: 0x0000, lo: 0x05},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	{value: 0xe500, lo: 0xa4, hi: 0xa4},
+	{value: 0xc600, lo: 0xa5, hi: 0xbf},
+	// Block 0x6a, offset 0x256
+	{value: 0x0000, lo: 0x03},
+	{value: 0xc600, lo: 0x80, hi: 0x87},
+	{value: 0xe500, lo: 0x88, hi: 0x88},
+	{value: 0xc600, lo: 0x89, hi: 0xa3},
+	// Block 0x6b, offset 0x25a
+	{value: 0x0002, lo: 0x01},
+	{value: 0x0003, lo: 0x81, hi: 0xbf},
+	// Block 0x6c, offset 0x25c
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xbd, hi: 0xbd},
+	// Block 0x6d, offset 0x25e
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xa0, hi: 0xa0},
+	// Block 0x6e, offset 0x260
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb6, hi: 0xba},
+	// Block 0x6f, offset 0x262
+	{value: 0x002d, lo: 0x05},
+	{value: 0x812e, lo: 0x8d, hi: 0x8d},
+	{value: 0x8133, lo: 0x8f, hi: 0x8f},
+	{value: 0x8133, lo: 0xb8, hi: 0xb8},
+	{value: 0x8101, lo: 0xb9, hi: 0xba},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x70, offset 0x268
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0xa5, hi: 0xa5},
+	{value: 0x812e, lo: 0xa6, hi: 0xa6},
+	// Block 0x71, offset 0x26b
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xa4, hi: 0xa7},
+	// Block 0x72, offset 0x26d
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xab, hi: 0xac},
+	// Block 0x73, offset 0x26f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0xbd, hi: 0xbf},
+	// Block 0x74, offset 0x271
+	{value: 0x0000, lo: 0x05},
+	{value: 0x812e, lo: 0x86, hi: 0x87},
+	{value: 0x8133, lo: 0x88, hi: 0x8a},
+	{value: 0x812e, lo: 0x8b, hi: 0x8b},
+	{value: 0x8133, lo: 0x8c, hi: 0x8c},
+	{value: 0x812e, lo: 0x8d, hi: 0x90},
+	// Block 0x75, offset 0x277
+	{value: 0x0005, lo: 0x03},
+	{value: 0x8133, lo: 0x82, hi: 0x82},
+	{value: 0x812e, lo: 0x83, hi: 0x84},
+	{value: 0x812e, lo: 0x85, hi: 0x85},
+	// Block 0x76, offset 0x27b
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0x86, hi: 0x86},
+	{value: 0x8105, lo: 0xb0, hi: 0xb0},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x77, offset 0x27f
+	{value: 0x17fe, lo: 0x07},
+	{value: 0xa000, lo: 0x99, hi: 0x99},
+	{value: 0x4379, lo: 0x9a, hi: 0x9a},
+	{value: 0xa000, lo: 0x9b, hi: 0x9b},
+	{value: 0x4383, lo: 0x9c, hi: 0x9c},
+	{value: 0xa000, lo: 0xa5, hi: 0xa5},
+	{value: 0x438d, lo: 0xab, hi: 0xab},
+	{value: 0x8105, lo: 0xb9, hi: 0xba},
+	// Block 0x78, offset 0x287
+	{value: 0x0000, lo: 0x06},
+	{value: 0x8133, lo: 0x80, hi: 0x82},
+	{value: 0x9900, lo: 0xa7, hi: 0xa7},
+	{value: 0x2eb5, lo: 0xae, hi: 0xae},
+	{value: 0x2ebf, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb1, hi: 0xb2},
+	{value: 0x8105, lo: 0xb3, hi: 0xb4},
+	// Block 0x79, offset 0x28e
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x80, hi: 0x80},
+	{value: 0x8103, lo: 0x8a, hi: 0x8a},
+	// Block 0x7a, offset 0x291
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb5, hi: 0xb5},
+	{value: 0x8103, lo: 0xb6, hi: 0xb6},
+	// Block 0x7b, offset 0x294
+	{value: 0x0002, lo: 0x01},
+	{value: 0x8103, lo: 0xa9, hi: 0xaa},
+	// Block 0x7c, offset 0x296
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0xbb, hi: 0xbc},
+	{value: 0x9900, lo: 0xbe, hi: 0xbe},
+	// Block 0x7d, offset 0x299
+	{value: 0x0000, lo: 0x07},
+	{value: 0xa000, lo: 0x87, hi: 0x87},
+	{value: 0x2ec9, lo: 0x8b, hi: 0x8b},
+	{value: 0x2ed3, lo: 0x8c, hi: 0x8c},
+	{value: 0x8105, lo: 0x8d, hi: 0x8d},
+	{value: 0x9900, lo: 0x97, hi: 0x97},
+	{value: 0x8133, lo: 0xa6, hi: 0xac},
+	{value: 0x8133, lo: 0xb0, hi: 0xb4},
+	// Block 0x7e, offset 0x2a1
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8105, lo: 0x82, hi: 0x82},
+	{value: 0x8103, lo: 0x86, hi: 0x86},
+	{value: 0x8133, lo: 0x9e, hi: 0x9e},
+	// Block 0x7f, offset 0x2a5
+	{value: 0x6a23, lo: 0x06},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb9, hi: 0xb9},
+	{value: 0x9900, lo: 0xba, hi: 0xba},
+	{value: 0x2ee7, lo: 0xbb, hi: 0xbb},
+	{value: 0x2edd, lo: 0xbc, hi: 0xbd},
+	{value: 0x2ef1, lo: 0xbe, hi: 0xbe},
+	// Block 0x80, offset 0x2ac
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0x82, hi: 0x82},
+	{value: 0x8103, lo: 0x83, hi: 0x83},
+	// Block 0x81, offset 0x2af
+	{value: 0x0000, lo: 0x05},
+	{value: 0x9900, lo: 0xaf, hi: 0xaf},
+	{value: 0xa000, lo: 0xb8, hi: 0xb9},
+	{value: 0x2efb, lo: 0xba, hi: 0xba},
+	{value: 0x2f05, lo: 0xbb, hi: 0xbb},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x82, offset 0x2b5
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0x80, hi: 0x80},
+	// Block 0x83, offset 0x2b7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xbf, hi: 0xbf},
+	// Block 0x84, offset 0x2b9
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb6, hi: 0xb6},
+	{value: 0x8103, lo: 0xb7, hi: 0xb7},
+	// Block 0x85, offset 0x2bc
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xab, hi: 0xab},
+	// Block 0x86, offset 0x2be
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8105, lo: 0xb9, hi: 0xb9},
+	{value: 0x8103, lo: 0xba, hi: 0xba},
+	// Block 0x87, offset 0x2c1
+	{value: 0x0000, lo: 0x04},
+	{value: 0x9900, lo: 0xb0, hi: 0xb0},
+	{value: 0xa000, lo: 0xb5, hi: 0xb5},
+	{value: 0x2f0f, lo: 0xb8, hi: 0xb8},
+	{value: 0x8105, lo: 0xbd, hi: 0xbe},
+	// Block 0x88, offset 0x2c6
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8103, lo: 0x83, hi: 0x83},
+	// Block 0x89, offset 0x2c8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xa0, hi: 0xa0},
+	// Block 0x8a, offset 0x2ca
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0xb4, hi: 0xb4},
+	// Block 0x8b, offset 0x2cc
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x87, hi: 0x87},
+	// Block 0x8c, offset 0x2ce
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x99, hi: 0x99},
+	// Block 0x8d, offset 0x2d0
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8103, lo: 0x82, hi: 0x82},
+	{value: 0x8105, lo: 0x84, hi: 0x85},
+	// Block 0x8e, offset 0x2d3
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x97, hi: 0x97},
+	// Block 0x8f, offset 0x2d5
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8105, lo: 0x81, hi: 0x82},
+	// Block 0x90, offset 0x2d7
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0xb0, hi: 0xb4},
+	// Block 0x91, offset 0x2d9
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xb0, hi: 0xb6},
+	// Block 0x92, offset 0x2db
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8102, lo: 0xb0, hi: 0xb1},
+	// Block 0x93, offset 0x2dd
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8101, lo: 0x9e, hi: 0x9e},
+	// Block 0x94, offset 0x2df
+	{value: 0x0000, lo: 0x0c},
+	{value: 0x470d, lo: 0x9e, hi: 0x9e},
+	{value: 0x4717, lo: 0x9f, hi: 0x9f},
+	{value: 0x474b, lo: 0xa0, hi: 0xa0},
+	{value: 0x4759, lo: 0xa1, hi: 0xa1},
+	{value: 0x4767, lo: 0xa2, hi: 0xa2},
+	{value: 0x4775, lo: 0xa3, hi: 0xa3},
+	{value: 0x4783, lo: 0xa4, hi: 0xa4},
+	{value: 0x812c, lo: 0xa5, hi: 0xa6},
+	{value: 0x8101, lo: 0xa7, hi: 0xa9},
+	{value: 0x8131, lo: 0xad, hi: 0xad},
+	{value: 0x812c, lo: 0xae, hi: 0xb2},
+	{value: 0x812e, lo: 0xbb, hi: 0xbf},
+	// Block 0x95, offset 0x2ec
+	{value: 0x0000, lo: 0x09},
+	{value: 0x812e, lo: 0x80, hi: 0x82},
+	{value: 0x8133, lo: 0x85, hi: 0x89},
+	{value: 0x812e, lo: 0x8a, hi: 0x8b},
+	{value: 0x8133, lo: 0xaa, hi: 0xad},
+	{value: 0x4721, lo: 0xbb, hi: 0xbb},
+	{value: 0x472b, lo: 0xbc, hi: 0xbc},
+	{value: 0x4791, lo: 0xbd, hi: 0xbd},
+	{value: 0x47ad, lo: 0xbe, hi: 0xbe},
+	{value: 0x479f, lo: 0xbf, hi: 0xbf},
+	// Block 0x96, offset 0x2f6
+	{value: 0x0000, lo: 0x01},
+	{value: 0x47bb, lo: 0x80, hi: 0x80},
+	// Block 0x97, offset 0x2f8
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x82, hi: 0x84},
+	// Block 0x98, offset 0x2fa
+	{value: 0x0002, lo: 0x03},
+	{value: 0x0043, lo: 0x80, hi: 0x99},
+	{value: 0x0083, lo: 0x9a, hi: 0xb3},
+	{value: 0x0043, lo: 0xb4, hi: 0xbf},
+	// Block 0x99, offset 0x2fe
+	{value: 0x0002, lo: 0x04},
+	{value: 0x005b, lo: 0x80, hi: 0x8d},
+	{value: 0x0083, lo: 0x8e, hi: 0x94},
+	{value: 0x0093, lo: 0x96, hi: 0xa7},
+	{value: 0x0043, lo: 0xa8, hi: 0xbf},
+	// Block 0x9a, offset 0x303
+	{value: 0x0002, lo: 0x0b},
+	{value: 0x0073, lo: 0x80, hi: 0x81},
+	{value: 0x0083, lo: 0x82, hi: 0x9b},
+	{value: 0x0043, lo: 0x9c, hi: 0x9c},
+	{value: 0x0047, lo: 0x9e, hi: 0x9f},
+	{value: 0x004f, lo: 0xa2, hi: 0xa2},
+	{value: 0x0055, lo: 0xa5, hi: 0xa6},
+	{value: 0x005d, lo: 0xa9, hi: 0xac},
+	{value: 0x0067, lo: 0xae, hi: 0xb5},
+	{value: 0x0083, lo: 0xb6, hi: 0xb9},
+	{value: 0x008d, lo: 0xbb, hi: 0xbb},
+	{value: 0x0091, lo: 0xbd, hi: 0xbf},
+	// Block 0x9b, offset 0x30f
+	{value: 0x0002, lo: 0x04},
+	{value: 0x0097, lo: 0x80, hi: 0x83},
+	{value: 0x00a1, lo: 0x85, hi: 0x8f},
+	{value: 0x0043, lo: 0x90, hi: 0xa9},
+	{value: 0x0083, lo: 0xaa, hi: 0xbf},
+	// Block 0x9c, offset 0x314
+	{value: 0x0002, lo: 0x08},
+	{value: 0x00af, lo: 0x80, hi: 0x83},
+	{value: 0x0043, lo: 0x84, hi: 0x85},
+	{value: 0x0049, lo: 0x87, hi: 0x8a},
+	{value: 0x0055, lo: 0x8d, hi: 0x94},
+	{value: 0x0067, lo: 0x96, hi: 0x9c},
+	{value: 0x0083, lo: 0x9e, hi: 0xb7},
+	{value: 0x0043, lo: 0xb8, hi: 0xb9},
+	{value: 0x0049, lo: 0xbb, hi: 0xbe},
+	// Block 0x9d, offset 0x31d
+	{value: 0x0002, lo: 0x05},
+	{value: 0x0053, lo: 0x80, hi: 0x84},
+	{value: 0x005f, lo: 0x86, hi: 0x86},
+	{value: 0x0067, lo: 0x8a, hi: 0x90},
+	{value: 0x0083, lo: 0x92, hi: 0xab},
+	{value: 0x0043, lo: 0xac, hi: 0xbf},
+	// Block 0x9e, offset 0x323
+	{value: 0x0002, lo: 0x04},
+	{value: 0x006b, lo: 0x80, hi: 0x85},
+	{value: 0x0083, lo: 0x86, hi: 0x9f},
+	{value: 0x0043, lo: 0xa0, hi: 0xb9},
+	{value: 0x0083, lo: 0xba, hi: 0xbf},
+	// Block 0x9f, offset 0x328
+	{value: 0x0002, lo: 0x03},
+	{value: 0x008f, lo: 0x80, hi: 0x93},
+	{value: 0x0043, lo: 0x94, hi: 0xad},
+	{value: 0x0083, lo: 0xae, hi: 0xbf},
+	// Block 0xa0, offset 0x32c
+	{value: 0x0002, lo: 0x04},
+	{value: 0x00a7, lo: 0x80, hi: 0x87},
+	{value: 0x0043, lo: 0x88, hi: 0xa1},
+	{value: 0x0083, lo: 0xa2, hi: 0xbb},
+	{value: 0x0043, lo: 0xbc, hi: 0xbf},
+	// Block 0xa1, offset 0x331
+	{value: 0x0002, lo: 0x03},
+	{value: 0x004b, lo: 0x80, hi: 0x95},
+	{value: 0x0083, lo: 0x96, hi: 0xaf},
+	{value: 0x0043, lo: 0xb0, hi: 0xbf},
+	// Block 0xa2, offset 0x335
+	{value: 0x0003, lo: 0x0f},
+	{value: 0x023c, lo: 0x80, hi: 0x80},
+	{value: 0x0556, lo: 0x81, hi: 0x81},
+	{value: 0x023f, lo: 0x82, hi: 0x9a},
+	{value: 0x0552, lo: 0x9b, hi: 0x9b},
+	{value: 0x024b, lo: 0x9c, hi: 0x9c},
+	{value: 0x0254, lo: 0x9d, hi: 0x9d},
+	{value: 0x025a, lo: 0x9e, hi: 0x9e},
+	{value: 0x027e, lo: 0x9f, hi: 0x9f},
+	{value: 0x026f, lo: 0xa0, hi: 0xa0},
+	{value: 0x026c, lo: 0xa1, hi: 0xa1},
+	{value: 0x01f7, lo: 0xa2, hi: 0xb2},
+	{value: 0x020c, lo: 0xb3, hi: 0xb3},
+	{value: 0x022a, lo: 0xb4, hi: 0xba},
+	{value: 0x0556, lo: 0xbb, hi: 0xbb},
+	{value: 0x023f, lo: 0xbc, hi: 0xbf},
+	// Block 0xa3, offset 0x345
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x024b, lo: 0x80, hi: 0x94},
+	{value: 0x0552, lo: 0x95, hi: 0x95},
+	{value: 0x024b, lo: 0x96, hi: 0x96},
+	{value: 0x0254, lo: 0x97, hi: 0x97},
+	{value: 0x025a, lo: 0x98, hi: 0x98},
+	{value: 0x027e, lo: 0x99, hi: 0x99},
+	{value: 0x026f, lo: 0x9a, hi: 0x9a},
+	{value: 0x026c, lo: 0x9b, hi: 0x9b},
+	{value: 0x01f7, lo: 0x9c, hi: 0xac},
+	{value: 0x020c, lo: 0xad, hi: 0xad},
+	{value: 0x022a, lo: 0xae, hi: 0xb4},
+	{value: 0x0556, lo: 0xb5, hi: 0xb5},
+	{value: 0x023f, lo: 0xb6, hi: 0xbf},
+	// Block 0xa4, offset 0x353
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x025d, lo: 0x80, hi: 0x8e},
+	{value: 0x0552, lo: 0x8f, hi: 0x8f},
+	{value: 0x024b, lo: 0x90, hi: 0x90},
+	{value: 0x0254, lo: 0x91, hi: 0x91},
+	{value: 0x025a, lo: 0x92, hi: 0x92},
+	{value: 0x027e, lo: 0x93, hi: 0x93},
+	{value: 0x026f, lo: 0x94, hi: 0x94},
+	{value: 0x026c, lo: 0x95, hi: 0x95},
+	{value: 0x01f7, lo: 0x96, hi: 0xa6},
+	{value: 0x020c, lo: 0xa7, hi: 0xa7},
+	{value: 0x022a, lo: 0xa8, hi: 0xae},
+	{value: 0x0556, lo: 0xaf, hi: 0xaf},
+	{value: 0x023f, lo: 0xb0, hi: 0xbf},
+	// Block 0xa5, offset 0x361
+	{value: 0x0003, lo: 0x0d},
+	{value: 0x026f, lo: 0x80, hi: 0x88},
+	{value: 0x0552, lo: 0x89, hi: 0x89},
+	{value: 0x024b, lo: 0x8a, hi: 0x8a},
+	{value: 0x0254, lo: 0x8b, hi: 0x8b},
+	{value: 0x025a, lo: 0x8c, hi: 0x8c},
+	{value: 0x027e, lo: 0x8d, hi: 0x8d},
+	{value: 0x026f, lo: 0x8e, hi: 0x8e},
+	{value: 0x026c, lo: 0x8f, hi: 0x8f},
+	{value: 0x01f7, lo: 0x90, hi: 0xa0},
+	{value: 0x020c, lo: 0xa1, hi: 0xa1},
+	{value: 0x022a, lo: 0xa2, hi: 0xa8},
+	{value: 0x0556, lo: 0xa9, hi: 0xa9},
+	{value: 0x023f, lo: 0xaa, hi: 0xbf},
+	// Block 0xa6, offset 0x36f
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0x8f, hi: 0x8f},
+	// Block 0xa7, offset 0x371
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xae, hi: 0xae},
+	// Block 0xa8, offset 0x373
+	{value: 0x0000, lo: 0x01},
+	{value: 0x8133, lo: 0xac, hi: 0xaf},
+	// Block 0xa9, offset 0x375
+	{value: 0x0000, lo: 0x03},
+	{value: 0x8134, lo: 0xac, hi: 0xad},
+	{value: 0x812e, lo: 0xae, hi: 0xae},
+	{value: 0x8133, lo: 0xaf, hi: 0xaf},
+	// Block 0xaa, offset 0x379
+	{value: 0x0000, lo: 0x01},
+	{value: 0x812e, lo: 0x90, hi: 0x96},
+	// Block 0xab, offset 0x37b
+	{value: 0x0000, lo: 0x02},
+	{value: 0x8133, lo: 0x84, hi: 0x89},
+	{value: 0x8103, lo: 0x8a, hi: 0x8a},
+	// Block 0xac, offset 0x37e
+	{value: 0x0002, lo: 0x0a},
+	{value: 0x0063, lo: 0x80, hi: 0x89},
+	{value: 0x1a7e, lo: 0x8a, hi: 0x8a},
+	{value: 0x1ab1, lo: 0x8b, hi: 0x8b},
+	{value: 0x1acc, lo: 0x8c, hi: 0x8c},
+	{value: 0x1ad2, lo: 0x8d, hi: 0x8d},
+	{value: 0x1cf0, lo: 0x8e, hi: 0x8e},
+	{value: 0x1ade, lo: 0x8f, hi: 0x8f},
+	{value: 0x1aa8, lo: 0xaa, hi: 0xaa},
+	{value: 0x1aab, lo: 0xab, hi: 0xab},
+	{value: 0x1aae, lo: 0xac, hi: 0xac},
+	// Block 0xad, offset 0x389
+	{value: 0x0000, lo: 0x01},
+	{value: 0x1a6c, lo: 0x90, hi: 0x90},
+	// Block 0xae, offset 0x38b
+	{value: 0x0028, lo: 0x09},
+	{value: 0x2999, lo: 0x80, hi: 0x80},
+	{value: 0x295d, lo: 0x81, hi: 0x81},
+	{value: 0x2967, lo: 0x82, hi: 0x82},
+	{value: 0x297b, lo: 0x83, hi: 0x84},
+	{value: 0x2985, lo: 0x85, hi: 0x86},
+	{value: 0x2971, lo: 0x87, hi: 0x87},
+	{value: 0x298f, lo: 0x88, hi: 0x88},
+	{value: 0x0c6a, lo: 0x90, hi: 0x90},
+	{value: 0x09e2, lo: 0x91, hi: 0x91},
+	// Block 0xaf, offset 0x395
+	{value: 0x0002, lo: 0x01},
+	{value: 0x0021, lo: 0xb0, hi: 0xb9},
+}
+
+// recompMap: 7528 bytes (entries only)
+var recompMap map[uint32]rune
+var recompMapOnce sync.Once
+
+const recompMapPacked = "" +
+	"\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0
+	"\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1
+	"\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2
+	"\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3
+	"\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4
+	"\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5
+	"\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7
+	"\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8
+	"\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9
+	"\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA
+	"\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB
+	"\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC
+	"\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD
+	"\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE
+	"\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF
+	"\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1
+	"\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2
+	"\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3
+	"\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4
+	"\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5
+	"\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6
+	"\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9
+	"\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA
+	"\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB
+	"\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC
+	"\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD
+	"\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0
+	"\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1
+	"\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2
+	"\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3
+	"\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4
+	"\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5
+	"\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7
+	"\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8
+	"\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9
+	"\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA
+	"\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB
+	"\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC
+	"\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED
+	"\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE
+	"\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF
+	"\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1
+	"\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2
+	"\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3
+	"\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4
+	"\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5
+	"\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6
+	"\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9
+	"\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA
+	"\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB
+	"\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC
+	"\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD
+	"\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF
+	"\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100
+	"\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101
+	"\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102
+	"\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103
+	"\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104
+	"\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105
+	"\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106
+	"\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107
+	"\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108
+	"\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109
+	"\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A
+	"\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B
+	"\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C
+	"\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D
+	"\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E
+	"\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F
+	"\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112
+	"\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113
+	"\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114
+	"\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115
+	"\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116
+	"\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117
+	"\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118
+	"\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119
+	"\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A
+	"\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B
+	"\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C
+	"\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D
+	"\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E
+	"\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F
+	"\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120
+	"\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121
+	"\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122
+	"\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123
+	"\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124
+	"\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125
+	"\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128
+	"\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129
+	"\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A
+	"\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B
+	"\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C
+	"\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D
+	"\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E
+	"\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F
+	"\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130
+	"\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134
+	"\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135
+	"\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136
+	"\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137
+	"\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139
+	"\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A
+	"\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B
+	"\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C
+	"\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D
+	"\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E
+	"\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143
+	"\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144
+	"\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145
+	"\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146
+	"\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147
+	"\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148
+	"\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C
+	"\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D
+	"\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E
+	"\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F
+	"\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150
+	"\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151
+	"\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154
+	"\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155
+	"\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156
+	"\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157
+	"\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158
+	"\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159
+	"\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A
+	"\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B
+	"\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C
+	"\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D
+	"\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E
+	"\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F
+	"\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160
+	"\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161
+	"\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162
+	"\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163
+	"\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164
+	"\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165
+	"\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168
+	"\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169
+	"\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A
+	"\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B
+	"\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C
+	"\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D
+	"\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E
+	"\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F
+	"\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170
+	"\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171
+	"\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172
+	"\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173
+	"\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174
+	"\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175
+	"\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176
+	"\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177
+	"\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178
+	"\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179
+	"\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A
+	"\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B
+	"\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C
+	"\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D
+	"\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E
+	"\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0
+	"\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1
+	"\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF
+	"\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0
+	"\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD
+	"\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE
+	"\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF
+	"\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0
+	"\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1
+	"\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2
+	"\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3
+	"\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4
+	"\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5
+	"\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6
+	"\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7
+	"\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8
+	"\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9
+	"\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA
+	"\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB
+	"\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC
+	"\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE
+	"\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF
+	"\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0
+	"\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1
+	"\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2
+	"\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3
+	"\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6
+	"\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7
+	"\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8
+	"\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9
+	"\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA
+	"\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB
+	"\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC
+	"\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED
+	"\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE
+	"\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF
+	"\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0
+	"\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4
+	"\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5
+	"\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8
+	"\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9
+	"\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA
+	"\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB
+	"\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC
+	"\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD
+	"\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE
+	"\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF
+	"\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200
+	"\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201
+	"\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202
+	"\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203
+	"\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204
+	"\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205
+	"\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206
+	"\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207
+	"\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208
+	"\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209
+	"\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A
+	"\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B
+	"\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C
+	"\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D
+	"\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E
+	"\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F
+	"\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210
+	"\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211
+	"\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212
+	"\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213
+	"\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214
+	"\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215
+	"\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216
+	"\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217
+	"\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218
+	"\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219
+	"\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A
+	"\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B
+	"\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E
+	"\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F
+	"\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226
+	"\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227
+	"\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228
+	"\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229
+	"\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A
+	"\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B
+	"\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C
+	"\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D
+	"\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E
+	"\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F
+	"\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230
+	"\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231
+	"\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232
+	"\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233
+	"\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385
+	"\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386
+	"\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388
+	"\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389
+	"\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A
+	"\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C
+	"\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E
+	"\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F
+	"\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390
+	"\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA
+	"\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB
+	"\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC
+	"\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD
+	"\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE
+	"\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF
+	"\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0
+	"\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA
+	"\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB
+	"\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC
+	"\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD
+	"\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE
+	"\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3
+	"\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4
+	"\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400
+	"\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401
+	"\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403
+	"\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407
+	"\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C
+	"\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D
+	"\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E
+	"\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419
+	"\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439
+	"\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450
+	"\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451
+	"\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453
+	"\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457
+	"\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C
+	"\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D
+	"\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E
+	"\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476
+	"\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477
+	"\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1
+	"\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2
+	"\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0
+	"\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1
+	"\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2
+	"\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3
+	"\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6
+	"\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7
+	"\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA
+	"\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB
+	"\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC
+	"\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD
+	"\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE
+	"\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF
+	"\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2
+	"\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3
+	"\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4
+	"\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5
+	"\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6
+	"\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7
+	"\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA
+	"\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB
+	"\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC
+	"\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED
+	"\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE
+	"\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF
+	"\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0
+	"\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1
+	"\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2
+	"\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3
+	"\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4
+	"\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5
+	"\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8
+	"\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9
+	"\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622
+	"\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623
+	"\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624
+	"\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625
+	"\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626
+	"\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0
+	"\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2
+	"\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3
+	"\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929
+	"\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931
+	"\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934
+	"\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB
+	"\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC
+	"\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48
+	"\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B
+	"\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C
+	"\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94
+	"\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA
+	"\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB
+	"\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC
+	"\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48
+	"\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0
+	"\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7
+	"\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8
+	"\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA
+	"\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB
+	"\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A
+	"\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B
+	"\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C
+	"\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA
+	"\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC
+	"\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD
+	"\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE
+	"\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026
+	"\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06
+	"\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08
+	"\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A
+	"\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C
+	"\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E
+	"\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12
+	"\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B
+	"\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D
+	"\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40
+	"\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41
+	"\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43
+	"\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00
+	"\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01
+	"\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02
+	"\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03
+	"\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04
+	"\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05
+	"\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06
+	"\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07
+	"\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08
+	"\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09
+	"\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A
+	"\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B
+	"\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C
+	"\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D
+	"\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E
+	"\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F
+	"\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10
+	"\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11
+	"\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12
+	"\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13
+	"\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14
+	"\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15
+	"\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16
+	"\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17
+	"\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18
+	"\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19
+	"\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A
+	"\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B
+	"\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C
+	"\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D
+	"\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E
+	"\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F
+	"\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20
+	"\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21
+	"\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22
+	"\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23
+	"\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24
+	"\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25
+	"\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26
+	"\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27
+	"\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28
+	"\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29
+	"\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A
+	"\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B
+	"\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C
+	"\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D
+	"\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E
+	"\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F
+	"\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30
+	"\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31
+	"\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32
+	"\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33
+	"\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34
+	"\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35
+	"\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36
+	"\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37
+	"\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38
+	"\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39
+	"\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A
+	"\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B
+	"\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C
+	"\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D
+	"\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E
+	"\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F
+	"\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40
+	"\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41
+	"\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42
+	"\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43
+	"\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44
+	"\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45
+	"\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46
+	"\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47
+	"\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48
+	"\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49
+	"\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A
+	"\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B
+	"\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C
+	"\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D
+	"\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E
+	"\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F
+	"\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50
+	"\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51
+	"\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52
+	"\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53
+	"\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54
+	"\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55
+	"\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56
+	"\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57
+	"\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58
+	"\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59
+	"\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A
+	"\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B
+	"\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C
+	"\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D
+	"\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E
+	"\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F
+	"\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60
+	"\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61
+	"\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62
+	"\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63
+	"\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64
+	"\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65
+	"\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66
+	"\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67
+	"\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68
+	"\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69
+	"\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A
+	"\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B
+	"\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C
+	"\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D
+	"\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E
+	"\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F
+	"\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70
+	"\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71
+	"\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72
+	"\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73
+	"\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74
+	"\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75
+	"\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76
+	"\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77
+	"\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78
+	"\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79
+	"\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A
+	"\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B
+	"\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C
+	"\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D
+	"\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E
+	"\x00v\x03#\x00\x00\x1e\x7f" + // 0x00760323: 0x00001E7F
+	"\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80
+	"\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81
+	"\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82
+	"\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83
+	"\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84
+	"\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85
+	"\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86
+	"\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87
+	"\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88
+	"\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89
+	"\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A
+	"\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B
+	"\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C
+	"\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D
+	"\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E
+	"\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F
+	"\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90
+	"\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91
+	"\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92
+	"\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93
+	"\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94
+	"\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95
+	"\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96
+	"\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97
+	"\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98
+	"\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99
+	"\x01\x7f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B
+	"\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0
+	"\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1
+	"\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2
+	"\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3
+	"\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4
+	"\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5
+	"\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6
+	"\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7
+	"\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8
+	"\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9
+	"\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA
+	"\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB
+	"\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC
+	"\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD
+	"\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE
+	"\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF
+	"\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0
+	"\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1
+	"\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2
+	"\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3
+	"\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4
+	"\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5
+	"\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6
+	"\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7
+	"\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8
+	"\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9
+	"\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA
+	"\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB
+	"\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC
+	"\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD
+	"\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE
+	"\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF
+	"\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0
+	"\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1
+	"\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2
+	"\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3
+	"\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4
+	"\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5
+	"\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6
+	"\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7
+	"\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8
+	"\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9
+	"\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA
+	"\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB
+	"\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC
+	"\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD
+	"\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE
+	"\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF
+	"\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0
+	"\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1
+	"\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2
+	"\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3
+	"\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4
+	"\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5
+	"\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6
+	"\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7
+	"\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8
+	"\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9
+	"\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA
+	"\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB
+	"\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC
+	"\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD
+	"\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE
+	"\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF
+	"\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0
+	"\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1
+	"\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2
+	"\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3
+	"\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4
+	"\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5
+	"\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6
+	"\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7
+	"\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8
+	"\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9
+	"\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA
+	"\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB
+	"\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC
+	"\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED
+	"\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE
+	"\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF
+	"\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0
+	"\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1
+	"\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2
+	"\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3
+	"\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4
+	"\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5
+	"\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6
+	"\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7
+	"\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8
+	"\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9
+	"\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00
+	"\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01
+	"\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02
+	"\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03
+	"\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04
+	"\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05
+	"\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06
+	"\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07
+	"\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08
+	"\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09
+	"\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A
+	"\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B
+	"\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C
+	"\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D
+	"\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E
+	"\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F
+	"\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10
+	"\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11
+	"\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12
+	"\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13
+	"\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14
+	"\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15
+	"\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18
+	"\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19
+	"\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A
+	"\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B
+	"\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C
+	"\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D
+	"\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20
+	"\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21
+	"\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22
+	"\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23
+	"\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24
+	"\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25
+	"\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26
+	"\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27
+	"\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28
+	"\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29
+	"\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A
+	"\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B
+	"\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C
+	"\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D
+	"\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E
+	"\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F
+	"\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30
+	"\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31
+	"\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32
+	"\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33
+	"\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34
+	"\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35
+	"\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36
+	"\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37
+	"\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38
+	"\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39
+	"\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A
+	"\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B
+	"\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C
+	"\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D
+	"\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E
+	"\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F
+	"\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40
+	"\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41
+	"\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42
+	"\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43
+	"\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44
+	"\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45
+	"\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48
+	"\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49
+	"\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A
+	"\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B
+	"\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C
+	"\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D
+	"\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50
+	"\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51
+	"\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52
+	"\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53
+	"\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54
+	"\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55
+	"\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56
+	"\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57
+	"\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59
+	"\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B
+	"\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D
+	"\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F
+	"\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60
+	"\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61
+	"\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62
+	"\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63
+	"\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64
+	"\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65
+	"\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66
+	"\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67
+	"\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68
+	"\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69
+	"\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A
+	"\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B
+	"\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C
+	"\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D
+	"\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E
+	"\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F
+	"\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70
+	"\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72
+	"\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74
+	"\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76
+	"\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78
+	"\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A
+	"\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C
+	"\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80
+	"\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81
+	"\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82
+	"\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83
+	"\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84
+	"\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85
+	"\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86
+	"\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87
+	"\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88
+	"\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89
+	"\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A
+	"\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B
+	"\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C
+	"\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D
+	"\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E
+	"\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F
+	"\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90
+	"\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91
+	"\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92
+	"\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93
+	"\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94
+	"\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95
+	"\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96
+	"\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97
+	"\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98
+	"\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99
+	"\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A
+	"\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B
+	"\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C
+	"\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D
+	"\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E
+	"\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F
+	"\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0
+	"\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1
+	"\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2
+	"\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3
+	"\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4
+	"\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5
+	"\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6
+	"\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7
+	"\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8
+	"\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9
+	"\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA
+	"\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB
+	"\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC
+	"\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD
+	"\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE
+	"\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF
+	"\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0
+	"\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1
+	"\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2
+	"\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3
+	"\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4
+	"\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6
+	"\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7
+	"\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8
+	"\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9
+	"\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA
+	"\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC
+	"\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1
+	"\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2
+	"\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3
+	"\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4
+	"\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6
+	"\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7
+	"\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8
+	"\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA
+	"\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC
+	"\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD
+	"\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE
+	"\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF
+	"\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0
+	"\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1
+	"\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2
+	"\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6
+	"\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7
+	"\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8
+	"\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9
+	"\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA
+	"\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD
+	"\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE
+	"\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF
+	"\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0
+	"\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1
+	"\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2
+	"\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4
+	"\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5
+	"\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6
+	"\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7
+	"\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8
+	"\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9
+	"\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA
+	"\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC
+	"\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED
+	"\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2
+	"\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3
+	"\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4
+	"\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6
+	"\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7
+	"\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8
+	"\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA
+	"\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC
+	"!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A
+	"!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B
+	"!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE
+	"!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD
+	"!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE
+	"!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF
+	"\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204
+	"\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209
+	"\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C
+	"\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224
+	"\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226
+	"\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241
+	"\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244
+	"\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247
+	"\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249
+	"\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260
+	"\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262
+	"\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D
+	"\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E
+	"\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F
+	"\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270
+	"\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271
+	"\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274
+	"\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275
+	"\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278
+	"\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279
+	"\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280
+	"\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281
+	"\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284
+	"\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285
+	"\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288
+	"\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289
+	"\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC
+	"\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD
+	"\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE
+	"\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF
+	"\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0
+	"\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1
+	"\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2
+	"\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3
+	"\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA
+	"\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB
+	"\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC
+	"\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED
+	"0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C
+	"0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E
+	"0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050
+	"0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052
+	"0S0\x99\x00\x000T" + // 0x30533099: 0x00003054
+	"0U0\x99\x00\x000V" + // 0x30553099: 0x00003056
+	"0W0\x99\x00\x000X" + // 0x30573099: 0x00003058
+	"0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A
+	"0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C
+	"0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E
+	"0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060
+	"0a0\x99\x00\x000b" + // 0x30613099: 0x00003062
+	"0d0\x99\x00\x000e" + // 0x30643099: 0x00003065
+	"0f0\x99\x00\x000g" + // 0x30663099: 0x00003067
+	"0h0\x99\x00\x000i" + // 0x30683099: 0x00003069
+	"0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070
+	"0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071
+	"0r0\x99\x00\x000s" + // 0x30723099: 0x00003073
+	"0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074
+	"0u0\x99\x00\x000v" + // 0x30753099: 0x00003076
+	"0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077
+	"0x0\x99\x00\x000y" + // 0x30783099: 0x00003079
+	"0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A
+	"0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C
+	"0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D
+	"0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094
+	"0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E
+	"0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC
+	"0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE
+	"0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0
+	"0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2
+	"0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4
+	"0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6
+	"0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8
+	"0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA
+	"0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC
+	"0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE
+	"0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0
+	"0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2
+	"0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5
+	"0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7
+	"0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9
+	"0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0
+	"0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1
+	"0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3
+	"0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4
+	"0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6
+	"0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7
+	"0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9
+	"0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA
+	"0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC
+	"0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD
+	"0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4
+	"0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7
+	"0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8
+	"0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9
+	"0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA
+	"0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE
+	"\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A
+	"\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C
+	"\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB
+	"\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E
+	"\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F
+	"\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B
+	"\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C
+	"\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB
+	"\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC
+	"\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE
+	"\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA
+	"\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB
+	"\x195\x190\x00\x01\x198" + // 0x19351930: 0x00011938
+	""
+	// Total size of tables: 56KB (57068 bytes)
diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
index 0175eae50aa..bf65457d9b4 100644
--- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
+++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go
@@ -1,7 +1,6 @@
 // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
 
 //go:build !go1.10
-// +build !go1.10
 
 package norm
 
diff --git a/vendor/golang.org/x/text/unicode/norm/trie.go b/vendor/golang.org/x/text/unicode/norm/trie.go
index 423386bf436..e4250ae22ce 100644
--- a/vendor/golang.org/x/text/unicode/norm/trie.go
+++ b/vendor/golang.org/x/text/unicode/norm/trie.go
@@ -29,7 +29,7 @@ var (
 	nfkcData = newNfkcTrie(0)
 )
 
-// lookupValue determines the type of block n and looks up the value for b.
+// lookup determines the type of block n and looks up the value for b.
 // For n < t.cutoff, the block is a simple lookup table. Otherwise, the block
 // is a list of ranges with an accompanying value. Given a matching range r,
 // the value for b is by r.value + (b - r.lo) * stride.
diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
index 2ed25a75024..165ede0f8f3 100644
--- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
+++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
@@ -27,10 +27,9 @@ import (
 	"go/token"
 	"go/types"
 	"io"
-	"io/ioutil"
 	"os/exec"
 
-	"golang.org/x/tools/go/internal/gcimporter"
+	"golang.org/x/tools/internal/gcimporter"
 )
 
 // Find returns the name of an object (.o) or archive (.a) file
@@ -85,9 +84,26 @@ func NewReader(r io.Reader) (io.Reader, error) {
 	}
 }
 
+// readAll works the same way as io.ReadAll, but avoids allocations and copies
+// by preallocating a byte slice of the necessary size if the size is known up
+// front. This is always possible when the input is an archive. In that case,
+// NewReader will return the known size using an io.LimitedReader.
+func readAll(r io.Reader) ([]byte, error) {
+	if lr, ok := r.(*io.LimitedReader); ok {
+		data := make([]byte, lr.N)
+		_, err := io.ReadFull(lr, data)
+		return data, err
+	}
+	return io.ReadAll(r)
+}
+
 // Read reads export data from in, decodes it, and returns type
 // information for the package.
-// The package name is specified by path.
+//
+// The package path (effectively its linker symbol prefix) is
+// specified by path, since unlike the package name, this information
+// may not be recorded in the export data.
+//
 // File position information is added to fset.
 //
 // Read may inspect and add to the imports map to ensure that references
@@ -98,7 +114,7 @@ func NewReader(r io.Reader) (io.Reader, error) {
 //
 // On return, the state of the reader is undefined.
 func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package, path string) (*types.Package, error) {
-	data, err := ioutil.ReadAll(in)
+	data, err := readAll(in)
 	if err != nil {
 		return nil, fmt.Errorf("reading export data for %q: %v", path, err)
 	}
@@ -107,12 +123,6 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package,
 		return nil, fmt.Errorf("can't read export data for %q directly from an archive file (call gcexportdata.NewReader first to extract export data)", path)
 	}
 
-	// The App Engine Go runtime v1.6 uses the old export data format.
-	// TODO(adonovan): delete once v1.7 has been around for a while.
-	if bytes.HasPrefix(data, []byte("package ")) {
-		return gcimporter.ImportData(imports, path, path, bytes.NewReader(data))
-	}
-
 	// The indexed export format starts with an 'i'; the older
 	// binary export format starts with a 'c', 'd', or 'v'
 	// (from "version"). Select appropriate importer.
@@ -161,7 +171,7 @@ func Write(out io.Writer, fset *token.FileSet, pkg *types.Package) error {
 //
 // Experimental: This API is experimental and may change in the future.
 func ReadBundle(in io.Reader, fset *token.FileSet, imports map[string]*types.Package) ([]*types.Package, error) {
-	data, err := ioutil.ReadAll(in)
+	data, err := readAll(in)
 	if err != nil {
 		return nil, fmt.Errorf("reading export bundle: %v", err)
 	}
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/go/internal/gcimporter/gcimporter.go
deleted file mode 100644
index e96c39600d1..00000000000
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/gcimporter.go
+++ /dev/null
@@ -1,1125 +0,0 @@
-// Copyright 2011 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// This file is a modified copy of $GOROOT/src/go/internal/gcimporter/gcimporter.go,
-// but it also contains the original source-based importer code for Go1.6.
-// Once we stop supporting 1.6, we can remove that code.
-
-// Package gcimporter provides various functions for reading
-// gc-generated object files that can be used to implement the
-// Importer interface defined by the Go 1.5 standard library package.
-package gcimporter // import "golang.org/x/tools/go/internal/gcimporter"
-
-import (
-	"bufio"
-	"errors"
-	"fmt"
-	"go/build"
-	"go/constant"
-	"go/token"
-	"go/types"
-	"io"
-	"io/ioutil"
-	"os"
-	"path/filepath"
-	"sort"
-	"strconv"
-	"strings"
-	"text/scanner"
-)
-
-const (
-	// Enable debug during development: it adds some additional checks, and
-	// prevents errors from being recovered.
-	debug = false
-
-	// If trace is set, debugging output is printed to std out.
-	trace = false
-)
-
-var pkgExts = [...]string{".a", ".o"}
-
-// FindPkg returns the filename and unique package id for an import
-// path based on package information provided by build.Import (using
-// the build.Default build.Context). A relative srcDir is interpreted
-// relative to the current working directory.
-// If no file was found, an empty filename is returned.
-func FindPkg(path, srcDir string) (filename, id string) {
-	if path == "" {
-		return
-	}
-
-	var noext string
-	switch {
-	default:
-		// "x" -> "$GOPATH/pkg/$GOOS_$GOARCH/x.ext", "x"
-		// Don't require the source files to be present.
-		if abs, err := filepath.Abs(srcDir); err == nil { // see issue 14282
-			srcDir = abs
-		}
-		bp, _ := build.Import(path, srcDir, build.FindOnly|build.AllowBinary)
-		if bp.PkgObj == "" {
-			id = path // make sure we have an id to print in error message
-			return
-		}
-		noext = strings.TrimSuffix(bp.PkgObj, ".a")
-		id = bp.ImportPath
-
-	case build.IsLocalImport(path):
-		// "./x" -> "/this/directory/x.ext", "/this/directory/x"
-		noext = filepath.Join(srcDir, path)
-		id = noext
-
-	case filepath.IsAbs(path):
-		// for completeness only - go/build.Import
-		// does not support absolute imports
-		// "/x" -> "/x.ext", "/x"
-		noext = path
-		id = path
-	}
-
-	if false { // for debugging
-		if path != id {
-			fmt.Printf("%s -> %s\n", path, id)
-		}
-	}
-
-	// try extensions
-	for _, ext := range pkgExts {
-		filename = noext + ext
-		if f, err := os.Stat(filename); err == nil && !f.IsDir() {
-			return
-		}
-	}
-
-	filename = "" // not found
-	return
-}
-
-// ImportData imports a package by reading the gc-generated export data,
-// adds the corresponding package object to the packages map indexed by id,
-// and returns the object.
-//
-// The packages map must contains all packages already imported. The data
-// reader position must be the beginning of the export data section. The
-// filename is only used in error messages.
-//
-// If packages[id] contains the completely imported package, that package
-// can be used directly, and there is no need to call this function (but
-// there is also no harm but for extra time used).
-func ImportData(packages map[string]*types.Package, filename, id string, data io.Reader) (pkg *types.Package, err error) {
-	// support for parser error handling
-	defer func() {
-		switch r := recover().(type) {
-		case nil:
-			// nothing to do
-		case importError:
-			err = r
-		default:
-			panic(r) // internal error
-		}
-	}()
-
-	var p parser
-	p.init(filename, id, data, packages)
-	pkg = p.parseExport()
-
-	return
-}
-
-// Import imports a gc-generated package given its import path and srcDir, adds
-// the corresponding package object to the packages map, and returns the object.
-// The packages map must contain all packages already imported.
-func Import(packages map[string]*types.Package, path, srcDir string, lookup func(path string) (io.ReadCloser, error)) (pkg *types.Package, err error) {
-	var rc io.ReadCloser
-	var filename, id string
-	if lookup != nil {
-		// With custom lookup specified, assume that caller has
-		// converted path to a canonical import path for use in the map.
-		if path == "unsafe" {
-			return types.Unsafe, nil
-		}
-		id = path
-
-		// No need to re-import if the package was imported completely before.
-		if pkg = packages[id]; pkg != nil && pkg.Complete() {
-			return
-		}
-		f, err := lookup(path)
-		if err != nil {
-			return nil, err
-		}
-		rc = f
-	} else {
-		filename, id = FindPkg(path, srcDir)
-		if filename == "" {
-			if path == "unsafe" {
-				return types.Unsafe, nil
-			}
-			return nil, fmt.Errorf("can't find import: %q", id)
-		}
-
-		// no need to re-import if the package was imported completely before
-		if pkg = packages[id]; pkg != nil && pkg.Complete() {
-			return
-		}
-
-		// open file
-		f, err := os.Open(filename)
-		if err != nil {
-			return nil, err
-		}
-		defer func() {
-			if err != nil {
-				// add file name to error
-				err = fmt.Errorf("%s: %v", filename, err)
-			}
-		}()
-		rc = f
-	}
-	defer rc.Close()
-
-	var hdr string
-	var size int64
-	buf := bufio.NewReader(rc)
-	if hdr, size, err = FindExportData(buf); err != nil {
-		return
-	}
-
-	switch hdr {
-	case "$$\n":
-		// Work-around if we don't have a filename; happens only if lookup != nil.
-		// Either way, the filename is only needed for importer error messages, so
-		// this is fine.
-		if filename == "" {
-			filename = path
-		}
-		return ImportData(packages, filename, id, buf)
-
-	case "$$B\n":
-		var data []byte
-		data, err = ioutil.ReadAll(buf)
-		if err != nil {
-			break
-		}
-
-		// TODO(gri): allow clients of go/importer to provide a FileSet.
-		// Or, define a new standard go/types/gcexportdata package.
-		fset := token.NewFileSet()
-
-		// The indexed export format starts with an 'i'; the older
-		// binary export format starts with a 'c', 'd', or 'v'
-		// (from "version"). Select appropriate importer.
-		if len(data) > 0 {
-			switch data[0] {
-			case 'i':
-				_, pkg, err := IImportData(fset, packages, data[1:], id)
-				return pkg, err
-
-			case 'v', 'c', 'd':
-				_, pkg, err := BImportData(fset, packages, data, id)
-				return pkg, err
-
-			case 'u':
-				_, pkg, err := UImportData(fset, packages, data[1:size], id)
-				return pkg, err
-
-			default:
-				l := len(data)
-				if l > 10 {
-					l = 10
-				}
-				return nil, fmt.Errorf("unexpected export data with prefix %q for path %s", string(data[:l]), id)
-			}
-		}
-
-	default:
-		err = fmt.Errorf("unknown export data header: %q", hdr)
-	}
-
-	return
-}
-
-// ----------------------------------------------------------------------------
-// Parser
-
-// TODO(gri) Imported objects don't have position information.
-//           Ideally use the debug table line info; alternatively
-//           create some fake position (or the position of the
-//           import). That way error messages referring to imported
-//           objects can print meaningful information.
-
-// parser parses the exports inside a gc compiler-produced
-// object/archive file and populates its scope with the results.
-type parser struct {
-	scanner    scanner.Scanner
-	tok        rune                      // current token
-	lit        string                    // literal string; only valid for Ident, Int, String tokens
-	id         string                    // package id of imported package
-	sharedPkgs map[string]*types.Package // package id -> package object (across importer)
-	localPkgs  map[string]*types.Package // package id -> package object (just this package)
-}
-
-func (p *parser) init(filename, id string, src io.Reader, packages map[string]*types.Package) {
-	p.scanner.Init(src)
-	p.scanner.Error = func(_ *scanner.Scanner, msg string) { p.error(msg) }
-	p.scanner.Mode = scanner.ScanIdents | scanner.ScanInts | scanner.ScanChars | scanner.ScanStrings | scanner.ScanComments | scanner.SkipComments
-	p.scanner.Whitespace = 1<<'\t' | 1<<' '
-	p.scanner.Filename = filename // for good error messages
-	p.next()
-	p.id = id
-	p.sharedPkgs = packages
-	if debug {
-		// check consistency of packages map
-		for _, pkg := range packages {
-			if pkg.Name() == "" {
-				fmt.Printf("no package name for %s\n", pkg.Path())
-			}
-		}
-	}
-}
-
-func (p *parser) next() {
-	p.tok = p.scanner.Scan()
-	switch p.tok {
-	case scanner.Ident, scanner.Int, scanner.Char, scanner.String, '·':
-		p.lit = p.scanner.TokenText()
-	default:
-		p.lit = ""
-	}
-	if debug {
-		fmt.Printf("%s: %q -> %q\n", scanner.TokenString(p.tok), p.scanner.TokenText(), p.lit)
-	}
-}
-
-func declTypeName(pkg *types.Package, name string) *types.TypeName {
-	scope := pkg.Scope()
-	if obj := scope.Lookup(name); obj != nil {
-		return obj.(*types.TypeName)
-	}
-	obj := types.NewTypeName(token.NoPos, pkg, name, nil)
-	// a named type may be referred to before the underlying type
-	// is known - set it up
-	types.NewNamed(obj, nil, nil)
-	scope.Insert(obj)
-	return obj
-}
-
-// ----------------------------------------------------------------------------
-// Error handling
-
-// Internal errors are boxed as importErrors.
-type importError struct {
-	pos scanner.Position
-	err error
-}
-
-func (e importError) Error() string {
-	return fmt.Sprintf("import error %s (byte offset = %d): %s", e.pos, e.pos.Offset, e.err)
-}
-
-func (p *parser) error(err interface{}) {
-	if s, ok := err.(string); ok {
-		err = errors.New(s)
-	}
-	// panic with a runtime.Error if err is not an error
-	panic(importError{p.scanner.Pos(), err.(error)})
-}
-
-func (p *parser) errorf(format string, args ...interface{}) {
-	p.error(fmt.Sprintf(format, args...))
-}
-
-func (p *parser) expect(tok rune) string {
-	lit := p.lit
-	if p.tok != tok {
-		p.errorf("expected %s, got %s (%s)", scanner.TokenString(tok), scanner.TokenString(p.tok), lit)
-	}
-	p.next()
-	return lit
-}
-
-func (p *parser) expectSpecial(tok string) {
-	sep := 'x' // not white space
-	i := 0
-	for i < len(tok) && p.tok == rune(tok[i]) && sep > ' ' {
-		sep = p.scanner.Peek() // if sep <= ' ', there is white space before the next token
-		p.next()
-		i++
-	}
-	if i < len(tok) {
-		p.errorf("expected %q, got %q", tok, tok[0:i])
-	}
-}
-
-func (p *parser) expectKeyword(keyword string) {
-	lit := p.expect(scanner.Ident)
-	if lit != keyword {
-		p.errorf("expected keyword %s, got %q", keyword, lit)
-	}
-}
-
-// ----------------------------------------------------------------------------
-// Qualified and unqualified names
-
-// parsePackageID parses a PackageId:
-//
-//	PackageId = string_lit .
-func (p *parser) parsePackageID() string {
-	id, err := strconv.Unquote(p.expect(scanner.String))
-	if err != nil {
-		p.error(err)
-	}
-	// id == "" stands for the imported package id
-	// (only known at time of package installation)
-	if id == "" {
-		id = p.id
-	}
-	return id
-}
-
-// parsePackageName parse a PackageName:
-//
-//	PackageName = ident .
-func (p *parser) parsePackageName() string {
-	return p.expect(scanner.Ident)
-}
-
-// parseDotIdent parses a dotIdentifier:
-//
-//	dotIdentifier = ( ident | '·' ) { ident | int | '·' } .
-func (p *parser) parseDotIdent() string {
-	ident := ""
-	if p.tok != scanner.Int {
-		sep := 'x' // not white space
-		for (p.tok == scanner.Ident || p.tok == scanner.Int || p.tok == '·') && sep > ' ' {
-			ident += p.lit
-			sep = p.scanner.Peek() // if sep <= ' ', there is white space before the next token
-			p.next()
-		}
-	}
-	if ident == "" {
-		p.expect(scanner.Ident) // use expect() for error handling
-	}
-	return ident
-}
-
-// parseQualifiedName parses a QualifiedName:
-//
-//	QualifiedName = "@" PackageId "." ( "?" | dotIdentifier ) .
-func (p *parser) parseQualifiedName() (id, name string) {
-	p.expect('@')
-	id = p.parsePackageID()
-	p.expect('.')
-	// Per rev f280b8a485fd (10/2/2013), qualified names may be used for anonymous fields.
-	if p.tok == '?' {
-		p.next()
-	} else {
-		name = p.parseDotIdent()
-	}
-	return
-}
-
-// getPkg returns the package for a given id. If the package is
-// not found, create the package and add it to the p.localPkgs
-// and p.sharedPkgs maps. name is the (expected) name of the
-// package. If name == "", the package name is expected to be
-// set later via an import clause in the export data.
-//
-// id identifies a package, usually by a canonical package path like
-// "encoding/json" but possibly by a non-canonical import path like
-// "./json".
-func (p *parser) getPkg(id, name string) *types.Package {
-	// package unsafe is not in the packages maps - handle explicitly
-	if id == "unsafe" {
-		return types.Unsafe
-	}
-
-	pkg := p.localPkgs[id]
-	if pkg == nil {
-		// first import of id from this package
-		pkg = p.sharedPkgs[id]
-		if pkg == nil {
-			// first import of id by this importer;
-			// add (possibly unnamed) pkg to shared packages
-			pkg = types.NewPackage(id, name)
-			p.sharedPkgs[id] = pkg
-		}
-		// add (possibly unnamed) pkg to local packages
-		if p.localPkgs == nil {
-			p.localPkgs = make(map[string]*types.Package)
-		}
-		p.localPkgs[id] = pkg
-	} else if name != "" {
-		// package exists already and we have an expected package name;
-		// make sure names match or set package name if necessary
-		if pname := pkg.Name(); pname == "" {
-			pkg.SetName(name)
-		} else if pname != name {
-			p.errorf("%s package name mismatch: %s (given) vs %s (expected)", id, pname, name)
-		}
-	}
-	return pkg
-}
-
-// parseExportedName is like parseQualifiedName, but
-// the package id is resolved to an imported *types.Package.
-func (p *parser) parseExportedName() (pkg *types.Package, name string) {
-	id, name := p.parseQualifiedName()
-	pkg = p.getPkg(id, "")
-	return
-}
-
-// ----------------------------------------------------------------------------
-// Types
-
-// parseBasicType parses a BasicType:
-//
-//	BasicType = identifier .
-func (p *parser) parseBasicType() types.Type {
-	id := p.expect(scanner.Ident)
-	obj := types.Universe.Lookup(id)
-	if obj, ok := obj.(*types.TypeName); ok {
-		return obj.Type()
-	}
-	p.errorf("not a basic type: %s", id)
-	return nil
-}
-
-// parseArrayType parses an ArrayType:
-//
-//	ArrayType = "[" int_lit "]" Type .
-func (p *parser) parseArrayType(parent *types.Package) types.Type {
-	// "[" already consumed and lookahead known not to be "]"
-	lit := p.expect(scanner.Int)
-	p.expect(']')
-	elem := p.parseType(parent)
-	n, err := strconv.ParseInt(lit, 10, 64)
-	if err != nil {
-		p.error(err)
-	}
-	return types.NewArray(elem, n)
-}
-
-// parseMapType parses a MapType:
-//
-//	MapType = "map" "[" Type "]" Type .
-func (p *parser) parseMapType(parent *types.Package) types.Type {
-	p.expectKeyword("map")
-	p.expect('[')
-	key := p.parseType(parent)
-	p.expect(']')
-	elem := p.parseType(parent)
-	return types.NewMap(key, elem)
-}
-
-// parseName parses a Name:
-//
-//	Name = identifier | "?" | QualifiedName .
-//
-// For unqualified and anonymous names, the returned package is the parent
-// package unless parent == nil, in which case the returned package is the
-// package being imported. (The parent package is not nil if the name
-// is an unqualified struct field or interface method name belonging to a
-// type declared in another package.)
-//
-// For qualified names, the returned package is nil (and not created if
-// it doesn't exist yet) unless materializePkg is set (which creates an
-// unnamed package with valid package path). In the latter case, a
-// subsequent import clause is expected to provide a name for the package.
-func (p *parser) parseName(parent *types.Package, materializePkg bool) (pkg *types.Package, name string) {
-	pkg = parent
-	if pkg == nil {
-		pkg = p.sharedPkgs[p.id]
-	}
-	switch p.tok {
-	case scanner.Ident:
-		name = p.lit
-		p.next()
-	case '?':
-		// anonymous
-		p.next()
-	case '@':
-		// exported name prefixed with package path
-		pkg = nil
-		var id string
-		id, name = p.parseQualifiedName()
-		if materializePkg {
-			pkg = p.getPkg(id, "")
-		}
-	default:
-		p.error("name expected")
-	}
-	return
-}
-
-func deref(typ types.Type) types.Type {
-	if p, _ := typ.(*types.Pointer); p != nil {
-		return p.Elem()
-	}
-	return typ
-}
-
-// parseField parses a Field:
-//
-//	Field = Name Type [ string_lit ] .
-func (p *parser) parseField(parent *types.Package) (*types.Var, string) {
-	pkg, name := p.parseName(parent, true)
-
-	if name == "_" {
-		// Blank fields should be package-qualified because they
-		// are unexported identifiers, but gc does not qualify them.
-		// Assuming that the ident belongs to the current package
-		// causes types to change during re-exporting, leading
-		// to spurious "can't assign A to B" errors from go/types.
-		// As a workaround, pretend all blank fields belong
-		// to the same unique dummy package.
-		const blankpkg = "<_>"
-		pkg = p.getPkg(blankpkg, blankpkg)
-	}
-
-	typ := p.parseType(parent)
-	anonymous := false
-	if name == "" {
-		// anonymous field - typ must be T or *T and T must be a type name
-		switch typ := deref(typ).(type) {
-		case *types.Basic: // basic types are named types
-			pkg = nil // objects defined in Universe scope have no package
-			name = typ.Name()
-		case *types.Named:
-			name = typ.Obj().Name()
-		default:
-			p.errorf("anonymous field expected")
-		}
-		anonymous = true
-	}
-	tag := ""
-	if p.tok == scanner.String {
-		s := p.expect(scanner.String)
-		var err error
-		tag, err = strconv.Unquote(s)
-		if err != nil {
-			p.errorf("invalid struct tag %s: %s", s, err)
-		}
-	}
-	return types.NewField(token.NoPos, pkg, name, typ, anonymous), tag
-}
-
-// parseStructType parses a StructType:
-//
-//	StructType = "struct" "{" [ FieldList ] "}" .
-//	FieldList  = Field { ";" Field } .
-func (p *parser) parseStructType(parent *types.Package) types.Type {
-	var fields []*types.Var
-	var tags []string
-
-	p.expectKeyword("struct")
-	p.expect('{')
-	for i := 0; p.tok != '}' && p.tok != scanner.EOF; i++ {
-		if i > 0 {
-			p.expect(';')
-		}
-		fld, tag := p.parseField(parent)
-		if tag != "" && tags == nil {
-			tags = make([]string, i)
-		}
-		if tags != nil {
-			tags = append(tags, tag)
-		}
-		fields = append(fields, fld)
-	}
-	p.expect('}')
-
-	return types.NewStruct(fields, tags)
-}
-
-// parseParameter parses a Parameter:
-//
-//	Parameter = ( identifier | "?" ) [ "..." ] Type [ string_lit ] .
-func (p *parser) parseParameter() (par *types.Var, isVariadic bool) {
-	_, name := p.parseName(nil, false)
-	// remove gc-specific parameter numbering
-	if i := strings.Index(name, "·"); i >= 0 {
-		name = name[:i]
-	}
-	if p.tok == '.' {
-		p.expectSpecial("...")
-		isVariadic = true
-	}
-	typ := p.parseType(nil)
-	if isVariadic {
-		typ = types.NewSlice(typ)
-	}
-	// ignore argument tag (e.g. "noescape")
-	if p.tok == scanner.String {
-		p.next()
-	}
-	// TODO(gri) should we provide a package?
-	par = types.NewVar(token.NoPos, nil, name, typ)
-	return
-}
-
-// parseParameters parses a Parameters:
-//
-//	Parameters    = "(" [ ParameterList ] ")" .
-//	ParameterList = { Parameter "," } Parameter .
-func (p *parser) parseParameters() (list []*types.Var, isVariadic bool) {
-	p.expect('(')
-	for p.tok != ')' && p.tok != scanner.EOF {
-		if len(list) > 0 {
-			p.expect(',')
-		}
-		par, variadic := p.parseParameter()
-		list = append(list, par)
-		if variadic {
-			if isVariadic {
-				p.error("... not on final argument")
-			}
-			isVariadic = true
-		}
-	}
-	p.expect(')')
-
-	return
-}
-
-// parseSignature parses a Signature:
-//
-//	Signature = Parameters [ Result ] .
-//	Result    = Type | Parameters .
-func (p *parser) parseSignature(recv *types.Var) *types.Signature {
-	params, isVariadic := p.parseParameters()
-
-	// optional result type
-	var results []*types.Var
-	if p.tok == '(' {
-		var variadic bool
-		results, variadic = p.parseParameters()
-		if variadic {
-			p.error("... not permitted on result type")
-		}
-	}
-
-	return types.NewSignature(recv, types.NewTuple(params...), types.NewTuple(results...), isVariadic)
-}
-
-// parseInterfaceType parses an InterfaceType:
-//
-//	InterfaceType = "interface" "{" [ MethodList ] "}" .
-//	MethodList    = Method { ";" Method } .
-//	Method        = Name Signature .
-//
-// The methods of embedded interfaces are always "inlined"
-// by the compiler and thus embedded interfaces are never
-// visible in the export data.
-func (p *parser) parseInterfaceType(parent *types.Package) types.Type {
-	var methods []*types.Func
-
-	p.expectKeyword("interface")
-	p.expect('{')
-	for i := 0; p.tok != '}' && p.tok != scanner.EOF; i++ {
-		if i > 0 {
-			p.expect(';')
-		}
-		pkg, name := p.parseName(parent, true)
-		sig := p.parseSignature(nil)
-		methods = append(methods, types.NewFunc(token.NoPos, pkg, name, sig))
-	}
-	p.expect('}')
-
-	// Complete requires the type's embedded interfaces to be fully defined,
-	// but we do not define any
-	return newInterface(methods, nil).Complete()
-}
-
-// parseChanType parses a ChanType:
-//
-//	ChanType = ( "chan" [ "<-" ] | "<-" "chan" ) Type .
-func (p *parser) parseChanType(parent *types.Package) types.Type {
-	dir := types.SendRecv
-	if p.tok == scanner.Ident {
-		p.expectKeyword("chan")
-		if p.tok == '<' {
-			p.expectSpecial("<-")
-			dir = types.SendOnly
-		}
-	} else {
-		p.expectSpecial("<-")
-		p.expectKeyword("chan")
-		dir = types.RecvOnly
-	}
-	elem := p.parseType(parent)
-	return types.NewChan(dir, elem)
-}
-
-// parseType parses a Type:
-//
-//	Type =
-//		BasicType | TypeName | ArrayType | SliceType | StructType |
-//		PointerType | FuncType | InterfaceType | MapType | ChanType |
-//		"(" Type ")" .
-//
-//	BasicType   = ident .
-//	TypeName    = ExportedName .
-//	SliceType   = "[" "]" Type .
-//	PointerType = "*" Type .
-//	FuncType    = "func" Signature .
-func (p *parser) parseType(parent *types.Package) types.Type {
-	switch p.tok {
-	case scanner.Ident:
-		switch p.lit {
-		default:
-			return p.parseBasicType()
-		case "struct":
-			return p.parseStructType(parent)
-		case "func":
-			// FuncType
-			p.next()
-			return p.parseSignature(nil)
-		case "interface":
-			return p.parseInterfaceType(parent)
-		case "map":
-			return p.parseMapType(parent)
-		case "chan":
-			return p.parseChanType(parent)
-		}
-	case '@':
-		// TypeName
-		pkg, name := p.parseExportedName()
-		return declTypeName(pkg, name).Type()
-	case '[':
-		p.next() // look ahead
-		if p.tok == ']' {
-			// SliceType
-			p.next()
-			return types.NewSlice(p.parseType(parent))
-		}
-		return p.parseArrayType(parent)
-	case '*':
-		// PointerType
-		p.next()
-		return types.NewPointer(p.parseType(parent))
-	case '<':
-		return p.parseChanType(parent)
-	case '(':
-		// "(" Type ")"
-		p.next()
-		typ := p.parseType(parent)
-		p.expect(')')
-		return typ
-	}
-	p.errorf("expected type, got %s (%q)", scanner.TokenString(p.tok), p.lit)
-	return nil
-}
-
-// ----------------------------------------------------------------------------
-// Declarations
-
-// parseImportDecl parses an ImportDecl:
-//
-//	ImportDecl = "import" PackageName PackageId .
-func (p *parser) parseImportDecl() {
-	p.expectKeyword("import")
-	name := p.parsePackageName()
-	p.getPkg(p.parsePackageID(), name)
-}
-
-// parseInt parses an int_lit:
-//
-//	int_lit = [ "+" | "-" ] { "0" ... "9" } .
-func (p *parser) parseInt() string {
-	s := ""
-	switch p.tok {
-	case '-':
-		s = "-"
-		p.next()
-	case '+':
-		p.next()
-	}
-	return s + p.expect(scanner.Int)
-}
-
-// parseNumber parses a number:
-//
-//	number = int_lit [ "p" int_lit ] .
-func (p *parser) parseNumber() (typ *types.Basic, val constant.Value) {
-	// mantissa
-	mant := constant.MakeFromLiteral(p.parseInt(), token.INT, 0)
-	if mant == nil {
-		panic("invalid mantissa")
-	}
-
-	if p.lit == "p" {
-		// exponent (base 2)
-		p.next()
-		exp, err := strconv.ParseInt(p.parseInt(), 10, 0)
-		if err != nil {
-			p.error(err)
-		}
-		if exp < 0 {
-			denom := constant.MakeInt64(1)
-			denom = constant.Shift(denom, token.SHL, uint(-exp))
-			typ = types.Typ[types.UntypedFloat]
-			val = constant.BinaryOp(mant, token.QUO, denom)
-			return
-		}
-		if exp > 0 {
-			mant = constant.Shift(mant, token.SHL, uint(exp))
-		}
-		typ = types.Typ[types.UntypedFloat]
-		val = mant
-		return
-	}
-
-	typ = types.Typ[types.UntypedInt]
-	val = mant
-	return
-}
-
-// parseConstDecl parses a ConstDecl:
-//
-//	ConstDecl   = "const" ExportedName [ Type ] "=" Literal .
-//	Literal     = bool_lit | int_lit | float_lit | complex_lit | rune_lit | string_lit .
-//	bool_lit    = "true" | "false" .
-//	complex_lit = "(" float_lit "+" float_lit "i" ")" .
-//	rune_lit    = "(" int_lit "+" int_lit ")" .
-//	string_lit  = `"` { unicode_char } `"` .
-func (p *parser) parseConstDecl() {
-	p.expectKeyword("const")
-	pkg, name := p.parseExportedName()
-
-	var typ0 types.Type
-	if p.tok != '=' {
-		// constant types are never structured - no need for parent type
-		typ0 = p.parseType(nil)
-	}
-
-	p.expect('=')
-	var typ types.Type
-	var val constant.Value
-	switch p.tok {
-	case scanner.Ident:
-		// bool_lit
-		if p.lit != "true" && p.lit != "false" {
-			p.error("expected true or false")
-		}
-		typ = types.Typ[types.UntypedBool]
-		val = constant.MakeBool(p.lit == "true")
-		p.next()
-
-	case '-', scanner.Int:
-		// int_lit
-		typ, val = p.parseNumber()
-
-	case '(':
-		// complex_lit or rune_lit
-		p.next()
-		if p.tok == scanner.Char {
-			p.next()
-			p.expect('+')
-			typ = types.Typ[types.UntypedRune]
-			_, val = p.parseNumber()
-			p.expect(')')
-			break
-		}
-		_, re := p.parseNumber()
-		p.expect('+')
-		_, im := p.parseNumber()
-		p.expectKeyword("i")
-		p.expect(')')
-		typ = types.Typ[types.UntypedComplex]
-		val = constant.BinaryOp(re, token.ADD, constant.MakeImag(im))
-
-	case scanner.Char:
-		// rune_lit
-		typ = types.Typ[types.UntypedRune]
-		val = constant.MakeFromLiteral(p.lit, token.CHAR, 0)
-		p.next()
-
-	case scanner.String:
-		// string_lit
-		typ = types.Typ[types.UntypedString]
-		val = constant.MakeFromLiteral(p.lit, token.STRING, 0)
-		p.next()
-
-	default:
-		p.errorf("expected literal got %s", scanner.TokenString(p.tok))
-	}
-
-	if typ0 == nil {
-		typ0 = typ
-	}
-
-	pkg.Scope().Insert(types.NewConst(token.NoPos, pkg, name, typ0, val))
-}
-
-// parseTypeDecl parses a TypeDecl:
-//
-//	TypeDecl = "type" ExportedName Type .
-func (p *parser) parseTypeDecl() {
-	p.expectKeyword("type")
-	pkg, name := p.parseExportedName()
-	obj := declTypeName(pkg, name)
-
-	// The type object may have been imported before and thus already
-	// have a type associated with it. We still need to parse the type
-	// structure, but throw it away if the object already has a type.
-	// This ensures that all imports refer to the same type object for
-	// a given type declaration.
-	typ := p.parseType(pkg)
-
-	if name := obj.Type().(*types.Named); name.Underlying() == nil {
-		name.SetUnderlying(typ)
-	}
-}
-
-// parseVarDecl parses a VarDecl:
-//
-//	VarDecl = "var" ExportedName Type .
-func (p *parser) parseVarDecl() {
-	p.expectKeyword("var")
-	pkg, name := p.parseExportedName()
-	typ := p.parseType(pkg)
-	pkg.Scope().Insert(types.NewVar(token.NoPos, pkg, name, typ))
-}
-
-// parseFunc parses a Func:
-//
-//	Func = Signature [ Body ] .
-//	Body = "{" ... "}" .
-func (p *parser) parseFunc(recv *types.Var) *types.Signature {
-	sig := p.parseSignature(recv)
-	if p.tok == '{' {
-		p.next()
-		for i := 1; i > 0; p.next() {
-			switch p.tok {
-			case '{':
-				i++
-			case '}':
-				i--
-			}
-		}
-	}
-	return sig
-}
-
-// parseMethodDecl parses a MethodDecl:
-//
-//	MethodDecl = "func" Receiver Name Func .
-//	Receiver   = "(" ( identifier | "?" ) [ "*" ] ExportedName ")" .
-func (p *parser) parseMethodDecl() {
-	// "func" already consumed
-	p.expect('(')
-	recv, _ := p.parseParameter() // receiver
-	p.expect(')')
-
-	// determine receiver base type object
-	base := deref(recv.Type()).(*types.Named)
-
-	// parse method name, signature, and possibly inlined body
-	_, name := p.parseName(nil, false)
-	sig := p.parseFunc(recv)
-
-	// methods always belong to the same package as the base type object
-	pkg := base.Obj().Pkg()
-
-	// add method to type unless type was imported before
-	// and method exists already
-	// TODO(gri) This leads to a quadratic algorithm - ok for now because method counts are small.
-	base.AddMethod(types.NewFunc(token.NoPos, pkg, name, sig))
-}
-
-// parseFuncDecl parses a FuncDecl:
-//
-//	FuncDecl = "func" ExportedName Func .
-func (p *parser) parseFuncDecl() {
-	// "func" already consumed
-	pkg, name := p.parseExportedName()
-	typ := p.parseFunc(nil)
-	pkg.Scope().Insert(types.NewFunc(token.NoPos, pkg, name, typ))
-}
-
-// parseDecl parses a Decl:
-//
-//	Decl = [ ImportDecl | ConstDecl | TypeDecl | VarDecl | FuncDecl | MethodDecl ] "\n" .
-func (p *parser) parseDecl() {
-	if p.tok == scanner.Ident {
-		switch p.lit {
-		case "import":
-			p.parseImportDecl()
-		case "const":
-			p.parseConstDecl()
-		case "type":
-			p.parseTypeDecl()
-		case "var":
-			p.parseVarDecl()
-		case "func":
-			p.next() // look ahead
-			if p.tok == '(' {
-				p.parseMethodDecl()
-			} else {
-				p.parseFuncDecl()
-			}
-		}
-	}
-	p.expect('\n')
-}
-
-// ----------------------------------------------------------------------------
-// Export
-
-// parseExport parses an Export:
-//
-//	Export        = "PackageClause { Decl } "$$" .
-//	PackageClause = "package" PackageName [ "safe" ] "\n" .
-func (p *parser) parseExport() *types.Package {
-	p.expectKeyword("package")
-	name := p.parsePackageName()
-	if p.tok == scanner.Ident && p.lit == "safe" {
-		// package was compiled with -u option - ignore
-		p.next()
-	}
-	p.expect('\n')
-
-	pkg := p.getPkg(p.id, name)
-
-	for p.tok != '$' && p.tok != scanner.EOF {
-		p.parseDecl()
-	}
-
-	if ch := p.scanner.Peek(); p.tok != '$' || ch != '$' {
-		// don't call next()/expect() since reading past the
-		// export data may cause scanner errors (e.g. NUL chars)
-		p.errorf("expected '$$', got %s %c", scanner.TokenString(p.tok), ch)
-	}
-
-	if n := p.scanner.ErrorCount; n != 0 {
-		p.errorf("expected no scanner errors, got %d", n)
-	}
-
-	// Record all locally referenced packages as imports.
-	var imports []*types.Package
-	for id, pkg2 := range p.localPkgs {
-		if pkg2.Name() == "" {
-			p.errorf("%s package has no name", id)
-		}
-		if id == p.id {
-			continue // avoid self-edge
-		}
-		imports = append(imports, pkg2)
-	}
-	sort.Sort(byPath(imports))
-	pkg.SetImports(imports)
-
-	// package was imported completely and without errors
-	pkg.MarkComplete()
-
-	return pkg
-}
-
-type byPath []*types.Package
-
-func (a byPath) Len() int           { return len(a) }
-func (a byPath) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
-func (a byPath) Less(i, j int) bool { return a[i].Path() < a[j].Path() }
diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go
index de881562de1..6bb7168d2e3 100644
--- a/vendor/golang.org/x/tools/go/packages/golist.go
+++ b/vendor/golang.org/x/tools/go/packages/golist.go
@@ -60,6 +60,7 @@ func (r *responseDeduper) addAll(dr *driverResponse) {
 	for _, root := range dr.Roots {
 		r.addRoot(root)
 	}
+	r.dr.GoVersion = dr.GoVersion
 }
 
 func (r *responseDeduper) addPackage(p *Package) {
@@ -454,11 +455,14 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse
 	if err != nil {
 		return nil, err
 	}
+
 	seen := make(map[string]*jsonPackage)
 	pkgs := make(map[string]*Package)
 	additionalErrors := make(map[string][]Error)
 	// Decode the JSON and convert it to Package form.
-	var response driverResponse
+	response := &driverResponse{
+		GoVersion: goVersion,
+	}
 	for dec := json.NewDecoder(buf); dec.More(); {
 		p := new(jsonPackage)
 		if err := dec.Decode(p); err != nil {
@@ -600,17 +604,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse
 
 		// Work around https://golang.org/issue/28749:
 		// cmd/go puts assembly, C, and C++ files in CompiledGoFiles.
-		// Filter out any elements of CompiledGoFiles that are also in OtherFiles.
-		// We have to keep this workaround in place until go1.12 is a distant memory.
-		if len(pkg.OtherFiles) > 0 {
-			other := make(map[string]bool, len(pkg.OtherFiles))
-			for _, f := range pkg.OtherFiles {
-				other[f] = true
-			}
-
+		// Remove files from CompiledGoFiles that are non-go files
+		// (or are not files that look like they are from the cache).
+		if len(pkg.CompiledGoFiles) > 0 {
 			out := pkg.CompiledGoFiles[:0]
 			for _, f := range pkg.CompiledGoFiles {
-				if other[f] {
+				if ext := filepath.Ext(f); ext != ".go" && ext != "" { // ext == "" means the file is from the cache, so probably cgo-processed file
 					continue
 				}
 				out = append(out, f)
@@ -730,7 +729,7 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse
 	}
 	sort.Slice(response.Packages, func(i, j int) bool { return response.Packages[i].ID < response.Packages[j].ID })
 
-	return &response, nil
+	return response, nil
 }
 
 func (state *golistState) shouldAddFilenameFromError(p *jsonPackage) bool {
@@ -756,6 +755,7 @@ func (state *golistState) shouldAddFilenameFromError(p *jsonPackage) bool {
 	return len(p.Error.ImportStack) == 0 || p.Error.ImportStack[len(p.Error.ImportStack)-1] == p.ImportPath
 }
 
+// getGoVersion returns the effective minor version of the go command.
 func (state *golistState) getGoVersion() (int, error) {
 	state.goVersionOnce.Do(func() {
 		state.goVersion, state.goVersionError = gocommand.GoVersion(state.ctx, state.cfgInvocation(), state.cfg.gocmdRunner)
diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go
index a93dc6add4d..0f1505b808a 100644
--- a/vendor/golang.org/x/tools/go/packages/packages.go
+++ b/vendor/golang.org/x/tools/go/packages/packages.go
@@ -15,10 +15,12 @@ import (
 	"go/scanner"
 	"go/token"
 	"go/types"
+	"io"
 	"io/ioutil"
 	"log"
 	"os"
 	"path/filepath"
+	"runtime"
 	"strings"
 	"sync"
 	"time"
@@ -233,6 +235,11 @@ type driverResponse struct {
 	// Imports will be connected and then type and syntax information added in a
 	// later pass (see refine).
 	Packages []*Package
+
+	// GoVersion is the minor version number used by the driver
+	// (e.g. the go command on the PATH) when selecting .go files.
+	// Zero means unknown.
+	GoVersion int
 }
 
 // Load loads and returns the Go packages named by the given patterns.
@@ -256,7 +263,7 @@ func Load(cfg *Config, patterns ...string) ([]*Package, error) {
 		return nil, err
 	}
 	l.sizes = response.Sizes
-	return l.refine(response.Roots, response.Packages...)
+	return l.refine(response)
 }
 
 // defaultDriver is a driver that implements go/packages' fallback behavior.
@@ -297,6 +304,9 @@ type Package struct {
 	// of the package, or while parsing or type-checking its files.
 	Errors []Error
 
+	// TypeErrors contains the subset of errors produced during type checking.
+	TypeErrors []types.Error
+
 	// GoFiles lists the absolute file paths of the package's Go source files.
 	GoFiles []string
 
@@ -532,6 +542,7 @@ type loaderPackage struct {
 	needsrc      bool  // load from source (Mode >= LoadTypes)
 	needtypes    bool  // type information is either requested or depended on
 	initial      bool  // package was matched by a pattern
+	goVersion    int   // minor version number of go command on PATH
 }
 
 // loader holds the working state of a single call to load.
@@ -618,7 +629,8 @@ func newLoader(cfg *Config) *loader {
 
 // refine connects the supplied packages into a graph and then adds type and
 // and syntax information as requested by the LoadMode.
-func (ld *loader) refine(roots []string, list ...*Package) ([]*Package, error) {
+func (ld *loader) refine(response *driverResponse) ([]*Package, error) {
+	roots := response.Roots
 	rootMap := make(map[string]int, len(roots))
 	for i, root := range roots {
 		rootMap[root] = i
@@ -626,7 +638,7 @@ func (ld *loader) refine(roots []string, list ...*Package) ([]*Package, error) {
 	ld.pkgs = make(map[string]*loaderPackage)
 	// first pass, fixup and build the map and roots
 	var initial = make([]*loaderPackage, len(roots))
-	for _, pkg := range list {
+	for _, pkg := range response.Packages {
 		rootIndex := -1
 		if i, found := rootMap[pkg.ID]; found {
 			rootIndex = i
@@ -648,6 +660,7 @@ func (ld *loader) refine(roots []string, list ...*Package) ([]*Package, error) {
 			Package:   pkg,
 			needtypes: needtypes,
 			needsrc:   needsrc,
+			goVersion: response.GoVersion,
 		}
 		ld.pkgs[lpkg.ID] = lpkg
 		if rootIndex >= 0 {
@@ -865,12 +878,19 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) {
 	// never has to create a types.Package for an indirect dependency,
 	// which would then require that such created packages be explicitly
 	// inserted back into the Import graph as a final step after export data loading.
+	// (Hence this return is after the Types assignment.)
 	// The Diamond test exercises this case.
 	if !lpkg.needtypes && !lpkg.needsrc {
 		return
 	}
 	if !lpkg.needsrc {
-		ld.loadFromExportData(lpkg)
+		if err := ld.loadFromExportData(lpkg); err != nil {
+			lpkg.Errors = append(lpkg.Errors, Error{
+				Pos:  "-",
+				Msg:  err.Error(),
+				Kind: UnknownError, // e.g. can't find/open/parse export data
+			})
+		}
 		return // not a source package, don't get syntax trees
 	}
 
@@ -902,6 +922,7 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) {
 
 		case types.Error:
 			// from type checker
+			lpkg.TypeErrors = append(lpkg.TypeErrors, err)
 			errs = append(errs, Error{
 				Pos:  err.Fset.Position(err.Pos).String(),
 				Msg:  err.Msg,
@@ -923,11 +944,41 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) {
 		lpkg.Errors = append(lpkg.Errors, errs...)
 	}
 
+	// If the go command on the PATH is newer than the runtime,
+	// then the go/{scanner,ast,parser,types} packages from the
+	// standard library may be unable to process the files
+	// selected by go list.
+	//
+	// There is currently no way to downgrade the effective
+	// version of the go command (see issue 52078), so we proceed
+	// with the newer go command but, in case of parse or type
+	// errors, we emit an additional diagnostic.
+	//
+	// See:
+	// - golang.org/issue/52078 (flag to set release tags)
+	// - golang.org/issue/50825 (gopls legacy version support)
+	// - golang.org/issue/55883 (go/packages confusing error)
+	//
+	// Should we assert a hard minimum of (currently) go1.16 here?
+	var runtimeVersion int
+	if _, err := fmt.Sscanf(runtime.Version(), "go1.%d", &runtimeVersion); err == nil && runtimeVersion < lpkg.goVersion {
+		defer func() {
+			if len(lpkg.Errors) > 0 {
+				appendError(Error{
+					Pos:  "-",
+					Msg:  fmt.Sprintf("This application uses version go1.%d of the source-processing packages but runs version go1.%d of 'go list'. It may fail to process source files that rely on newer language features. If so, rebuild the application using a newer version of Go.", runtimeVersion, lpkg.goVersion),
+					Kind: UnknownError,
+				})
+			}
+		}()
+	}
+
 	if ld.Config.Mode&NeedTypes != 0 && len(lpkg.CompiledGoFiles) == 0 && lpkg.ExportFile != "" {
 		// The config requested loading sources and types, but sources are missing.
 		// Add an error to the package and fall back to loading from export data.
 		appendError(Error{"-", fmt.Sprintf("sources missing for package %s", lpkg.ID), ParseError})
-		ld.loadFromExportData(lpkg)
+		_ = ld.loadFromExportData(lpkg) // ignore any secondary errors
+
 		return // can't get syntax trees for this package
 	}
 
@@ -981,7 +1032,7 @@ func (ld *loader) loadPackage(lpkg *loaderPackage) {
 	tc := &types.Config{
 		Importer: importer,
 
-		// Type-check bodies of functions only in non-initial packages.
+		// Type-check bodies of functions only in initial packages.
 		// Example: for import graph A->B->C and initial packages {A,C},
 		// we can ignore function bodies in B.
 		IgnoreFuncBodies: ld.Mode&NeedDeps == 0 && !lpkg.initial,
@@ -1151,9 +1202,10 @@ func sameFile(x, y string) bool {
 	return false
 }
 
-// loadFromExportData returns type information for the specified
+// loadFromExportData ensures that type information is present for the specified
 // package, loading it from an export data file on the first request.
-func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error) {
+// On success it sets lpkg.Types to a new Package.
+func (ld *loader) loadFromExportData(lpkg *loaderPackage) error {
 	if lpkg.PkgPath == "" {
 		log.Fatalf("internal error: Package %s has no PkgPath", lpkg)
 	}
@@ -1164,8 +1216,8 @@ func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error
 	// must be sequential. (Finer-grained locking would require
 	// changes to the gcexportdata API.)
 	//
-	// The exportMu lock guards the Package.Pkg field and the
-	// types.Package it points to, for each Package in the graph.
+	// The exportMu lock guards the lpkg.Types field and the
+	// types.Package it points to, for each loaderPackage in the graph.
 	//
 	// Not all accesses to Package.Pkg need to be protected by exportMu:
 	// graph ordering ensures that direct dependencies of source
@@ -1174,18 +1226,18 @@ func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error
 	defer ld.exportMu.Unlock()
 
 	if tpkg := lpkg.Types; tpkg != nil && tpkg.Complete() {
-		return tpkg, nil // cache hit
+		return nil // cache hit
 	}
 
 	lpkg.IllTyped = true // fail safe
 
 	if lpkg.ExportFile == "" {
 		// Errors while building export data will have been printed to stderr.
-		return nil, fmt.Errorf("no export data file")
+		return fmt.Errorf("no export data file")
 	}
 	f, err := os.Open(lpkg.ExportFile)
 	if err != nil {
-		return nil, err
+		return err
 	}
 	defer f.Close()
 
@@ -1197,7 +1249,7 @@ func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error
 	// queries.)
 	r, err := gcexportdata.NewReader(f)
 	if err != nil {
-		return nil, fmt.Errorf("reading %s: %v", lpkg.ExportFile, err)
+		return fmt.Errorf("reading %s: %v", lpkg.ExportFile, err)
 	}
 
 	// Build the view.
@@ -1241,7 +1293,7 @@ func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error
 	// (May modify incomplete packages in view but not create new ones.)
 	tpkg, err := gcexportdata.Read(r, ld.Fset, view, lpkg.PkgPath)
 	if err != nil {
-		return nil, fmt.Errorf("reading %s: %v", lpkg.ExportFile, err)
+		return fmt.Errorf("reading %s: %v", lpkg.ExportFile, err)
 	}
 	if _, ok := view["go.shape"]; ok {
 		// Account for the pseudopackage "go.shape" that gets
@@ -1254,8 +1306,7 @@ func (ld *loader) loadFromExportData(lpkg *loaderPackage) (*types.Package, error
 
 	lpkg.Types = tpkg
 	lpkg.IllTyped = false
-
-	return tpkg, nil
+	return nil
 }
 
 // impliedLoadMode returns loadMode with its dependencies.
@@ -1271,3 +1322,5 @@ func impliedLoadMode(loadMode LoadMode) LoadMode {
 func usesExportData(cfg *Config) bool {
 	return cfg.Mode&NeedExportFile != 0 || cfg.Mode&NeedTypes != 0 && cfg.Mode&NeedDeps == 0
 }
+
+var _ interface{} = io.Discard // assert build toolchain is go1.16 or later
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/bexport.go b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go
similarity index 99%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/bexport.go
rename to vendor/golang.org/x/tools/internal/gcimporter/bexport.go
index 196cb3f9b41..30582ed6d3d 100644
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/bexport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go
@@ -12,7 +12,6 @@ import (
 	"bytes"
 	"encoding/binary"
 	"fmt"
-	"go/ast"
 	"go/constant"
 	"go/token"
 	"go/types"
@@ -145,7 +144,7 @@ func BExportData(fset *token.FileSet, pkg *types.Package) (b []byte, err error)
 	objcount := 0
 	scope := pkg.Scope()
 	for _, name := range scope.Names() {
-		if !ast.IsExported(name) {
+		if !token.IsExported(name) {
 			continue
 		}
 		if trace {
@@ -482,7 +481,7 @@ func (p *exporter) method(m *types.Func) {
 
 	p.pos(m)
 	p.string(m.Name())
-	if m.Name() != "_" && !ast.IsExported(m.Name()) {
+	if m.Name() != "_" && !token.IsExported(m.Name()) {
 		p.pkg(m.Pkg(), false)
 	}
 
@@ -501,7 +500,7 @@ func (p *exporter) fieldName(f *types.Var) {
 		// 3) field name doesn't match base type name (alias name)
 		bname := basetypeName(f.Type())
 		if name == bname {
-			if ast.IsExported(name) {
+			if token.IsExported(name) {
 				name = "" // 1) we don't need to know the field name or package
 			} else {
 				name = "?" // 2) use unexported name "?" to force package export
@@ -514,7 +513,7 @@ func (p *exporter) fieldName(f *types.Var) {
 	}
 
 	p.string(name)
-	if name != "" && !ast.IsExported(name) {
+	if name != "" && !token.IsExported(name) {
 		p.pkg(f.Pkg(), false)
 	}
 }
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/bimport.go b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/bimport.go
rename to vendor/golang.org/x/tools/internal/gcimporter/bimport.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/exportdata.go b/vendor/golang.org/x/tools/internal/gcimporter/exportdata.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/exportdata.go
rename to vendor/golang.org/x/tools/internal/gcimporter/exportdata.go
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go
new file mode 100644
index 00000000000..0372fb3a646
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go
@@ -0,0 +1,265 @@
+// Copyright 2011 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// This file is a reduced copy of $GOROOT/src/go/internal/gcimporter/gcimporter.go.
+
+// Package gcimporter provides various functions for reading
+// gc-generated object files that can be used to implement the
+// Importer interface defined by the Go 1.5 standard library package.
+package gcimporter // import "golang.org/x/tools/internal/gcimporter"
+
+import (
+	"bufio"
+	"bytes"
+	"fmt"
+	"go/build"
+	"go/token"
+	"go/types"
+	"io"
+	"io/ioutil"
+	"os"
+	"os/exec"
+	"path/filepath"
+	"strings"
+	"sync"
+)
+
+const (
+	// Enable debug during development: it adds some additional checks, and
+	// prevents errors from being recovered.
+	debug = false
+
+	// If trace is set, debugging output is printed to std out.
+	trace = false
+)
+
+var exportMap sync.Map // package dir → func() (string, bool)
+
+// lookupGorootExport returns the location of the export data
+// (normally found in the build cache, but located in GOROOT/pkg
+// in prior Go releases) for the package located in pkgDir.
+//
+// (We use the package's directory instead of its import path
+// mainly to simplify handling of the packages in src/vendor
+// and cmd/vendor.)
+func lookupGorootExport(pkgDir string) (string, bool) {
+	f, ok := exportMap.Load(pkgDir)
+	if !ok {
+		var (
+			listOnce   sync.Once
+			exportPath string
+		)
+		f, _ = exportMap.LoadOrStore(pkgDir, func() (string, bool) {
+			listOnce.Do(func() {
+				cmd := exec.Command("go", "list", "-export", "-f", "{{.Export}}", pkgDir)
+				cmd.Dir = build.Default.GOROOT
+				var output []byte
+				output, err := cmd.Output()
+				if err != nil {
+					return
+				}
+
+				exports := strings.Split(string(bytes.TrimSpace(output)), "\n")
+				if len(exports) != 1 {
+					return
+				}
+
+				exportPath = exports[0]
+			})
+
+			return exportPath, exportPath != ""
+		})
+	}
+
+	return f.(func() (string, bool))()
+}
+
+var pkgExts = [...]string{".a", ".o"}
+
+// FindPkg returns the filename and unique package id for an import
+// path based on package information provided by build.Import (using
+// the build.Default build.Context). A relative srcDir is interpreted
+// relative to the current working directory.
+// If no file was found, an empty filename is returned.
+func FindPkg(path, srcDir string) (filename, id string) {
+	if path == "" {
+		return
+	}
+
+	var noext string
+	switch {
+	default:
+		// "x" -> "$GOPATH/pkg/$GOOS_$GOARCH/x.ext", "x"
+		// Don't require the source files to be present.
+		if abs, err := filepath.Abs(srcDir); err == nil { // see issue 14282
+			srcDir = abs
+		}
+		bp, _ := build.Import(path, srcDir, build.FindOnly|build.AllowBinary)
+		if bp.PkgObj == "" {
+			var ok bool
+			if bp.Goroot && bp.Dir != "" {
+				filename, ok = lookupGorootExport(bp.Dir)
+			}
+			if !ok {
+				id = path // make sure we have an id to print in error message
+				return
+			}
+		} else {
+			noext = strings.TrimSuffix(bp.PkgObj, ".a")
+			id = bp.ImportPath
+		}
+
+	case build.IsLocalImport(path):
+		// "./x" -> "/this/directory/x.ext", "/this/directory/x"
+		noext = filepath.Join(srcDir, path)
+		id = noext
+
+	case filepath.IsAbs(path):
+		// for completeness only - go/build.Import
+		// does not support absolute imports
+		// "/x" -> "/x.ext", "/x"
+		noext = path
+		id = path
+	}
+
+	if false { // for debugging
+		if path != id {
+			fmt.Printf("%s -> %s\n", path, id)
+		}
+	}
+
+	if filename != "" {
+		if f, err := os.Stat(filename); err == nil && !f.IsDir() {
+			return
+		}
+	}
+
+	// try extensions
+	for _, ext := range pkgExts {
+		filename = noext + ext
+		if f, err := os.Stat(filename); err == nil && !f.IsDir() {
+			return
+		}
+	}
+
+	filename = "" // not found
+	return
+}
+
+// Import imports a gc-generated package given its import path and srcDir, adds
+// the corresponding package object to the packages map, and returns the object.
+// The packages map must contain all packages already imported.
+func Import(packages map[string]*types.Package, path, srcDir string, lookup func(path string) (io.ReadCloser, error)) (pkg *types.Package, err error) {
+	var rc io.ReadCloser
+	var filename, id string
+	if lookup != nil {
+		// With custom lookup specified, assume that caller has
+		// converted path to a canonical import path for use in the map.
+		if path == "unsafe" {
+			return types.Unsafe, nil
+		}
+		id = path
+
+		// No need to re-import if the package was imported completely before.
+		if pkg = packages[id]; pkg != nil && pkg.Complete() {
+			return
+		}
+		f, err := lookup(path)
+		if err != nil {
+			return nil, err
+		}
+		rc = f
+	} else {
+		filename, id = FindPkg(path, srcDir)
+		if filename == "" {
+			if path == "unsafe" {
+				return types.Unsafe, nil
+			}
+			return nil, fmt.Errorf("can't find import: %q", id)
+		}
+
+		// no need to re-import if the package was imported completely before
+		if pkg = packages[id]; pkg != nil && pkg.Complete() {
+			return
+		}
+
+		// open file
+		f, err := os.Open(filename)
+		if err != nil {
+			return nil, err
+		}
+		defer func() {
+			if err != nil {
+				// add file name to error
+				err = fmt.Errorf("%s: %v", filename, err)
+			}
+		}()
+		rc = f
+	}
+	defer rc.Close()
+
+	var hdr string
+	var size int64
+	buf := bufio.NewReader(rc)
+	if hdr, size, err = FindExportData(buf); err != nil {
+		return
+	}
+
+	switch hdr {
+	case "$$B\n":
+		var data []byte
+		data, err = ioutil.ReadAll(buf)
+		if err != nil {
+			break
+		}
+
+		// TODO(gri): allow clients of go/importer to provide a FileSet.
+		// Or, define a new standard go/types/gcexportdata package.
+		fset := token.NewFileSet()
+
+		// The indexed export format starts with an 'i'; the older
+		// binary export format starts with a 'c', 'd', or 'v'
+		// (from "version"). Select appropriate importer.
+		if len(data) > 0 {
+			switch data[0] {
+			case 'i':
+				_, pkg, err := IImportData(fset, packages, data[1:], id)
+				return pkg, err
+
+			case 'v', 'c', 'd':
+				_, pkg, err := BImportData(fset, packages, data, id)
+				return pkg, err
+
+			case 'u':
+				_, pkg, err := UImportData(fset, packages, data[1:size], id)
+				return pkg, err
+
+			default:
+				l := len(data)
+				if l > 10 {
+					l = 10
+				}
+				return nil, fmt.Errorf("unexpected export data with prefix %q for path %s", string(data[:l]), id)
+			}
+		}
+
+	default:
+		err = fmt.Errorf("unknown export data header: %q", hdr)
+	}
+
+	return
+}
+
+func deref(typ types.Type) types.Type {
+	if p, _ := typ.(*types.Pointer); p != nil {
+		return p.Elem()
+	}
+	return typ
+}
+
+type byPath []*types.Package
+
+func (a byPath) Len() int           { return len(a) }
+func (a byPath) Swap(i, j int)      { a[i], a[j] = a[j], a[i] }
+func (a byPath) Less(i, j int) bool { return a[i].Path() < a[j].Path() }
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go
similarity index 78%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/iexport.go
rename to vendor/golang.org/x/tools/internal/gcimporter/iexport.go
index 9a4ff329e12..ba53cdcdd10 100644
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/iexport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go
@@ -12,7 +12,6 @@ import (
 	"bytes"
 	"encoding/binary"
 	"fmt"
-	"go/ast"
 	"go/constant"
 	"go/token"
 	"go/types"
@@ -23,9 +22,45 @@ import (
 	"strconv"
 	"strings"
 
+	"golang.org/x/tools/internal/tokeninternal"
 	"golang.org/x/tools/internal/typeparams"
 )
 
+// IExportShallow encodes "shallow" export data for the specified package.
+//
+// No promises are made about the encoding other than that it can be
+// decoded by the same version of IIExportShallow. If you plan to save
+// export data in the file system, be sure to include a cryptographic
+// digest of the executable in the key to avoid version skew.
+func IExportShallow(fset *token.FileSet, pkg *types.Package) ([]byte, error) {
+	// In principle this operation can only fail if out.Write fails,
+	// but that's impossible for bytes.Buffer---and as a matter of
+	// fact iexportCommon doesn't even check for I/O errors.
+	// TODO(adonovan): handle I/O errors properly.
+	// TODO(adonovan): use byte slices throughout, avoiding copying.
+	const bundle, shallow = false, true
+	var out bytes.Buffer
+	err := iexportCommon(&out, fset, bundle, shallow, iexportVersion, []*types.Package{pkg})
+	return out.Bytes(), err
+}
+
+// IImportShallow decodes "shallow" types.Package data encoded by IExportShallow
+// in the same executable. This function cannot import data from
+// cmd/compile or gcexportdata.Write.
+func IImportShallow(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string, insert InsertType) (*types.Package, error) {
+	const bundle = false
+	pkgs, err := iimportCommon(fset, imports, data, bundle, path, insert)
+	if err != nil {
+		return nil, err
+	}
+	return pkgs[0], nil
+}
+
+// InsertType is the type of a function that creates a types.TypeName
+// object for a named type and inserts it into the scope of the
+// specified Package.
+type InsertType = func(pkg *types.Package, name string)
+
 // Current bundled export format version. Increase with each format change.
 // 0: initial implementation
 const bundleVersion = 0
@@ -36,15 +71,17 @@ const bundleVersion = 0
 // The package path of the top-level package will not be recorded,
 // so that calls to IImportData can override with a provided package path.
 func IExportData(out io.Writer, fset *token.FileSet, pkg *types.Package) error {
-	return iexportCommon(out, fset, false, iexportVersion, []*types.Package{pkg})
+	const bundle, shallow = false, false
+	return iexportCommon(out, fset, bundle, shallow, iexportVersion, []*types.Package{pkg})
 }
 
 // IExportBundle writes an indexed export bundle for pkgs to out.
 func IExportBundle(out io.Writer, fset *token.FileSet, pkgs []*types.Package) error {
-	return iexportCommon(out, fset, true, iexportVersion, pkgs)
+	const bundle, shallow = true, false
+	return iexportCommon(out, fset, bundle, shallow, iexportVersion, pkgs)
 }
 
-func iexportCommon(out io.Writer, fset *token.FileSet, bundle bool, version int, pkgs []*types.Package) (err error) {
+func iexportCommon(out io.Writer, fset *token.FileSet, bundle, shallow bool, version int, pkgs []*types.Package) (err error) {
 	if !debug {
 		defer func() {
 			if e := recover(); e != nil {
@@ -61,6 +98,7 @@ func iexportCommon(out io.Writer, fset *token.FileSet, bundle bool, version int,
 	p := iexporter{
 		fset:        fset,
 		version:     version,
+		shallow:     shallow,
 		allPkgs:     map[*types.Package]bool{},
 		stringIndex: map[string]uint64{},
 		declIndex:   map[types.Object]uint64{},
@@ -82,7 +120,7 @@ func iexportCommon(out io.Writer, fset *token.FileSet, bundle bool, version int,
 	for _, pkg := range pkgs {
 		scope := pkg.Scope()
 		for _, name := range scope.Names() {
-			if ast.IsExported(name) {
+			if token.IsExported(name) {
 				p.pushDecl(scope.Lookup(name))
 			}
 		}
@@ -101,6 +139,17 @@ func iexportCommon(out io.Writer, fset *token.FileSet, bundle bool, version int,
 		p.doDecl(p.declTodo.popHead())
 	}
 
+	// Produce index of offset of each file record in files.
+	var files intWriter
+	var fileOffset []uint64 // fileOffset[i] is offset in files of file encoded as i
+	if p.shallow {
+		fileOffset = make([]uint64, len(p.fileInfos))
+		for i, info := range p.fileInfos {
+			fileOffset[i] = uint64(files.Len())
+			p.encodeFile(&files, info.file, info.needed)
+		}
+	}
+
 	// Append indices to data0 section.
 	dataLen := uint64(p.data0.Len())
 	w := p.newWriter()
@@ -126,16 +175,75 @@ func iexportCommon(out io.Writer, fset *token.FileSet, bundle bool, version int,
 	}
 	hdr.uint64(uint64(p.version))
 	hdr.uint64(uint64(p.strings.Len()))
+	if p.shallow {
+		hdr.uint64(uint64(files.Len()))
+		hdr.uint64(uint64(len(fileOffset)))
+		for _, offset := range fileOffset {
+			hdr.uint64(offset)
+		}
+	}
 	hdr.uint64(dataLen)
 
 	// Flush output.
 	io.Copy(out, &hdr)
 	io.Copy(out, &p.strings)
+	if p.shallow {
+		io.Copy(out, &files)
+	}
 	io.Copy(out, &p.data0)
 
 	return nil
 }
 
+// encodeFile writes to w a representation of the file sufficient to
+// faithfully restore position information about all needed offsets.
+// Mutates the needed array.
+func (p *iexporter) encodeFile(w *intWriter, file *token.File, needed []uint64) {
+	_ = needed[0] // precondition: needed is non-empty
+
+	w.uint64(p.stringOff(file.Name()))
+
+	size := uint64(file.Size())
+	w.uint64(size)
+
+	// Sort the set of needed offsets. Duplicates are harmless.
+	sort.Slice(needed, func(i, j int) bool { return needed[i] < needed[j] })
+
+	lines := tokeninternal.GetLines(file) // byte offset of each line start
+	w.uint64(uint64(len(lines)))
+
+	// Rather than record the entire array of line start offsets,
+	// we save only a sparse list of (index, offset) pairs for
+	// the start of each line that contains a needed position.
+	var sparse [][2]int // (index, offset) pairs
+outer:
+	for i, lineStart := range lines {
+		lineEnd := size
+		if i < len(lines)-1 {
+			lineEnd = uint64(lines[i+1])
+		}
+		// Does this line contains a needed offset?
+		if needed[0] < lineEnd {
+			sparse = append(sparse, [2]int{i, lineStart})
+			for needed[0] < lineEnd {
+				needed = needed[1:]
+				if len(needed) == 0 {
+					break outer
+				}
+			}
+		}
+	}
+
+	// Delta-encode the columns.
+	w.uint64(uint64(len(sparse)))
+	var prev [2]int
+	for _, pair := range sparse {
+		w.uint64(uint64(pair[0] - prev[0]))
+		w.uint64(uint64(pair[1] - prev[1]))
+		prev = pair
+	}
+}
+
 // writeIndex writes out an object index. mainIndex indicates whether
 // we're writing out the main index, which is also read by
 // non-compiler tools and includes a complete package description
@@ -205,7 +313,8 @@ type iexporter struct {
 	out     *bytes.Buffer
 	version int
 
-	localpkg *types.Package
+	shallow  bool           // don't put types from other packages in the index
+	localpkg *types.Package // (nil in bundle mode)
 
 	// allPkgs tracks all packages that have been referenced by
 	// the export data, so we can ensure to include them in the
@@ -217,6 +326,12 @@ type iexporter struct {
 	strings     intWriter
 	stringIndex map[string]uint64
 
+	// In shallow mode, object positions are encoded as (file, offset).
+	// Each file is recorded as a line-number table.
+	// Only the lines of needed positions are saved faithfully.
+	fileInfo  map[*token.File]uint64 // value is index in fileInfos
+	fileInfos []*filePositions
+
 	data0       intWriter
 	declIndex   map[types.Object]uint64
 	tparamNames map[types.Object]string // typeparam->exported name
@@ -225,6 +340,11 @@ type iexporter struct {
 	indent int // for tracing support
 }
 
+type filePositions struct {
+	file   *token.File
+	needed []uint64 // unordered list of needed file offsets
+}
+
 func (p *iexporter) trace(format string, args ...interface{}) {
 	if !trace {
 		// Call sites should also be guarded, but having this check here allows
@@ -248,6 +368,25 @@ func (p *iexporter) stringOff(s string) uint64 {
 	return off
 }
 
+// fileIndexAndOffset returns the index of the token.File and the byte offset of pos within it.
+func (p *iexporter) fileIndexAndOffset(file *token.File, pos token.Pos) (uint64, uint64) {
+	index, ok := p.fileInfo[file]
+	if !ok {
+		index = uint64(len(p.fileInfo))
+		p.fileInfos = append(p.fileInfos, &filePositions{file: file})
+		if p.fileInfo == nil {
+			p.fileInfo = make(map[*token.File]uint64)
+		}
+		p.fileInfo[file] = index
+	}
+	// Record each needed offset.
+	info := p.fileInfos[index]
+	offset := uint64(file.Offset(pos))
+	info.needed = append(info.needed, offset)
+
+	return index, offset
+}
+
 // pushDecl adds n to the declaration work queue, if not already present.
 func (p *iexporter) pushDecl(obj types.Object) {
 	// Package unsafe is known to the compiler and predeclared.
@@ -256,6 +395,11 @@ func (p *iexporter) pushDecl(obj types.Object) {
 		panic("cannot export package unsafe")
 	}
 
+	// Shallow export data: don't index decls from other packages.
+	if p.shallow && obj.Pkg() != p.localpkg {
+		return
+	}
+
 	if _, ok := p.declIndex[obj]; ok {
 		return
 	}
@@ -303,7 +447,13 @@ func (p *iexporter) doDecl(obj types.Object) {
 	case *types.Func:
 		sig, _ := obj.Type().(*types.Signature)
 		if sig.Recv() != nil {
-			panic(internalErrorf("unexpected method: %v", sig))
+			// We shouldn't see methods in the package scope,
+			// but the type checker may repair "func () F() {}"
+			// to "func (Invalid) F()" and then treat it like "func F()",
+			// so allow that. See golang/go#57729.
+			if sig.Recv().Type() != types.Typ[types.Invalid] {
+				panic(internalErrorf("unexpected method: %v", sig))
+			}
 		}
 
 		// Function.
@@ -415,13 +565,30 @@ func (w *exportWriter) tag(tag byte) {
 }
 
 func (w *exportWriter) pos(pos token.Pos) {
-	if w.p.version >= iexportVersionPosCol {
+	if w.p.shallow {
+		w.posV2(pos)
+	} else if w.p.version >= iexportVersionPosCol {
 		w.posV1(pos)
 	} else {
 		w.posV0(pos)
 	}
 }
 
+// posV2 encoding (used only in shallow mode) records positions as
+// (file, offset), where file is the index in the token.File table
+// (which records the file name and newline offsets) and offset is a
+// byte offset. It effectively ignores //line directives.
+func (w *exportWriter) posV2(pos token.Pos) {
+	if pos == token.NoPos {
+		w.uint64(0)
+		return
+	}
+	file := w.p.fset.File(pos) // fset must be non-nil
+	index, offset := w.p.fileIndexAndOffset(file, pos)
+	w.uint64(1 + index)
+	w.uint64(offset)
+}
+
 func (w *exportWriter) posV1(pos token.Pos) {
 	if w.p.fset == nil {
 		w.int64(0)
@@ -497,7 +664,7 @@ func (w *exportWriter) pkg(pkg *types.Package) {
 	w.string(w.exportPath(pkg))
 }
 
-func (w *exportWriter) qualifiedIdent(obj types.Object) {
+func (w *exportWriter) qualifiedType(obj *types.TypeName) {
 	name := w.p.exportName(obj)
 
 	// Ensure any referenced declarations are written out too.
@@ -556,11 +723,11 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) {
 			return
 		}
 		w.startType(definedType)
-		w.qualifiedIdent(t.Obj())
+		w.qualifiedType(t.Obj())
 
 	case *typeparams.TypeParam:
 		w.startType(typeParamType)
-		w.qualifiedIdent(t.Obj())
+		w.qualifiedType(t.Obj())
 
 	case *types.Pointer:
 		w.startType(pointerType)
@@ -602,14 +769,17 @@ func (w *exportWriter) doTyp(t types.Type, pkg *types.Package) {
 
 	case *types.Struct:
 		w.startType(structType)
-		w.setPkg(pkg, true)
-
 		n := t.NumFields()
+		if n > 0 {
+			w.setPkg(t.Field(0).Pkg(), true) // qualifying package for field objects
+		} else {
+			w.setPkg(pkg, true)
+		}
 		w.uint64(uint64(n))
 		for i := 0; i < n; i++ {
 			f := t.Field(i)
 			w.pos(f.Pos())
-			w.string(f.Name())
+			w.string(f.Name()) // unexported fields implicitly qualified by prior setPkg
 			w.typ(f.Type(), pkg)
 			w.bool(f.Anonymous())
 			w.string(t.Tag(i)) // note (or tag)
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go
similarity index 86%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/iimport.go
rename to vendor/golang.org/x/tools/internal/gcimporter/iimport.go
index 4caa0f55d9d..448f903e86a 100644
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/iimport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go
@@ -51,6 +51,8 @@ const (
 	iexportVersionPosCol   = 1
 	iexportVersionGo1_18   = 2
 	iexportVersionGenerics = 2
+
+	iexportVersionCurrent = 2
 )
 
 type ident struct {
@@ -83,7 +85,7 @@ const (
 // If the export data version is not recognized or the format is otherwise
 // compromised, an error is returned.
 func IImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (int, *types.Package, error) {
-	pkgs, err := iimportCommon(fset, imports, data, false, path)
+	pkgs, err := iimportCommon(fset, imports, data, false, path, nil)
 	if err != nil {
 		return 0, nil, err
 	}
@@ -92,11 +94,11 @@ func IImportData(fset *token.FileSet, imports map[string]*types.Package, data []
 
 // IImportBundle imports a set of packages from the serialized package bundle.
 func IImportBundle(fset *token.FileSet, imports map[string]*types.Package, data []byte) ([]*types.Package, error) {
-	return iimportCommon(fset, imports, data, true, "")
+	return iimportCommon(fset, imports, data, true, "", nil)
 }
 
-func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data []byte, bundle bool, path string) (pkgs []*types.Package, err error) {
-	const currentVersion = 1
+func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data []byte, bundle bool, path string, insert InsertType) (pkgs []*types.Package, err error) {
+	const currentVersion = iexportVersionCurrent
 	version := int64(-1)
 	if !debug {
 		defer func() {
@@ -135,19 +137,34 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data
 	}
 
 	sLen := int64(r.uint64())
+	var fLen int64
+	var fileOffset []uint64
+	if insert != nil {
+		// Shallow mode uses a different position encoding.
+		fLen = int64(r.uint64())
+		fileOffset = make([]uint64, r.uint64())
+		for i := range fileOffset {
+			fileOffset[i] = r.uint64()
+		}
+	}
 	dLen := int64(r.uint64())
 
 	whence, _ := r.Seek(0, io.SeekCurrent)
 	stringData := data[whence : whence+sLen]
-	declData := data[whence+sLen : whence+sLen+dLen]
-	r.Seek(sLen+dLen, io.SeekCurrent)
+	fileData := data[whence+sLen : whence+sLen+fLen]
+	declData := data[whence+sLen+fLen : whence+sLen+fLen+dLen]
+	r.Seek(sLen+fLen+dLen, io.SeekCurrent)
 
 	p := iimporter{
 		version: int(version),
 		ipath:   path,
+		insert:  insert,
 
 		stringData:  stringData,
 		stringCache: make(map[uint64]string),
+		fileOffset:  fileOffset,
+		fileData:    fileData,
+		fileCache:   make([]*token.File, len(fileOffset)),
 		pkgCache:    make(map[uint64]*types.Package),
 
 		declData: declData,
@@ -185,11 +202,18 @@ func iimportCommon(fset *token.FileSet, imports map[string]*types.Package, data
 		} else if pkg.Name() != pkgName {
 			errorf("conflicting names %s and %s for package %q", pkg.Name(), pkgName, path)
 		}
+		if i == 0 && !bundle {
+			p.localpkg = pkg
+		}
 
 		p.pkgCache[pkgPathOff] = pkg
 
+		// Read index for package.
 		nameIndex := make(map[string]uint64)
-		for nSyms := r.uint64(); nSyms > 0; nSyms-- {
+		nSyms := r.uint64()
+		// In shallow mode we don't expect an index for other packages.
+		assert(nSyms == 0 || p.localpkg == pkg || p.insert == nil)
+		for ; nSyms > 0; nSyms-- {
 			name := p.stringAt(r.uint64())
 			nameIndex[name] = r.uint64()
 		}
@@ -265,8 +289,14 @@ type iimporter struct {
 	version int
 	ipath   string
 
+	localpkg *types.Package
+	insert   func(pkg *types.Package, name string) // "shallow" mode only
+
 	stringData  []byte
 	stringCache map[uint64]string
+	fileOffset  []uint64 // fileOffset[i] is offset in fileData for info about file encoded as i
+	fileData    []byte
+	fileCache   []*token.File // memoized decoding of file encoded as i
 	pkgCache    map[uint64]*types.Package
 
 	declData    []byte
@@ -308,6 +338,13 @@ func (p *iimporter) doDecl(pkg *types.Package, name string) {
 
 	off, ok := p.pkgIndex[pkg][name]
 	if !ok {
+		// In "shallow" mode, call back to the application to
+		// find the object and insert it into the package scope.
+		if p.insert != nil {
+			assert(pkg != p.localpkg)
+			p.insert(pkg, name) // "can't fail"
+			return
+		}
 		errorf("%v.%v not in index", pkg, name)
 	}
 
@@ -332,6 +369,55 @@ func (p *iimporter) stringAt(off uint64) string {
 	return s
 }
 
+func (p *iimporter) fileAt(index uint64) *token.File {
+	file := p.fileCache[index]
+	if file == nil {
+		off := p.fileOffset[index]
+		file = p.decodeFile(intReader{bytes.NewReader(p.fileData[off:]), p.ipath})
+		p.fileCache[index] = file
+	}
+	return file
+}
+
+func (p *iimporter) decodeFile(rd intReader) *token.File {
+	filename := p.stringAt(rd.uint64())
+	size := int(rd.uint64())
+	file := p.fake.fset.AddFile(filename, -1, size)
+
+	// SetLines requires a nondecreasing sequence.
+	// Because it is common for clients to derive the interval
+	// [start, start+len(name)] from a start position, and we
+	// want to ensure that the end offset is on the same line,
+	// we fill in the gaps of the sparse encoding with values
+	// that strictly increase by the largest possible amount.
+	// This allows us to avoid having to record the actual end
+	// offset of each needed line.
+
+	lines := make([]int, int(rd.uint64()))
+	var index, offset int
+	for i, n := 0, int(rd.uint64()); i < n; i++ {
+		index += int(rd.uint64())
+		offset += int(rd.uint64())
+		lines[index] = offset
+
+		// Ensure monotonicity between points.
+		for j := index - 1; j > 0 && lines[j] == 0; j-- {
+			lines[j] = lines[j+1] - 1
+		}
+	}
+
+	// Ensure monotonicity after last point.
+	for j := len(lines) - 1; j > 0 && lines[j] == 0; j-- {
+		size--
+		lines[j] = size
+	}
+
+	if !file.SetLines(lines) {
+		errorf("SetLines failed: %d", lines) // can't happen
+	}
+	return file
+}
+
 func (p *iimporter) pkgAt(off uint64) *types.Package {
 	if pkg, ok := p.pkgCache[off]; ok {
 		return pkg
@@ -625,6 +711,9 @@ func (r *importReader) qualifiedIdent() (*types.Package, string) {
 }
 
 func (r *importReader) pos() token.Pos {
+	if r.p.insert != nil { // shallow mode
+		return r.posv2()
+	}
 	if r.p.version >= iexportVersionPosCol {
 		r.posv1()
 	} else {
@@ -661,6 +750,15 @@ func (r *importReader) posv1() {
 	}
 }
 
+func (r *importReader) posv2() token.Pos {
+	file := r.uint64()
+	if file == 0 {
+		return token.NoPos
+	}
+	tf := r.p.fileAt(file - 1)
+	return tf.Pos(int(r.uint64()))
+}
+
 func (r *importReader) typ() types.Type {
 	return r.p.typAt(r.uint64(), nil)
 }
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/newInterface10.go b/vendor/golang.org/x/tools/internal/gcimporter/newInterface10.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/newInterface10.go
rename to vendor/golang.org/x/tools/internal/gcimporter/newInterface10.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/newInterface11.go b/vendor/golang.org/x/tools/internal/gcimporter/newInterface11.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/newInterface11.go
rename to vendor/golang.org/x/tools/internal/gcimporter/newInterface11.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/support_go117.go b/vendor/golang.org/x/tools/internal/gcimporter/support_go117.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/support_go117.go
rename to vendor/golang.org/x/tools/internal/gcimporter/support_go117.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/support_go118.go b/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go
similarity index 62%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/support_go118.go
rename to vendor/golang.org/x/tools/internal/gcimporter/support_go118.go
index a993843230c..edbe6ea7041 100644
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/support_go118.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/support_go118.go
@@ -21,3 +21,17 @@ func additionalPredeclared() []types.Type {
 		types.Universe.Lookup("any").Type(),
 	}
 }
+
+// See cmd/compile/internal/types.SplitVargenSuffix.
+func splitVargenSuffix(name string) (base, suffix string) {
+	i := len(name)
+	for i > 0 && name[i-1] >= '0' && name[i-1] <= '9' {
+		i--
+	}
+	const dot = "·"
+	if i >= len(dot) && name[i-len(dot):i] == dot {
+		i -= len(dot)
+		return name[:i], name[i:]
+	}
+	return name, ""
+}
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/unified_no.go b/vendor/golang.org/x/tools/internal/gcimporter/unified_no.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/unified_no.go
rename to vendor/golang.org/x/tools/internal/gcimporter/unified_no.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/unified_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/unified_yes.go
rename to vendor/golang.org/x/tools/internal/gcimporter/unified_yes.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/ureader_no.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/ureader_no.go
rename to vendor/golang.org/x/tools/internal/gcimporter/ureader_no.go
diff --git a/vendor/golang.org/x/tools/go/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
similarity index 70%
rename from vendor/golang.org/x/tools/go/internal/gcimporter/ureader_yes.go
rename to vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
index 3c1a4375435..b285a11ce25 100644
--- a/vendor/golang.org/x/tools/go/internal/gcimporter/ureader_yes.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
@@ -14,7 +14,7 @@ import (
 	"go/types"
 	"strings"
 
-	"golang.org/x/tools/go/internal/pkgbits"
+	"golang.org/x/tools/internal/pkgbits"
 )
 
 // A pkgReader holds the shared state for reading a unified IR package
@@ -36,6 +36,12 @@ type pkgReader struct {
 	// laterFns holds functions that need to be invoked at the end of
 	// import reading.
 	laterFns []func()
+	// laterFors is used in case of 'type A B' to ensure that B is processed before A.
+	laterFors map[types.Type]int
+
+	// ifaces holds a list of constructed Interfaces, which need to have
+	// Complete called after importing is done.
+	ifaces []*types.Interface
 }
 
 // later adds a function to be invoked at the end of import reading.
@@ -63,6 +69,15 @@ func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []
 	return
 }
 
+// laterFor adds a function to be invoked at the end of import reading, and records the type that function is finishing.
+func (pr *pkgReader) laterFor(t types.Type, fn func()) {
+	if pr.laterFors == nil {
+		pr.laterFors = make(map[types.Type]int)
+	}
+	pr.laterFors[t] = len(pr.laterFns)
+	pr.laterFns = append(pr.laterFns, fn)
+}
+
 // readUnifiedPackage reads a package description from the given
 // unified IR export data decoder.
 func readUnifiedPackage(fset *token.FileSet, ctxt *types.Context, imports map[string]*types.Package, input pkgbits.PkgDecoder) *types.Package {
@@ -102,6 +117,10 @@ func readUnifiedPackage(fset *token.FileSet, ctxt *types.Context, imports map[st
 		fn()
 	}
 
+	for _, iface := range pr.ifaces {
+		iface.Complete()
+	}
+
 	pkg.MarkComplete()
 	return pkg
 }
@@ -139,6 +158,17 @@ func (pr *pkgReader) newReader(k pkgbits.RelocKind, idx pkgbits.Index, marker pk
 	}
 }
 
+func (pr *pkgReader) tempReader(k pkgbits.RelocKind, idx pkgbits.Index, marker pkgbits.SyncMarker) *reader {
+	return &reader{
+		Decoder: pr.TempDecoder(k, idx, marker),
+		p:       pr,
+	}
+}
+
+func (pr *pkgReader) retireReader(r *reader) {
+	pr.RetireDecoder(&r.Decoder)
+}
+
 // @@@ Positions
 
 func (r *reader) pos() token.Pos {
@@ -163,26 +193,29 @@ func (pr *pkgReader) posBaseIdx(idx pkgbits.Index) string {
 		return b
 	}
 
-	r := pr.newReader(pkgbits.RelocPosBase, idx, pkgbits.SyncPosBase)
+	var filename string
+	{
+		r := pr.tempReader(pkgbits.RelocPosBase, idx, pkgbits.SyncPosBase)
 
-	// Within types2, position bases have a lot more details (e.g.,
-	// keeping track of where //line directives appeared exactly).
-	//
-	// For go/types, we just track the file name.
+		// Within types2, position bases have a lot more details (e.g.,
+		// keeping track of where //line directives appeared exactly).
+		//
+		// For go/types, we just track the file name.
 
-	filename := r.String()
+		filename = r.String()
 
-	if r.Bool() { // file base
-		// Was: "b = token.NewTrimmedFileBase(filename, true)"
-	} else { // line base
-		pos := r.pos()
-		line := r.Uint()
-		col := r.Uint()
+		if r.Bool() { // file base
+			// Was: "b = token.NewTrimmedFileBase(filename, true)"
+		} else { // line base
+			pos := r.pos()
+			line := r.Uint()
+			col := r.Uint()
 
-		// Was: "b = token.NewLineBase(pos, filename, true, line, col)"
-		_, _, _ = pos, line, col
+			// Was: "b = token.NewLineBase(pos, filename, true, line, col)"
+			_, _, _ = pos, line, col
+		}
+		pr.retireReader(r)
 	}
-
 	b := filename
 	pr.posBases[idx] = b
 	return b
@@ -231,11 +264,35 @@ func (r *reader) doPkg() *types.Package {
 	for i := range imports {
 		imports[i] = r.pkg()
 	}
-	pkg.SetImports(imports)
+	pkg.SetImports(flattenImports(imports))
 
 	return pkg
 }
 
+// flattenImports returns the transitive closure of all imported
+// packages rooted from pkgs.
+func flattenImports(pkgs []*types.Package) []*types.Package {
+	var res []*types.Package
+	seen := make(map[*types.Package]struct{})
+	for _, pkg := range pkgs {
+		if _, ok := seen[pkg]; ok {
+			continue
+		}
+		seen[pkg] = struct{}{}
+		res = append(res, pkg)
+
+		// pkg.Imports() is already flattened.
+		for _, pkg := range pkg.Imports() {
+			if _, ok := seen[pkg]; ok {
+				continue
+			}
+			seen[pkg] = struct{}{}
+			res = append(res, pkg)
+		}
+	}
+	return res
+}
+
 // @@@ Types
 
 func (r *reader) typ() types.Type {
@@ -264,12 +321,15 @@ func (pr *pkgReader) typIdx(info typeInfo, dict *readerDict) types.Type {
 		return typ
 	}
 
-	r := pr.newReader(pkgbits.RelocType, idx, pkgbits.SyncTypeIdx)
-	r.dict = dict
-
-	typ := r.doTyp()
-	assert(typ != nil)
+	var typ types.Type
+	{
+		r := pr.tempReader(pkgbits.RelocType, idx, pkgbits.SyncTypeIdx)
+		r.dict = dict
 
+		typ = r.doTyp()
+		assert(typ != nil)
+		pr.retireReader(r)
+	}
 	// See comment in pkgReader.typIdx explaining how this happens.
 	if prev := *where; prev != nil {
 		return prev
@@ -372,6 +432,16 @@ func (r *reader) interfaceType() *types.Interface {
 	if implicit {
 		iface.MarkImplicit()
 	}
+
+	// We need to call iface.Complete(), but if there are any embedded
+	// defined types, then we may not have set their underlying
+	// interface type yet. So we need to defer calling Complete until
+	// after we've called SetUnderlying everywhere.
+	//
+	// TODO(mdempsky): After CL 424876 lands, it should be safe to call
+	// iface.Complete() immediately.
+	r.p.ifaces = append(r.p.ifaces, iface)
+
 	return iface
 }
 
@@ -425,18 +495,30 @@ func (r *reader) obj() (types.Object, []types.Type) {
 }
 
 func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types.Package, string) {
-	rname := pr.newReader(pkgbits.RelocName, idx, pkgbits.SyncObject1)
 
-	objPkg, objName := rname.qualifiedIdent()
-	assert(objName != "")
+	var objPkg *types.Package
+	var objName string
+	var tag pkgbits.CodeObj
+	{
+		rname := pr.tempReader(pkgbits.RelocName, idx, pkgbits.SyncObject1)
 
-	tag := pkgbits.CodeObj(rname.Code(pkgbits.SyncCodeObj))
+		objPkg, objName = rname.qualifiedIdent()
+		assert(objName != "")
+
+		tag = pkgbits.CodeObj(rname.Code(pkgbits.SyncCodeObj))
+		pr.retireReader(rname)
+	}
 
 	if tag == pkgbits.ObjStub {
 		assert(objPkg == nil || objPkg == types.Unsafe)
 		return objPkg, objName
 	}
 
+	// Ignore local types promoted to global scope (#55110).
+	if _, suffix := splitVargenSuffix(objName); suffix != "" {
+		return objPkg, objName
+	}
+
 	if objPkg.Scope().Lookup(objName) == nil {
 		dict := pr.objDictIdx(idx)
 
@@ -477,15 +559,56 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types.Package, string) {
 
 			named.SetTypeParams(r.typeParamNames())
 
-			// TODO(mdempsky): Rewrite receiver types to underlying is an
-			// Interface? The go/types importer does this (I think because
-			// unit tests expected that), but cmd/compile doesn't care
-			// about it, so maybe we can avoid worrying about that here.
-			rhs := r.typ()
-			r.p.later(func() {
-				underlying := rhs.Underlying()
+			setUnderlying := func(underlying types.Type) {
+				// If the underlying type is an interface, we need to
+				// duplicate its methods so we can replace the receiver
+				// parameter's type (#49906).
+				if iface, ok := underlying.(*types.Interface); ok && iface.NumExplicitMethods() != 0 {
+					methods := make([]*types.Func, iface.NumExplicitMethods())
+					for i := range methods {
+						fn := iface.ExplicitMethod(i)
+						sig := fn.Type().(*types.Signature)
+
+						recv := types.NewVar(fn.Pos(), fn.Pkg(), "", named)
+						methods[i] = types.NewFunc(fn.Pos(), fn.Pkg(), fn.Name(), types.NewSignature(recv, sig.Params(), sig.Results(), sig.Variadic()))
+					}
+
+					embeds := make([]types.Type, iface.NumEmbeddeds())
+					for i := range embeds {
+						embeds[i] = iface.EmbeddedType(i)
+					}
+
+					newIface := types.NewInterfaceType(methods, embeds)
+					r.p.ifaces = append(r.p.ifaces, newIface)
+					underlying = newIface
+				}
+
 				named.SetUnderlying(underlying)
-			})
+			}
+
+			// Since go.dev/cl/455279, we can assume rhs.Underlying() will
+			// always be non-nil. However, to temporarily support users of
+			// older snapshot releases, we continue to fallback to the old
+			// behavior for now.
+			//
+			// TODO(mdempsky): Remove fallback code and simplify after
+			// allowing time for snapshot users to upgrade.
+			rhs := r.typ()
+			if underlying := rhs.Underlying(); underlying != nil {
+				setUnderlying(underlying)
+			} else {
+				pk := r.p
+				pk.laterFor(named, func() {
+					// First be sure that the rhs is initialized, if it needs to be initialized.
+					delete(pk.laterFors, named) // prevent cycles
+					if i, ok := pk.laterFors[rhs]; ok {
+						f := pk.laterFns[i]
+						pk.laterFns[i] = func() {} // function is running now, so replace it with a no-op
+						f()                        // initialize RHS
+					}
+					setUnderlying(rhs.Underlying())
+				})
+			}
 
 			for i, n := 0, r.Len(); i < n; i++ {
 				named.AddMethod(r.method())
@@ -502,25 +625,28 @@ func (pr *pkgReader) objIdx(idx pkgbits.Index) (*types.Package, string) {
 }
 
 func (pr *pkgReader) objDictIdx(idx pkgbits.Index) *readerDict {
-	r := pr.newReader(pkgbits.RelocObjDict, idx, pkgbits.SyncObject1)
 
 	var dict readerDict
 
-	if implicits := r.Len(); implicits != 0 {
-		errorf("unexpected object with %v implicit type parameter(s)", implicits)
-	}
+	{
+		r := pr.tempReader(pkgbits.RelocObjDict, idx, pkgbits.SyncObject1)
+		if implicits := r.Len(); implicits != 0 {
+			errorf("unexpected object with %v implicit type parameter(s)", implicits)
+		}
 
-	dict.bounds = make([]typeInfo, r.Len())
-	for i := range dict.bounds {
-		dict.bounds[i] = r.typInfo()
-	}
+		dict.bounds = make([]typeInfo, r.Len())
+		for i := range dict.bounds {
+			dict.bounds[i] = r.typInfo()
+		}
 
-	dict.derived = make([]derivedInfo, r.Len())
-	dict.derivedTypes = make([]types.Type, len(dict.derived))
-	for i := range dict.derived {
-		dict.derived[i] = derivedInfo{r.Reloc(pkgbits.RelocType), r.Bool()}
-	}
+		dict.derived = make([]derivedInfo, r.Len())
+		dict.derivedTypes = make([]types.Type, len(dict.derived))
+		for i := range dict.derived {
+			dict.derived[i] = derivedInfo{r.Reloc(pkgbits.RelocType), r.Bool()}
+		}
 
+		pr.retireReader(r)
+	}
 	// function references follow, but reader doesn't need those
 
 	return &dict
diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
index 67256dc3974..d50551693f3 100644
--- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go
+++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
@@ -10,8 +10,10 @@ import (
 	"context"
 	"fmt"
 	"io"
+	"log"
 	"os"
 	"regexp"
+	"runtime"
 	"strconv"
 	"strings"
 	"sync"
@@ -232,6 +234,12 @@ func (i *Invocation) run(ctx context.Context, stdout, stderr io.Writer) error {
 	return runCmdContext(ctx, cmd)
 }
 
+// DebugHangingGoCommands may be set by tests to enable additional
+// instrumentation (including panics) for debugging hanging Go commands.
+//
+// See golang/go#54461 for details.
+var DebugHangingGoCommands = false
+
 // runCmdContext is like exec.CommandContext except it sends os.Interrupt
 // before os.Kill.
 func runCmdContext(ctx context.Context, cmd *exec.Cmd) error {
@@ -243,11 +251,24 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error {
 		resChan <- cmd.Wait()
 	}()
 
-	select {
-	case err := <-resChan:
-		return err
-	case <-ctx.Done():
+	// If we're interested in debugging hanging Go commands, stop waiting after a
+	// minute and panic with interesting information.
+	if DebugHangingGoCommands {
+		select {
+		case err := <-resChan:
+			return err
+		case <-time.After(1 * time.Minute):
+			HandleHangingGoCommand(cmd.Process)
+		case <-ctx.Done():
+		}
+	} else {
+		select {
+		case err := <-resChan:
+			return err
+		case <-ctx.Done():
+		}
 	}
+
 	// Cancelled. Interrupt and see if it ends voluntarily.
 	cmd.Process.Signal(os.Interrupt)
 	select {
@@ -255,11 +276,63 @@ func runCmdContext(ctx context.Context, cmd *exec.Cmd) error {
 		return err
 	case <-time.After(time.Second):
 	}
+
 	// Didn't shut down in response to interrupt. Kill it hard.
-	cmd.Process.Kill()
+	// TODO(rfindley): per advice from bcmills@, it may be better to send SIGQUIT
+	// on certain platforms, such as unix.
+	if err := cmd.Process.Kill(); err != nil && DebugHangingGoCommands {
+		// Don't panic here as this reliably fails on windows with EINVAL.
+		log.Printf("error killing the Go command: %v", err)
+	}
+
+	// See above: don't wait indefinitely if we're debugging hanging Go commands.
+	if DebugHangingGoCommands {
+		select {
+		case err := <-resChan:
+			return err
+		case <-time.After(10 * time.Second): // a shorter wait as resChan should return quickly following Kill
+			HandleHangingGoCommand(cmd.Process)
+		}
+	}
 	return <-resChan
 }
 
+func HandleHangingGoCommand(proc *os.Process) {
+	switch runtime.GOOS {
+	case "linux", "darwin", "freebsd", "netbsd":
+		fmt.Fprintln(os.Stderr, `DETECTED A HANGING GO COMMAND
+
+The gopls test runner has detected a hanging go command. In order to debug
+this, the output of ps and lsof/fstat is printed below.
+
+See golang/go#54461 for more details.`)
+
+		fmt.Fprintln(os.Stderr, "\nps axo ppid,pid,command:")
+		fmt.Fprintln(os.Stderr, "-------------------------")
+		psCmd := exec.Command("ps", "axo", "ppid,pid,command")
+		psCmd.Stdout = os.Stderr
+		psCmd.Stderr = os.Stderr
+		if err := psCmd.Run(); err != nil {
+			panic(fmt.Sprintf("running ps: %v", err))
+		}
+
+		listFiles := "lsof"
+		if runtime.GOOS == "freebsd" || runtime.GOOS == "netbsd" {
+			listFiles = "fstat"
+		}
+
+		fmt.Fprintln(os.Stderr, "\n"+listFiles+":")
+		fmt.Fprintln(os.Stderr, "-----")
+		listFilesCmd := exec.Command(listFiles)
+		listFilesCmd.Stdout = os.Stderr
+		listFilesCmd.Stderr = os.Stderr
+		if err := listFilesCmd.Run(); err != nil {
+			panic(fmt.Sprintf("running %s: %v", listFiles, err))
+		}
+	}
+	panic(fmt.Sprintf("detected hanging go command (pid %d): see golang/go#54461 for more details", proc.Pid))
+}
+
 func cmdDebugStr(cmd *exec.Cmd) string {
 	env := make(map[string]string)
 	for _, kv := range cmd.Env {
diff --git a/vendor/golang.org/x/tools/internal/gocommand/version.go b/vendor/golang.org/x/tools/internal/gocommand/version.go
index 71304368020..307a76d474a 100644
--- a/vendor/golang.org/x/tools/internal/gocommand/version.go
+++ b/vendor/golang.org/x/tools/internal/gocommand/version.go
@@ -7,11 +7,19 @@ package gocommand
 import (
 	"context"
 	"fmt"
+	"regexp"
 	"strings"
 )
 
-// GoVersion checks the go version by running "go list" with modules off.
-// It returns the X in Go 1.X.
+// GoVersion reports the minor version number of the highest release
+// tag built into the go command on the PATH.
+//
+// Note that this may be higher than the version of the go tool used
+// to build this application, and thus the versions of the standard
+// go/{scanner,parser,ast,types} packages that are linked into it.
+// In that case, callers should either downgrade to the version of
+// go used to build the application, or report an error that the
+// application is too old to use the go command on the PATH.
 func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) {
 	inv.Verb = "list"
 	inv.Args = []string{"-e", "-f", `{{context.ReleaseTags}}`, `--`, `unsafe`}
@@ -38,7 +46,7 @@ func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) {
 	if len(stdout) < 3 {
 		return 0, fmt.Errorf("bad ReleaseTags output: %q", stdout)
 	}
-	// Split up "[go1.1 go1.15]"
+	// Split up "[go1.1 go1.15]" and return highest go1.X value.
 	tags := strings.Fields(stdout[1 : len(stdout)-2])
 	for i := len(tags) - 1; i >= 0; i-- {
 		var version int
@@ -49,3 +57,25 @@ func GoVersion(ctx context.Context, inv Invocation, r *Runner) (int, error) {
 	}
 	return 0, fmt.Errorf("no parseable ReleaseTags in %v", tags)
 }
+
+// GoVersionOutput returns the complete output of the go version command.
+func GoVersionOutput(ctx context.Context, inv Invocation, r *Runner) (string, error) {
+	inv.Verb = "version"
+	goVersion, err := r.Run(ctx, inv)
+	if err != nil {
+		return "", err
+	}
+	return goVersion.String(), nil
+}
+
+// ParseGoVersionOutput extracts the Go version string
+// from the output of the "go version" command.
+// Given an unrecognized form, it returns an empty string.
+func ParseGoVersionOutput(data string) string {
+	re := regexp.MustCompile(`^go version (go\S+|devel \S+)`)
+	m := re.FindStringSubmatch(data)
+	if len(m) != 2 {
+		return "" // unrecognized version
+	}
+	return m[1]
+}
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/codes.go b/vendor/golang.org/x/tools/internal/pkgbits/codes.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/codes.go
rename to vendor/golang.org/x/tools/internal/pkgbits/codes.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/decoder.go b/vendor/golang.org/x/tools/internal/pkgbits/decoder.go
similarity index 83%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/decoder.go
rename to vendor/golang.org/x/tools/internal/pkgbits/decoder.go
index 2bc793668ec..b92e8e6eb32 100644
--- a/vendor/golang.org/x/tools/go/internal/pkgbits/decoder.go
+++ b/vendor/golang.org/x/tools/internal/pkgbits/decoder.go
@@ -6,9 +6,11 @@ package pkgbits
 
 import (
 	"encoding/binary"
+	"errors"
 	"fmt"
 	"go/constant"
 	"go/token"
+	"io"
 	"math/big"
 	"os"
 	"runtime"
@@ -51,6 +53,8 @@ type PkgDecoder struct {
 	// For example, section K's end positions start at elemEndsEnds[K-1]
 	// (or 0, if K==0) and end at elemEndsEnds[K].
 	elemEndsEnds [numRelocs]uint32
+
+	scratchRelocEnt []RelocEnt
 }
 
 // PkgPath returns the package path for the package
@@ -94,7 +98,7 @@ func NewPkgDecoder(pkgPath, input string) PkgDecoder {
 	pr.elemEnds = make([]uint32, pr.elemEndsEnds[len(pr.elemEndsEnds)-1])
 	assert(binary.Read(r, binary.LittleEndian, pr.elemEnds[:]) == nil)
 
-	pos, err := r.Seek(0, os.SEEK_CUR)
+	pos, err := r.Seek(0, io.SeekCurrent)
 	assert(err == nil)
 
 	pr.elemData = input[pos:]
@@ -164,6 +168,21 @@ func (pr *PkgDecoder) NewDecoder(k RelocKind, idx Index, marker SyncMarker) Deco
 	return r
 }
 
+// TempDecoder returns a Decoder for the given (section, index) pair,
+// and decodes the given SyncMarker from the element bitstream.
+// If possible the Decoder should be RetireDecoder'd when it is no longer
+// needed, this will avoid heap allocations.
+func (pr *PkgDecoder) TempDecoder(k RelocKind, idx Index, marker SyncMarker) Decoder {
+	r := pr.TempDecoderRaw(k, idx)
+	r.Sync(marker)
+	return r
+}
+
+func (pr *PkgDecoder) RetireDecoder(d *Decoder) {
+	pr.scratchRelocEnt = d.Relocs
+	d.Relocs = nil
+}
+
 // NewDecoderRaw returns a Decoder for the given (section, index) pair.
 //
 // Most callers should use NewDecoder instead.
@@ -187,6 +206,30 @@ func (pr *PkgDecoder) NewDecoderRaw(k RelocKind, idx Index) Decoder {
 	return r
 }
 
+func (pr *PkgDecoder) TempDecoderRaw(k RelocKind, idx Index) Decoder {
+	r := Decoder{
+		common: pr,
+		k:      k,
+		Idx:    idx,
+	}
+
+	r.Data.Reset(pr.DataIdx(k, idx))
+	r.Sync(SyncRelocs)
+	l := r.Len()
+	if cap(pr.scratchRelocEnt) >= l {
+		r.Relocs = pr.scratchRelocEnt[:l]
+		pr.scratchRelocEnt = nil
+	} else {
+		r.Relocs = make([]RelocEnt, l)
+	}
+	for i := range r.Relocs {
+		r.Sync(SyncReloc)
+		r.Relocs[i] = RelocEnt{RelocKind(r.Len()), Index(r.Len())}
+	}
+
+	return r
+}
+
 // A Decoder provides methods for decoding an individual element's
 // bitstream data.
 type Decoder struct {
@@ -206,11 +249,39 @@ func (r *Decoder) checkErr(err error) {
 }
 
 func (r *Decoder) rawUvarint() uint64 {
-	x, err := binary.ReadUvarint(&r.Data)
+	x, err := readUvarint(&r.Data)
 	r.checkErr(err)
 	return x
 }
 
+// readUvarint is a type-specialized copy of encoding/binary.ReadUvarint.
+// This avoids the interface conversion and thus has better escape properties,
+// which flows up the stack.
+func readUvarint(r *strings.Reader) (uint64, error) {
+	var x uint64
+	var s uint
+	for i := 0; i < binary.MaxVarintLen64; i++ {
+		b, err := r.ReadByte()
+		if err != nil {
+			if i > 0 && err == io.EOF {
+				err = io.ErrUnexpectedEOF
+			}
+			return x, err
+		}
+		if b < 0x80 {
+			if i == binary.MaxVarintLen64-1 && b > 1 {
+				return x, overflow
+			}
+			return x | uint64(b)<<s, nil
+		}
+		x |= uint64(b&0x7f) << s
+		s += 7
+	}
+	return x, overflow
+}
+
+var overflow = errors.New("pkgbits: readUvarint overflows a 64-bit integer")
+
 func (r *Decoder) rawVarint() int64 {
 	ux := r.rawUvarint()
 
@@ -237,7 +308,7 @@ func (r *Decoder) Sync(mWant SyncMarker) {
 		return
 	}
 
-	pos, _ := r.Data.Seek(0, os.SEEK_CUR) // TODO(mdempsky): io.SeekCurrent after #44505 is resolved
+	pos, _ := r.Data.Seek(0, io.SeekCurrent)
 	mHave := SyncMarker(r.rawUvarint())
 	writerPCs := make([]int, r.rawUvarint())
 	for i := range writerPCs {
@@ -302,7 +373,7 @@ func (r *Decoder) Int64() int64 {
 	return r.rawVarint()
 }
 
-// Int64 decodes and returns a uint64 value from the element bitstream.
+// Uint64 decodes and returns a uint64 value from the element bitstream.
 func (r *Decoder) Uint64() uint64 {
 	r.Sync(SyncUint64)
 	return r.rawUvarint()
@@ -409,8 +480,12 @@ func (r *Decoder) bigFloat() *big.Float {
 // PeekPkgPath returns the package path for the specified package
 // index.
 func (pr *PkgDecoder) PeekPkgPath(idx Index) string {
-	r := pr.NewDecoder(RelocPkg, idx, SyncPkgDef)
-	path := r.String()
+	var path string
+	{
+		r := pr.TempDecoder(RelocPkg, idx, SyncPkgDef)
+		path = r.String()
+		pr.RetireDecoder(&r)
+	}
 	if path == "" {
 		path = pr.pkgPath
 	}
@@ -420,14 +495,23 @@ func (pr *PkgDecoder) PeekPkgPath(idx Index) string {
 // PeekObj returns the package path, object name, and CodeObj for the
 // specified object index.
 func (pr *PkgDecoder) PeekObj(idx Index) (string, string, CodeObj) {
-	r := pr.NewDecoder(RelocName, idx, SyncObject1)
-	r.Sync(SyncSym)
-	r.Sync(SyncPkg)
-	path := pr.PeekPkgPath(r.Reloc(RelocPkg))
-	name := r.String()
+	var ridx Index
+	var name string
+	var rcode int
+	{
+		r := pr.TempDecoder(RelocName, idx, SyncObject1)
+		r.Sync(SyncSym)
+		r.Sync(SyncPkg)
+		ridx = r.Reloc(RelocPkg)
+		name = r.String()
+		rcode = r.Code(SyncCodeObj)
+		pr.RetireDecoder(&r)
+	}
+
+	path := pr.PeekPkgPath(ridx)
 	assert(name != "")
 
-	tag := CodeObj(r.Code(SyncCodeObj))
+	tag := CodeObj(rcode)
 
 	return path, name, tag
 }
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/doc.go b/vendor/golang.org/x/tools/internal/pkgbits/doc.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/doc.go
rename to vendor/golang.org/x/tools/internal/pkgbits/doc.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/encoder.go b/vendor/golang.org/x/tools/internal/pkgbits/encoder.go
similarity index 95%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/encoder.go
rename to vendor/golang.org/x/tools/internal/pkgbits/encoder.go
index c50c838caae..6482617a4fc 100644
--- a/vendor/golang.org/x/tools/go/internal/pkgbits/encoder.go
+++ b/vendor/golang.org/x/tools/internal/pkgbits/encoder.go
@@ -147,8 +147,9 @@ func (pw *PkgEncoder) NewEncoderRaw(k RelocKind) Encoder {
 type Encoder struct {
 	p *PkgEncoder
 
-	Relocs []RelocEnt
-	Data   bytes.Buffer // accumulated element bitstream data
+	Relocs   []RelocEnt
+	RelocMap map[RelocEnt]uint32
+	Data     bytes.Buffer // accumulated element bitstream data
 
 	encodingRelocHeader bool
 
@@ -210,15 +211,18 @@ func (w *Encoder) rawVarint(x int64) {
 }
 
 func (w *Encoder) rawReloc(r RelocKind, idx Index) int {
-	// TODO(mdempsky): Use map for lookup; this takes quadratic time.
-	for i, rEnt := range w.Relocs {
-		if rEnt.Kind == r && rEnt.Idx == idx {
-			return i
+	e := RelocEnt{r, idx}
+	if w.RelocMap != nil {
+		if i, ok := w.RelocMap[e]; ok {
+			return int(i)
 		}
+	} else {
+		w.RelocMap = make(map[RelocEnt]uint32)
 	}
 
 	i := len(w.Relocs)
-	w.Relocs = append(w.Relocs, RelocEnt{r, idx})
+	w.RelocMap[e] = uint32(i)
+	w.Relocs = append(w.Relocs, e)
 	return i
 }
 
@@ -289,7 +293,7 @@ func (w *Encoder) Len(x int) { assert(x >= 0); w.Uint64(uint64(x)) }
 // Int encodes and writes an int value into the element bitstream.
 func (w *Encoder) Int(x int) { w.Int64(int64(x)) }
 
-// Len encodes and writes a uint value into the element bitstream.
+// Uint encodes and writes a uint value into the element bitstream.
 func (w *Encoder) Uint(x uint) { w.Uint64(uint64(x)) }
 
 // Reloc encodes and writes a relocation for the given (section,
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/flags.go b/vendor/golang.org/x/tools/internal/pkgbits/flags.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/flags.go
rename to vendor/golang.org/x/tools/internal/pkgbits/flags.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/frames_go1.go b/vendor/golang.org/x/tools/internal/pkgbits/frames_go1.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/frames_go1.go
rename to vendor/golang.org/x/tools/internal/pkgbits/frames_go1.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/frames_go17.go b/vendor/golang.org/x/tools/internal/pkgbits/frames_go17.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/frames_go17.go
rename to vendor/golang.org/x/tools/internal/pkgbits/frames_go17.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/reloc.go b/vendor/golang.org/x/tools/internal/pkgbits/reloc.go
similarity index 95%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/reloc.go
rename to vendor/golang.org/x/tools/internal/pkgbits/reloc.go
index 7a8f04ab3fc..fcdfb97ca99 100644
--- a/vendor/golang.org/x/tools/go/internal/pkgbits/reloc.go
+++ b/vendor/golang.org/x/tools/internal/pkgbits/reloc.go
@@ -5,11 +5,11 @@
 package pkgbits
 
 // A RelocKind indicates a particular section within a unified IR export.
-type RelocKind int
+type RelocKind int32
 
 // An Index represents a bitstream element index within a particular
 // section.
-type Index int
+type Index int32
 
 // A relocEnt (relocation entry) is an entry in an element's local
 // reference table.
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/support.go b/vendor/golang.org/x/tools/internal/pkgbits/support.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/support.go
rename to vendor/golang.org/x/tools/internal/pkgbits/support.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/sync.go b/vendor/golang.org/x/tools/internal/pkgbits/sync.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/sync.go
rename to vendor/golang.org/x/tools/internal/pkgbits/sync.go
diff --git a/vendor/golang.org/x/tools/go/internal/pkgbits/syncmarker_string.go b/vendor/golang.org/x/tools/internal/pkgbits/syncmarker_string.go
similarity index 100%
rename from vendor/golang.org/x/tools/go/internal/pkgbits/syncmarker_string.go
rename to vendor/golang.org/x/tools/internal/pkgbits/syncmarker_string.go
diff --git a/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go
new file mode 100644
index 00000000000..a3fb2d4f29d
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/tokeninternal/tokeninternal.go
@@ -0,0 +1,59 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// package tokeninternal provides access to some internal features of the token
+// package.
+package tokeninternal
+
+import (
+	"go/token"
+	"sync"
+	"unsafe"
+)
+
+// GetLines returns the table of line-start offsets from a token.File.
+func GetLines(file *token.File) []int {
+	// token.File has a Lines method on Go 1.21 and later.
+	if file, ok := (interface{})(file).(interface{ Lines() []int }); ok {
+		return file.Lines()
+	}
+
+	// This declaration must match that of token.File.
+	// This creates a risk of dependency skew.
+	// For now we check that the size of the two
+	// declarations is the same, on the (fragile) assumption
+	// that future changes would add fields.
+	type tokenFile119 struct {
+		_     string
+		_     int
+		_     int
+		mu    sync.Mutex // we're not complete monsters
+		lines []int
+		_     []struct{}
+	}
+	type tokenFile118 struct {
+		_ *token.FileSet // deleted in go1.19
+		tokenFile119
+	}
+
+	type uP = unsafe.Pointer
+	switch unsafe.Sizeof(*file) {
+	case unsafe.Sizeof(tokenFile118{}):
+		var ptr *tokenFile118
+		*(*uP)(uP(&ptr)) = uP(file)
+		ptr.mu.Lock()
+		defer ptr.mu.Unlock()
+		return ptr.lines
+
+	case unsafe.Sizeof(tokenFile119{}):
+		var ptr *tokenFile119
+		*(*uP)(uP(&ptr)) = uP(file)
+		ptr.mu.Lock()
+		defer ptr.mu.Unlock()
+		return ptr.lines
+
+	default:
+		panic("unexpected token.File size")
+	}
+}
diff --git a/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go b/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go
index d38ee3c27cd..07484073a57 100644
--- a/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go
+++ b/vendor/golang.org/x/tools/internal/typesinternal/errorcode.go
@@ -30,6 +30,12 @@ type ErrorCode int
 // convention that "bad" implies a problem with syntax, and "invalid" implies a
 // problem with types.
 
+const (
+	// InvalidSyntaxTree occurs if an invalid syntax tree is provided
+	// to the type checker. It should never happen.
+	InvalidSyntaxTree ErrorCode = -1
+)
+
 const (
 	_ ErrorCode = iota
 
@@ -153,12 +159,12 @@ const (
 
 	/* decls > var (+ other variable assignment codes) */
 
-	// UntypedNil occurs when the predeclared (untyped) value nil is used to
+	// UntypedNilUse occurs when the predeclared (untyped) value nil is used to
 	// initialize a variable declared without an explicit type.
 	//
 	// Example:
 	//  var x = nil
-	UntypedNil
+	UntypedNilUse
 
 	// WrongAssignCount occurs when the number of values on the right-hand side
 	// of an assignment or or initialization expression does not match the number
@@ -1523,4 +1529,32 @@ const (
 	// Example:
 	//  type T[P any] struct{ *P }
 	MisplacedTypeParam
+
+	// InvalidUnsafeSliceData occurs when unsafe.SliceData is called with
+	// an argument that is not of slice type. It also occurs if it is used
+	// in a package compiled for a language version before go1.20.
+	//
+	// Example:
+	//  import "unsafe"
+	//
+	//  var x int
+	//  var _ = unsafe.SliceData(x)
+	InvalidUnsafeSliceData
+
+	// InvalidUnsafeString occurs when unsafe.String is called with
+	// a length argument that is not of integer type, negative, or
+	// out of bounds. It also occurs if it is used in a package
+	// compiled for a language version before go1.20.
+	//
+	// Example:
+	//  import "unsafe"
+	//
+	//  var b [10]byte
+	//  var _ = unsafe.String(&b[0], -1)
+	InvalidUnsafeString
+
+	// InvalidUnsafeStringData occurs if it is used in a package
+	// compiled for a language version before go1.20.
+	_ // not used anymore
+
 )
diff --git a/vendor/golang.org/x/tools/internal/typesinternal/errorcode_string.go b/vendor/golang.org/x/tools/internal/typesinternal/errorcode_string.go
index de90e9515ae..15ecf7c5ded 100644
--- a/vendor/golang.org/x/tools/internal/typesinternal/errorcode_string.go
+++ b/vendor/golang.org/x/tools/internal/typesinternal/errorcode_string.go
@@ -8,6 +8,7 @@ func _() {
 	// An "invalid array index" compiler error signifies that the constant values have changed.
 	// Re-run the stringer command to generate them again.
 	var x [1]struct{}
+	_ = x[InvalidSyntaxTree - -1]
 	_ = x[Test-1]
 	_ = x[BlankPkgName-2]
 	_ = x[MismatchedPkgName-3]
@@ -23,7 +24,7 @@ func _() {
 	_ = x[InvalidConstInit-13]
 	_ = x[InvalidConstVal-14]
 	_ = x[InvalidConstType-15]
-	_ = x[UntypedNil-16]
+	_ = x[UntypedNilUse-16]
 	_ = x[WrongAssignCount-17]
 	_ = x[UnassignableOperand-18]
 	_ = x[NoNewVar-19]
@@ -152,16 +153,27 @@ func _() {
 	_ = x[MisplacedConstraintIface-142]
 	_ = x[InvalidMethodTypeParams-143]
 	_ = x[MisplacedTypeParam-144]
+	_ = x[InvalidUnsafeSliceData-145]
+	_ = x[InvalidUnsafeString-146]
 }
 
-const _ErrorCode_name = "TestBlankPkgNameMismatchedPkgNameInvalidPkgUseBadImportPathBrokenImportImportCRenamedUnusedImportInvalidInitCycleDuplicateDeclInvalidDeclCycleInvalidTypeCycleInvalidConstInitInvalidConstValInvalidConstTypeUntypedNilWrongAssignCountUnassignableOperandNoNewVarMultiValAssignOpInvalidIfaceAssignInvalidChanAssignIncompatibleAssignUnaddressableFieldAssignNotATypeInvalidArrayLenBlankIfaceMethodIncomparableMapKeyInvalidIfaceEmbedInvalidPtrEmbedBadRecvInvalidRecvDuplicateFieldAndMethodDuplicateMethodInvalidBlankInvalidIotaMissingInitBodyInvalidInitSigInvalidInitDeclInvalidMainDeclTooManyValuesNotAnExprTruncatedFloatNumericOverflowUndefinedOpMismatchedTypesDivByZeroNonNumericIncDecUnaddressableOperandInvalidIndirectionNonIndexableOperandInvalidIndexSwappedSliceIndicesNonSliceableOperandInvalidSliceExprInvalidShiftCountInvalidShiftOperandInvalidReceiveInvalidSendDuplicateLitKeyMissingLitKeyInvalidLitIndexOversizeArrayLitMixedStructLitInvalidStructLitMissingLitFieldDuplicateLitFieldUnexportedLitFieldInvalidLitFieldUntypedLitInvalidLitAmbiguousSelectorUndeclaredImportedNameUnexportedNameUndeclaredNameMissingFieldOrMethodBadDotDotDotSyntaxNonVariadicDotDotDotMisplacedDotDotDotInvalidDotDotDotOperandInvalidDotDotDotUncalledBuiltinInvalidAppendInvalidCapInvalidCloseInvalidCopyInvalidComplexInvalidDeleteInvalidImagInvalidLenSwappedMakeArgsInvalidMakeInvalidRealInvalidAssertImpossibleAssertInvalidConversionInvalidUntypedConversionBadOffsetofSyntaxInvalidOffsetofUnusedExprUnusedVarMissingReturnWrongResultCountOutOfScopeResultInvalidCondInvalidPostDeclInvalidChanRangeInvalidIterVarInvalidRangeExprMisplacedBreakMisplacedContinueMisplacedFallthroughDuplicateCaseDuplicateDefaultBadTypeKeywordInvalidTypeSwitchInvalidExprSwitchInvalidSelectCaseUndeclaredLabelDuplicateLabelMisplacedLabelUnusedLabelJumpOverDeclJumpIntoBlockInvalidMethodExprWrongArgCountInvalidCallUnusedResultsInvalidDeferInvalidGoBadDeclRepeatedDeclInvalidUnsafeAddInvalidUnsafeSliceUnsupportedFeatureNotAGenericTypeWrongTypeArgCountCannotInferTypeArgsInvalidTypeArgInvalidInstanceCycleInvalidUnionMisplacedConstraintIfaceInvalidMethodTypeParamsMisplacedTypeParam"
+const (
+	_ErrorCode_name_0 = "InvalidSyntaxTree"
+	_ErrorCode_name_1 = "TestBlankPkgNameMismatchedPkgNameInvalidPkgUseBadImportPathBrokenImportImportCRenamedUnusedImportInvalidInitCycleDuplicateDeclInvalidDeclCycleInvalidTypeCycleInvalidConstInitInvalidConstValInvalidConstTypeUntypedNilUseWrongAssignCountUnassignableOperandNoNewVarMultiValAssignOpInvalidIfaceAssignInvalidChanAssignIncompatibleAssignUnaddressableFieldAssignNotATypeInvalidArrayLenBlankIfaceMethodIncomparableMapKeyInvalidIfaceEmbedInvalidPtrEmbedBadRecvInvalidRecvDuplicateFieldAndMethodDuplicateMethodInvalidBlankInvalidIotaMissingInitBodyInvalidInitSigInvalidInitDeclInvalidMainDeclTooManyValuesNotAnExprTruncatedFloatNumericOverflowUndefinedOpMismatchedTypesDivByZeroNonNumericIncDecUnaddressableOperandInvalidIndirectionNonIndexableOperandInvalidIndexSwappedSliceIndicesNonSliceableOperandInvalidSliceExprInvalidShiftCountInvalidShiftOperandInvalidReceiveInvalidSendDuplicateLitKeyMissingLitKeyInvalidLitIndexOversizeArrayLitMixedStructLitInvalidStructLitMissingLitFieldDuplicateLitFieldUnexportedLitFieldInvalidLitFieldUntypedLitInvalidLitAmbiguousSelectorUndeclaredImportedNameUnexportedNameUndeclaredNameMissingFieldOrMethodBadDotDotDotSyntaxNonVariadicDotDotDotMisplacedDotDotDotInvalidDotDotDotOperandInvalidDotDotDotUncalledBuiltinInvalidAppendInvalidCapInvalidCloseInvalidCopyInvalidComplexInvalidDeleteInvalidImagInvalidLenSwappedMakeArgsInvalidMakeInvalidRealInvalidAssertImpossibleAssertInvalidConversionInvalidUntypedConversionBadOffsetofSyntaxInvalidOffsetofUnusedExprUnusedVarMissingReturnWrongResultCountOutOfScopeResultInvalidCondInvalidPostDeclInvalidChanRangeInvalidIterVarInvalidRangeExprMisplacedBreakMisplacedContinueMisplacedFallthroughDuplicateCaseDuplicateDefaultBadTypeKeywordInvalidTypeSwitchInvalidExprSwitchInvalidSelectCaseUndeclaredLabelDuplicateLabelMisplacedLabelUnusedLabelJumpOverDeclJumpIntoBlockInvalidMethodExprWrongArgCountInvalidCallUnusedResultsInvalidDeferInvalidGoBadDeclRepeatedDeclInvalidUnsafeAddInvalidUnsafeSliceUnsupportedFeatureNotAGenericTypeWrongTypeArgCountCannotInferTypeArgsInvalidTypeArgInvalidInstanceCycleInvalidUnionMisplacedConstraintIfaceInvalidMethodTypeParamsMisplacedTypeParamInvalidUnsafeSliceDataInvalidUnsafeString"
+)
 
-var _ErrorCode_index = [...]uint16{0, 4, 16, 33, 46, 59, 71, 85, 97, 113, 126, 142, 158, 174, 189, 205, 215, 231, 250, 258, 274, 292, 309, 327, 351, 359, 374, 390, 408, 425, 440, 447, 458, 481, 496, 508, 519, 534, 548, 563, 578, 591, 600, 614, 629, 640, 655, 664, 680, 700, 718, 737, 749, 768, 787, 803, 820, 839, 853, 864, 879, 892, 907, 923, 937, 953, 968, 985, 1003, 1018, 1028, 1038, 1055, 1077, 1091, 1105, 1125, 1143, 1163, 1181, 1204, 1220, 1235, 1248, 1258, 1270, 1281, 1295, 1308, 1319, 1329, 1344, 1355, 1366, 1379, 1395, 1412, 1436, 1453, 1468, 1478, 1487, 1500, 1516, 1532, 1543, 1558, 1574, 1588, 1604, 1618, 1635, 1655, 1668, 1684, 1698, 1715, 1732, 1749, 1764, 1778, 1792, 1803, 1815, 1828, 1845, 1858, 1869, 1882, 1894, 1903, 1910, 1922, 1938, 1956, 1974, 1989, 2006, 2025, 2039, 2059, 2071, 2095, 2118, 2136}
+var (
+	_ErrorCode_index_1 = [...]uint16{0, 4, 16, 33, 46, 59, 71, 85, 97, 113, 126, 142, 158, 174, 189, 205, 218, 234, 253, 261, 277, 295, 312, 330, 354, 362, 377, 393, 411, 428, 443, 450, 461, 484, 499, 511, 522, 537, 551, 566, 581, 594, 603, 617, 632, 643, 658, 667, 683, 703, 721, 740, 752, 771, 790, 806, 823, 842, 856, 867, 882, 895, 910, 926, 940, 956, 971, 988, 1006, 1021, 1031, 1041, 1058, 1080, 1094, 1108, 1128, 1146, 1166, 1184, 1207, 1223, 1238, 1251, 1261, 1273, 1284, 1298, 1311, 1322, 1332, 1347, 1358, 1369, 1382, 1398, 1415, 1439, 1456, 1471, 1481, 1490, 1503, 1519, 1535, 1546, 1561, 1577, 1591, 1607, 1621, 1638, 1658, 1671, 1687, 1701, 1718, 1735, 1752, 1767, 1781, 1795, 1806, 1818, 1831, 1848, 1861, 1872, 1885, 1897, 1906, 1913, 1925, 1941, 1959, 1977, 1992, 2009, 2028, 2042, 2062, 2074, 2098, 2121, 2139, 2161, 2180}
+)
 
 func (i ErrorCode) String() string {
-	i -= 1
-	if i < 0 || i >= ErrorCode(len(_ErrorCode_index)-1) {
-		return "ErrorCode(" + strconv.FormatInt(int64(i+1), 10) + ")"
+	switch {
+	case i == -1:
+		return _ErrorCode_name_0
+	case 1 <= i && i <= 146:
+		i -= 1
+		return _ErrorCode_name_1[_ErrorCode_index_1[i]:_ErrorCode_index_1[i+1]]
+	default:
+		return "ErrorCode(" + strconv.FormatInt(int64(i), 10) + ")"
 	}
-	return _ErrorCode_name[_ErrorCode_index[i]:_ErrorCode_index[i+1]]
 }
diff --git a/vendor/modules.txt b/vendor/modules.txt
index 73c8a544676..04f6babe63d 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -427,13 +427,13 @@ go.uber.org/zap/internal/exit
 go.uber.org/zap/zapcore
 go.uber.org/zap/zapgrpc
 go.uber.org/zap/zaptest/observer
-# golang.org/x/crypto v0.1.0
-## explicit; go 1.17
+# golang.org/x/crypto v0.17.0
+## explicit; go 1.18
 golang.org/x/crypto/sha3
-# golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4
+# golang.org/x/mod v0.8.0
 ## explicit; go 1.17
 golang.org/x/mod/semver
-# golang.org/x/net v0.7.0
+# golang.org/x/net v0.10.0
 ## explicit; go 1.17
 golang.org/x/net/html
 golang.org/x/net/html/atom
@@ -444,15 +444,14 @@ golang.org/x/net/http2/hpack
 golang.org/x/net/idna
 golang.org/x/net/internal/timeseries
 golang.org/x/net/trace
-# golang.org/x/sys v0.5.0
-## explicit; go 1.17
+# golang.org/x/sys v0.15.0
+## explicit; go 1.18
 golang.org/x/sys/cpu
 golang.org/x/sys/execabs
-golang.org/x/sys/internal/unsafeheader
 golang.org/x/sys/unix
 golang.org/x/sys/windows
-# golang.org/x/text v0.7.0
-## explicit; go 1.17
+# golang.org/x/text v0.14.0
+## explicit; go 1.18
 golang.org/x/text/encoding
 golang.org/x/text/encoding/charmap
 golang.org/x/text/encoding/htmlindex
@@ -473,19 +472,20 @@ golang.org/x/text/secure/bidirule
 golang.org/x/text/transform
 golang.org/x/text/unicode/bidi
 golang.org/x/text/unicode/norm
-# golang.org/x/tools v0.1.12
+# golang.org/x/tools v0.6.0
 ## explicit; go 1.18
 golang.org/x/tools/go/gcexportdata
-golang.org/x/tools/go/internal/gcimporter
 golang.org/x/tools/go/internal/packagesdriver
-golang.org/x/tools/go/internal/pkgbits
 golang.org/x/tools/go/packages
 golang.org/x/tools/internal/event
 golang.org/x/tools/internal/event/core
 golang.org/x/tools/internal/event/keys
 golang.org/x/tools/internal/event/label
+golang.org/x/tools/internal/gcimporter
 golang.org/x/tools/internal/gocommand
 golang.org/x/tools/internal/packagesinternal
+golang.org/x/tools/internal/pkgbits
+golang.org/x/tools/internal/tokeninternal
 golang.org/x/tools/internal/typeparams
 golang.org/x/tools/internal/typesinternal
 # golang.org/x/xerrors v0.0.0-20200804184101-5ec99f83aff1